{"$update": {"344": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "345": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "346": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "347": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "340": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "341": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "342": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "343": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "348": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "349": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1653": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "298": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "299": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "296": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "297": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "294": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "295": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "292": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "293": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "290": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "291": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "270": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "271": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "272": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "273": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "274": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "275": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "276": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "277": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "278": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "279": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1132": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1004": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2189": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "108": {"$update": {"ARO_description": "PDC-8 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "109": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "102": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "103": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "100": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "101": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "106": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "107": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "104": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "105": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2046": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2047": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2044": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2045": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2042": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2043": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2040": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2041": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2048": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2049": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2038": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "99": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "98": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "91": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "90": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "93": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "92": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "95": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "94": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "97": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "96": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1623": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1622": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1621": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1620": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1627": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1626": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1625": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1624": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1999": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1998": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1629": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1628": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "559": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "558": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "555": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "554": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "557": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "556": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "551": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "550": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "553": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "552": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1199": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1198": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1191": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1190": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1193": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1192": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1195": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1194": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1197": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1196": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1759": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1758": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1757": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1756": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1755": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1754": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1753": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1752": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1751": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1750": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1177": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1176": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1175": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1174": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1173": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1172": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1171": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1170": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1179": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1178": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "511": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "510": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1005": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1285": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1284": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1287": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "512": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1281": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1280": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1283": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1282": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1003": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1289": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1288": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "514": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1579": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1578": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "689": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "688": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "685": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "684": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "687": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "686": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "681": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "680": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "683": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "682": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "623": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1226": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "621": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "873": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1224": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "627": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1222": {"$update": {"ARO_description": "An enzyme that confers resistance to fosfomycin in Serratia marcescens by breaking the epoxide ring of the molecule. It depends on the cofactors Manganese (II) and Potassium and uses Glutathione (GSH) as the nucleophilic molecule. In Pseudomonas aeruginosa, FosA catalyzes the conjugation of glutathione to carbon-1 of fosfomycin, rendering it ineffective as an antibacterial drug.", "model_type": "protein homolog model", "model_sequences": {"$update": {"sequence": {"$insert": {"3366": {"dna_sequence": {"fmax": "1222098", "fmin": "1221690", "accession": "NC002516", "strand": "+", "sequence": "ATGCTTACCGGTCTCAATCACCTGACCCTGGCGGTCGCCGACCTGCCGGCCAGCATCGCCTTCTACCGCGATCTTCTCGGCTTTCGCCTGGAAGCGCGCTGGGACCAGGGCGCCTATCTCGAACTGGGTTCGCTGTGGCTGTGCCTGTCCCGGGAGCCGCAGTACGGCGGGCCGGCCGCGGACTACACGCACTACGCCTTCGGCATCGCCGCCGCGGATTTCGCCCGCTTCGCCGCGCAGCTGCGCGCGCATGGCGTGCGCGAATGGAAGCAGAACCGCAGCGAGGGCGATTCGTTCTACTTCCTCGACCCGGACGGCCATCGCCTGGAGGCCCACGTCGGCGACCTGCGCAGCCGGCTCGCGGCGTGCCGGCAAGCGCCCTATGCGGGAATGCGTTTCGCCGACTAG"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_249820.1", "sequence": "MLTGLNHLTLAVADLPASIAFYRDLLGFRLEARWDQGAYLELGSLWLCLSREPQYGGPAADYTHYAFGIAAADFARFAAQLRAHGVREWKQNRSEGDSFYFLDPDGHRLEAHVGDLRSRLAACRQAPYAGMRFAD"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1221": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "624": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "407": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1370": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "405": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1372": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1375": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1374": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1377": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "400": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1379": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1378": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1342": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "409": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "408": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "453": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "454": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "455": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1346": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1347": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1245": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "379": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "378": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "371": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "370": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "373": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "372": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "375": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "374": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "377": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "376": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "393": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "392": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "391": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "390": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "397": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "396": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "395": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "394": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "399": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "398": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1247": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "245": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "244": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "247": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "246": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "241": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "240": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "243": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "242": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "249": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3375": {"dna_sequence": {"fmax": "1434", "fmin": "0", "accession": "JQ340365", "strand": "+", "sequence": "ATGTCCCGTGCCGCCGTCCCCTCCGTCCGCCGGCGCCTGCTGGTCAACCTGCTGGTCGGCTTCGTGCTGTGCTGGCTGAGCGTGGCGGCGCTGACCTACCACCTCTCGCTGAAGCAGGTGAACCGCCTGTTCGACGACGACATGGTGGACTTCGGCGAAGCCGCCCTGCGCCTGCTCGACCTTGCCACCGAAGACCAGGCCGGCGAGGACGGCTCCATCACCGAGATCATCGAACGCAGCCGCGAAGCGATCCAGGGTCTGCCCCTGCTGCGCCGCGAAAGCGCCCTCGGCTACGCCCTGTGGCGCGACGGCCAGCCGCTGCTGTCGAGCCTCAACCTGCCGCCGGAGATCACGGCCCAGGGCCCCGGCTTCAGCACCGTGGAAGCCCAGGGCACCCACTGGCGGGTGCTCCAGCTGAACATCGACGGCTTCCAGATCTGGATCAGCGAAAACCTGATCTACCGCCAGCACACCATGAACCTGCTGCTGTTCTACTCGCTGTTCCCACTGCTGCTGGCGCTGCCGTTGCTCGGCGGCCTGGTCTGGTTCGGCGTTGCCCGCGGCCTGGCGCCGCTACGCGAAGTGCAGGCCGAGGTCCAGCAGCGCTCCGCGCGACACCTGCAGCCGATCGCGGTGGAAGCGGTGCCGCTGGAGATCCGCGGCCTCATCGACGAACTCAACCTCCTGCTGGAGCGTCTGCGCACCGCCCTCGAGGCCGAACGCCGACTGACCAGCGACGCCGCCCATGAAATCCGCACGCCACTGGCCAGCCTGCGCACCCATGCCCAGGTCGCGCTGCGTTCGGAAGACCCCAAGGCCCACGCCCGCGGCCTGCTGCAAGTCAGTCGCAGCGTCGAGCGGATCAGCACCTTGATGGAGCAGATCCTGCTCCTCGCCCGCCTCGACGGCGACGCCCTGCTGGAGCAATTCCACCCGGTCAACCTCGCCACCCTGGCCGAAGACGTACTCTCCGAACTGGCGCGCCAGGCCATCGACAAGGACATCGAGCTGTCGTTGCACCAGGAGACCGTGCACGTGATGGGCATCGACCTGTGGCTGAAGGCGATGGTCGGCAACCTGGTGGGCAACGCCCTGCGCTACACACCGGCCGGGGGCCAGGTCGAGATCCGCGTCGAGAATCGCGCCCAGCACGCCGTGCTGCGGGTGCGCGACAACGGCCCCGGGGTCGCCCTGGAAGAGCAGCAGGCGATCTTCACCCGCTTCTACCGCAGCCCCGCCACCAGCAGCGGCGAGGGCAGCGGCCTGGGCCTGCCGATCGTCAAGCGCATCGTCGAACTGCACTTCGGCAGTATCGGCCTGGGCAAGGGACTGGAGGGCAAAGGGCTGGAAGTGCAGGTGTTCCTGCCGAAGACCCAGCCGGACGCGACGCGGCCGCCGGCCAGAGGTCCGGACAGCGGGCGGTCACATATCTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AEX49906.1", "sequence": "MSRAAVPSVRRRLLVNLLVGFVLCWLSVAALTYHLSLKQVNRLFDDDMVDFGEAALRLLDLATEDQAGEDGSITEIIERSREAIQGLPLLRRESALGYALWRDGQPLLSSLNLPPEITAQGPGFSTVEAQGTHWRVLQLNIDGFQIWISENLIYRQHTMNLLLFYSLFPLLLALPLLGGLVWFGVARGLAPLREVQAEVQQRSARHLQPIAVEAVPLEIRGLIDELNLLLERLRTALEAERRLTSDAAHEIRTPLASLRTHAQVALRSEDPKAHARGLLQVSRSVERISTLMEQILLLARLDGDALLEQFHPVNLATLAEDVLSELARQAIDKDIELSLHQETVHVMGIDLWLKAMVGNLVGNALRYTPAGGQVEIRVENRAQHAVLRVRDNGPGVALEEQQAIFTRFYRSPATSSGEGSGLGLPIVKRIVELHFGSIGLGKGLEGKGLEVQVFLPKTQPDATRPPARGPDSGRSHI"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "248": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "179": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "178": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "177": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "176": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "175": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "174": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "173": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "172": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "171": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "170": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2051": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2050": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2053": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2052": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2055": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2054": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2057": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2056": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2059": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2058": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1500": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1501": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1506": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1507": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1504": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1505": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1977": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1976": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "659": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1975": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1974": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1973": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1972": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1971": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1970": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1968": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1969": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1618": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1619": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1616": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1617": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1614": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1615": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1960": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1613": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1610": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1611": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1768": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1769": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1762": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1763": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1760": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1761": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1766": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1767": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1764": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1765": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1142": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1143": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1140": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1141": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1146": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1147": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1144": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1145": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1148": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1149": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "690": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "692": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "693": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1544": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "691": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "696": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "697": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "694": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "695": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "698": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "699": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1548": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1549": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "542": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "543": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "540": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "541": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "546": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "547": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "544": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "545": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "548": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "549": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1782": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1783": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1784": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1785": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1786": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1787": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "414": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "415": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "416": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "417": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "410": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "411": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "412": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "413": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1384": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1385": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1386": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1387": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1380": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "419": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1382": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1383": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "368": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "369": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "366": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "367": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "364": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "365": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "362": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "363": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "360": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "361": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "380": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "381": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "382": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "383": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3372": {"dna_sequence": {"fmax": "2029", "fmin": "682", "accession": "JN868716", "strand": "+", "sequence": "GTGATCCGTTCCCTGCGCATCCGTCTGATGCTCGGCGCCGCCGCCCTGGCGGTGCTGTTCATGCTGGCGCTGCTGCCGGCCCTGCAGCGGGCCTTCGGCATCGCCCTGGAGAACACCATCGAGCAGCGCCTGGCCGCCGACGTGGCGACCCTGGTCTCGGCGGCGCGGGTGGAGAAGGGCCGCCTGGTGATGCCCGAGCACCTGCCGGTGGAGGAGTTCAACCTGCCGGAGGCCAAGGTCCTCGGCTATATCTACGACCAGAATGGCGATCTGCTCTGGCGCTCCACCTCGGCGGCCGACGAGTCGATCAACTACACGCCGCGCTACGACGGCCGCGGCAACGAATTCCACACCACCCGCGATGCGAAGGGCGAGGAGTTCTTCGTGTTCGACGTCGAGATCGACCTGCTGCGCGGCAAGCAGGCGGCCTACAGCATCGTCACCATGCAATCGGTCAGCGAGTTCGAGAGCCTGCTCAAGGGGTTCCGCGAGCAGCTCTACCTGTGGCTCGGCGGCGCCCTGCTGGTCTTGCTCGGGCTGCTCTGGCTGGGTCTGACCTGGGGCTTCCGGGCGATGCGCGGGTTGAGTTCCGAGCTGGACCAGATCGAATCCGGCGAGCGCGAGAGCCTGAGCGAGGAGCATCCGCGCGAGCTGCTGCGCCTGACCCACTCGCTGAACCGCCTGTTGCGCAGCGAGCACAAGCAGCGCGAGCGCTACCGCCACTCCCTCGGCGACCTGGCGCACAGTCTGAAGACGCCGCTGGCGGTCTTGCAGGGGGTCGGCGACCAGCTCGCCGAGGAGCCCGGCAACCGCGAGCAGGTGCGGGTGCTACAGGGCCAGATCGAGCGCATGAGCCAGCAGATAGGCTATCAGTTGCAGCGCGCCAGCCTGCGCAAGAGCGGCCTGGTACGCCATCGCGAGCAACTGGCGCCGCTGGTGGAGACCCTGTGCGACGCGCTGGACAAGGTCTATCGCGACAAGCGGGTAAGCCTGCAGCGGGACTTCTCGCCGTCCTTCAGCGTGCCGGTGGAGCGCGGCGCGCTGCTGGAACTGCTCGGCAACCTGCTGGAGAACGCCTATCGCCTGTGCCTGGGCCGGGTCCGCGTGGGCGCCCGGCTGGGGCCGGGTTACTCGGAGCTGTGGGTCGAGGACGACGGTCCCGGAGTGCCTGCCGAACAGCGCGCACGAATCATCCGCCGCGGCGAGCGCGCCGATACCCAGCACCCGGGGCAGGGCATCGGCCTGGCCGTGGCGCTGGACATCATCGAGAGCTACGACGGCGAACTGAGCCTGGACGATTCCGAGCTGGGCGGCGCCTGCTTCCGCATACGTTTCGCTACAGTCTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AEU17992.1", "sequence": "MIRSLRIRLMLGAAALAVLFMLALLPALQRAFGIALENTIEQRLAADVATLVSAARVEKGRLVMPEHLPVEEFNLPEAKVLGYIYDQNGDLLWRSTSAADESINYTPRYDGRGNEFHTTRDAKGEEFFVFDVEIDLLRGKQAAYSIVTMQSVSEFESLLKGFREQLYLWLGGALLVLLGLLWLGLTWGFRAMRGLSSELDQIESGERESLSEEHPRELLRLTHSLNRLLRSEHKQRERYRHSLGDLAHSLKTPLAVLQGVGDQLAEEPGNREQVRVLQGQIERMSQQIGYQLQRASLRKSGLVRHREQLAPLVETLCDALDKVYRDKRVSLQRDFSPSFSVPVERGALLELLGNLLENAYRLCLGRVRVGARLGPGYSELWVEDDGPGVPAEQRARIIRRGERADTQHPGQGIGLAVALDIIESYDGELSLDDSELGGACFRIRFATV"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "384": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "385": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "386": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "387": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "388": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "389": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "258": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "259": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "252": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "253": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "250": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "251": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "256": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "257": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "254": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "255": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1849": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1848": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "168": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "169": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "164": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "165": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "166": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "167": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "160": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "161": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "162": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "163": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1980": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1841": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1840": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "678": {"$update": {"ARO_description": "PDC-10 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "679": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1814": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1815": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1816": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1817": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1810": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1811": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1812": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1813": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1818": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1819": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "670": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "671": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1609": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1608": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1979": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1978": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1601": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1600": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3371": {"dna_sequence": {"fmax": "686", "fmin": "8", "accession": "JN868721", "strand": "+", "sequence": "ATGAAACTGCTGGTAGTGGAAGACGAGGCGCTGTTGCGCCACCACCTCTATACCCGCCTGGGTGAACAGGGGCACGTGGTGGACGCGGTACCGGATGCCGAGGAAGCCCTCTACCGGGTCAGCGAATACCACCACGACCTGGCGGTGATCGACCTCGGCCTGCCGGGCATGAGCGGCCTGGACCTGATCCGCGAGCTGCGTTCGCAGGGCAAGTCCTTCCCGATCCTGATCCTCACCGCCCGCGGCAACTGGCAGGACAAGGTCGAAGGCCTGGCCGCCGGGGCCGACGACTACGTGGTCAAGCCGTTCCAGTTCGAGGAACTGGAAGCGCGCCTGAACGCGTTGCTGCGACGCTCCTCGGGGTTCGTCCAGTCGACCATCGAGGCCGGCCCCCTGGTCCTCGACCTGAACCGCAAGCAGGCGCTGGTCGAGGAGCAACCGGTGGCGCTGACCGCCTACGAATACCGCATCCTCGAATACCTCATGCGGCATCACCAGCAGGTGGTGGCCAAGGAACGCCTGATGGAACAGCTCTACCCCGACGACGAGGAGCGCGACGCCAACGTCATCGAGGTGCTGGTCGGCCGCCTGCGGCGCAAGCTGGAGGCCTGCGGCGGCTTCAAGCCGATCGATACGGTGCGCGGCCAGGGCTACCTGTTCACCGAGCGCTGCCGGTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AEU18003.1", "sequence": "MKLLVVEDEALLRHHLYTRLGEQGHVVDAVPDAEEALYRVSEYHHDLAVIDLGLPGMSGLDLIRELRSQGKSFPILILTARGNWQDKVEGLAAGADDYVVKPFQFEELEARLNALLRRSSGFVQSTIEAGPLVLDLNRKQALVEEQPVALTAYEYRILEYLMRHHQQVVAKERLMEQLYPDDEERDANVIEVLVGRLRRKLEACGGFKPIDTVRGQGYLFTERCR"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1603": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1602": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1605": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1604": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1607": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1606": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "809": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "808": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "803": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "802": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "801": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "800": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "807": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "806": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "805": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "804": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1775": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1774": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1777": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1776": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1771": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1770": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1773": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1772": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1779": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1778": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1159": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1158": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1155": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1154": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1157": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1156": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1151": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1150": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1153": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1152": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1555": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1554": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1551": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1550": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1553": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1552": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "59": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "58": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1557": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1556": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1559": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "54": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "57": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "56": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "51": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "50": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "53": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "52": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "537": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "55": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "535": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "534": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "533": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "532": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "531": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "530": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "539": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "538": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1558": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "536": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "429": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "428": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1399": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1398": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1397": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "420": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "423": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "422": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "425": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1392": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "427": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1390": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2183": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2182": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2181": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2180": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2187": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2186": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "229": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "228": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "227": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "226": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "225": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "224": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "223": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "222": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "221": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "220": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "151": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "150": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "153": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "152": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "155": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "154": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "157": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "156": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "159": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "158": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1807": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1806": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1805": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1804": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1803": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1802": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1801": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1800": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1809": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1808": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1524": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1948": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1949": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1525": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1942": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1943": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1940": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1941": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1946": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1947": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1944": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1945": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "818": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "819": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1527": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "810": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "811": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "812": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "813": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "814": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "815": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "816": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "817": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1991": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1522": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1990": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1523": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1993": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1490": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "421": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1492": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1493": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1494": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1495": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1496": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1497": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1498": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1499": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1395": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1994": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1700": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1701": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1702": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1703": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1704": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1705": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1706": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1707": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1708": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1709": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1996": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "424": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1391": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "426": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1128": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1129": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1120": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1121": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1122": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1123": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1124": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1125": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1126": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1127": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "524": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "525": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "526": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "527": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1018": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "521": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "522": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "523": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1014": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1015": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1016": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1017": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "528": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "529": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1012": {"$update": {"ARO_description": "KPC-5 is a beta-lactamase found in Klebsiella pneumoniae and Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1013": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1234": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1235": {"$update": {"ARO_accession": "3003676", "ARO_name": "AAC(6')-Ib'", "ARO_description": "AAC(6')-Ib' is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in P. aeruginosa and P. fluorescens.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40308"}}, "1236": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1237": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1230": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1231": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1232": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1233": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1238": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1239": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "438": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "439": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "436": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "437": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "434": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "435": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "432": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "433": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "430": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "431": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1967": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1961": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "238": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "239": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "234": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "235": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "236": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "237": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "230": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "231": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "232": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "233": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1": {"$update": {"ARO_description": "PDC-4 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "146": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "147": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "144": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "145": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "142": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "143": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "140": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "141": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "148": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "149": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2088": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2089": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2082": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2083": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2080": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2081": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2086": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2087": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2084": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2085": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1832": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1833": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1830": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$delete": ["544"]}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1831": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1836": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1837": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1834": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1835": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1838": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1839": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2154": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2155": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "939": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2157": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2150": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2151": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2152": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2153": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "933": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "932": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "931": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "930": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "937": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "936": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "935": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "934": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1955": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1954": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1957": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1956": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1951": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1950": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1953": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1952": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1959": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1958": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "829": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "828": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "825": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "824": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "827": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "826": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "821": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "820": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "823": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "822": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1536": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1483": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1482": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1481": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1480": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1487": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1486": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1485": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1484": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1489": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1488": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "797": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "928": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "795": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "794": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "793": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "792": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "791": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2146": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1719": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1718": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "799": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "798": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1270": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "613": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1272": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1139": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1138": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1133": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "616": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1131": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1130": {"$update": {"ARO_description": "PDC-9 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1137": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1136": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1135": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$insert": {"36616": {"category_aro_name": "aminocoumarin resistance gene", "category_aro_cvterm_id": "36616", "category_aro_accession": "3000477", "category_aro_description": "Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance"}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1134": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "614": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "476": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1277": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "519": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "518": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "926": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1009": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1008": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1007": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1006": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "513": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "927": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "515": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1002": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1001": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1000": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1227": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "622": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1225": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "620": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1223": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "626": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "625": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1220": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "629": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "628": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1229": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1228": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1535": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1561": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1286": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "11": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "10": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "13": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "12": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "15": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "14": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "17": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "16": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "19": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "18": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1534": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "201": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "200": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "203": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "202": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "205": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "204": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "207": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "206": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "209": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "208": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1573": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1572": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1571": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1570": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1577": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1576": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1575": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1574": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2185": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2184": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2095": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2094": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2097": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2096": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2091": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2090": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2093": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2092": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2099": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2098": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2188": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1829": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1828": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1825": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1824": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1827": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1826": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1821": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1820": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1823": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1822": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$insert": {"36616": {"category_aro_name": "aminocoumarin resistance gene", "category_aro_cvterm_id": "36616", "category_aro_accession": "3000477", "category_aro_description": "Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance"}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2147": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "929": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2145": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2144": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2143": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2142": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2141": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2140": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "920": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "921": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "922": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "923": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "924": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "925": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2149": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2148": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1920": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1921": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1922": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1923": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1924": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1925": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1926": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1927": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1928": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1929": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "832": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "833": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "830": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "831": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "836": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "837": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "834": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "835": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "838": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "839": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "3": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1986": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1987": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1532": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "784": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "785": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "786": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "787": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "780": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "781": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "782": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1729": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1726": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1727": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1724": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1725": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "788": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "789": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1720": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1721": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "60": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "61": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "62": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "63": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3370": {"dna_sequence": {"fmax": "2604", "fmin": "1965", "accession": "AY954726", "strand": "+", "sequence": "TTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAACCCTTCCATCGAGGGGGACGTCCAAGGGCTGGCGCCCTTGGCCGCCCCTCATGTCAAACG"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AAX54878.1", "sequence": "MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "64": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "65": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "66": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "67": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "68": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "69": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1371": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1588": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1589": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "406": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1582": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1583": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1580": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1581": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1586": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1373": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1584": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1585": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1038": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "404": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "508": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "509": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1032": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "507": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "504": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1031": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "502": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "503": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1034": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "402": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1212": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1213": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1210": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1211": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1216": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "401": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "636": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "637": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "638": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "639": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1218": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1219": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1394": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "465": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1728": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "783": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1106": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1107": {"$update": {"ARO_description": "PDC-2 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1104": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1105": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1450": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1103": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1100": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1101": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1458": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1459": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1108": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1109": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1722": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1723": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2136": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2137": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1393": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "216": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "217": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "214": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "215": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "212": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "213": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "210": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "211": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1530": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "218": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "219": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2138": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2139": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "462": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "4": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1858": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1859": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1850": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1851": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1852": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1853": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1854": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1855": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1856": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1857": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2172": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2173": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2170": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2171": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "919": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "918": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2174": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "915": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "914": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "917": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "916": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "911": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "910": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "913": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "912": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1933": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1932": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1931": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1930": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1937": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1936": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1935": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1934": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1939": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1938": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "458": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "847": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "846": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "845": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "844": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "843": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "842": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "841": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "840": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "849": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "848": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1587": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1739": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1738": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1731": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1730": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1733": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1732": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1735": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1734": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1737": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1736": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1039": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "796": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "753": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "752": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "751": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "750": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "757": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "756": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "755": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "754": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "759": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "758": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1595": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "506": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1597": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1596": {"$update": {"ARO_description": "OXA-24 is a beta-lactamase found in A. baumannii and P. aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1591": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1590": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1593": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1592": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1599": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1030": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1025": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1024": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1027": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1026": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1021": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1020": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1023": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1022": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1036": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1029": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1028": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1037": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "500": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "501": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "605": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "604": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "607": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "606": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "601": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "600": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "603": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "602": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1205": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1204": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1207": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1206": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "609": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1200": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1203": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1202": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "633": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "634": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1217": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1214": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1215": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1111": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1110": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1113": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1112": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1115": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1114": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1117": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1440": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1119": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1118": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "467": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1449": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1448": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "466": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1357": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "460": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1355": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "489": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "488": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "487": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "486": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "485": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "484": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "483": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "482": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "481": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "480": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "790": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "199": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "198": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "195": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "194": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "197": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "196": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "191": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "190": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "193": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "192": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1454": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1455": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1456": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1457": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1102": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1451": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1452": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1453": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "902": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "903": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "900": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "901": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "906": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "907": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "904": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "905": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1843": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3367": {"dna_sequence": {"fmax": "9632", "fmin": "8888", "accession": "DQ914960", "strand": "-", "sequence": "TCATTTTCGTTTCAGCACGTAAAACAGCTCGTTTTCGCCGGTCAGCCGCGCGGCAATCGCGCGATTTTCCGGCACGTGCGCCTCCATCCATTCGGAATAGTGCTTTTCCATGCCGACGTTGCGCCCGCCGAGCGAACGCGTCGGAAACGATGCGACGATCCATTCCGCATTCACGCGCATTAGCGCATCCATCGCCGCGCCCGCACGCTGGCGCTCCAAAAGCGGCAGCACCTTAAACAGCAGCGCCGCATTCGCCTCGTCTTCCGGGATTTCGCACAGCAAATCGCCCAAACGCGCTTCCGCGCCGCCAAACGCACGAATTACGTTTACGCACTGACCGCTGATATCCACGCCGGTAATCGCCGCATTTGGCAATCGATGCGCGAGGTAGACAGGATTCAGCCCGCACGCGAGATCGAGGATTCGCGCCGGCGTTCCGCTGGCTTCAAACAGCTGATCGAACACGCGATCCATCGATTCCACAGGCAGCCGTTCGCGCGTGGACGCGTGCATTCCAAGCAGCGCTTCCCAATCGCGTGCCGCCGCCATTTCCATTGCGCGTTTGTATTCGCGCTCGGTCATGAACGCGCCGGTCACGCCGTGAAGCGCTTCGCGCGCCGCCTTGTCCACGTCCTTTTCCTTTTTGAATTTCGCGCTGCATTCACGCCATATGCGCTCGATCGTGTCCGGGCAAACGTCGCGATATTTTTTCGAAGCGAGCAGTTTTTCCTTCAGTTCGCTCAT"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "ABJ53409.1", "sequence": "MSELKEKLLASKKYRDVCPDTIERIWRECSAKFKKEKDVDKAAREALHGVTGAFMTEREYKRAMEMAAARDWEALLGMHASTRERLPVESMDRVFDQLFEASGTPARILDLACGLNPVYLAHRLPNAAITGVDISGQCVNVIRAFGGAEARLGDLLCEIPEDEANAALLFKVLPLLERQRAGAAMDALMRVNAEWIVASFPTRSLGGRNVGMEKHYSEWMEAHVPENRAIAARLTGENELFYVLKRK"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1842": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "908": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "909": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1847": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1846": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1845": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1844": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2169": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2168": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2165": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2164": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2167": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2166": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2161": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2160": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2163": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2162": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1908": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1909": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1906": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1907": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1904": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1905": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1902": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1903": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1900": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1901": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "854": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "855": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "856": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "857": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "850": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "851": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "852": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "853": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "858": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "859": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "6": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "740": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "741": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "742": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "743": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "744": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "745": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "746": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "747": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "748": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "749": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1050": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1051": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1052": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1053": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1054": {"$update": {"ARO_description": "EmrE is a small multidrug transporter that functions as a homodimer and that couples the efflux of small polyaromatic cations from the cell with the import of protons down an electrochemical gradient. EmrE is found in E. coli and P. aeruginosa.", "model_type": "protein homolog model", "model_sequences": {"$update": {"sequence": {"$insert": {"3368": {"dna_sequence": {"fmax": "5606435", "fmin": "5606102", "accession": "NC_002516.2", "strand": "+", "sequence": "ATGACCAACTATCTCTACCTCGCCATCGCCATCGCCGCCGAAGTGGTCGCCACCACCTCGCTGAAAGCCGTCGCCGGATTCAGCAAGCCACTGCCGCTGCTGCTGGTGGTGGGCGGCTACGTGCTCGCCTTCAGCATGCTCGTGCTGGTCATGCGCACCCTGCCGGTCGGCGTGGTCTACGCCATCTGGTCCGGACTCGGCATCGTCCTGGTCAGCCTGGTGGCGATGTTCGTCTACGGCCAGCGCCTGGACCCCGCCGCCCTCCTCGGCATCGGCCTGATCATCGCCGGCGTGCTGGTGATCCAGTTGTTCTCCCGCGCTTCGGGGCACTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_253677.1", "sequence": "MTNYLYLAIAIAAEVVATTSLKAVAGFSKPLPLLLVVGGYVLAFSMLVLVMRTLPVGVVYAIWSGLGIVLVSLVAMFVYGQRLDPAALLGIGLIIAGVLVIQLFSRASGH"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1055": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1056": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1057": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1058": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1059": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1696": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1697": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1694": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1695": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1692": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1693": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1690": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1691": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1791": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1698": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1699": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1278": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1279": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "618": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "619": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "612": {"$update": {"ARO_description": "PDC-7 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1271": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "610": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "611": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1274": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "617": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1276": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "615": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1795": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1794": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1491": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1472": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1473": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1470": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1471": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1476": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1477": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1474": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1475": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1478": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1479": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1304": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1305": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1306": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1307": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1300": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1301": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1302": {"$update": {"ARO_description": "tet34 causes the activation of Mg2+-dependent purine nucleotide synthesis, which protects the protein synthesis pathway. It is found in Gram-negative Vibrio", "model_type": "protein homolog model", "ARO_category": {"36021": {"category_aro_name": "gene conferring antibiotic resistance via molecular bypass", "category_aro_cvterm_id": "36021", "category_aro_accession": "3000012", "category_aro_description": "Genes involved in restructuring of the cell wall"}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1303": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1308": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1309": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "498": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "499": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "494": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "495": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "496": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "497": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "490": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "491": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "492": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "493": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "24": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "25": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "26": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "27": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "20": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "21": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "22": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "23": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "28": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "29": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1241": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "7": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1087": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1086": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1085": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1876": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1877": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1874": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1875": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1872": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1873": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1870": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1871": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1083": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1878": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1879": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "977": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "976": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "975": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "974": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "973": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "972": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "971": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "970": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1080": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "979": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "978": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "182": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "183": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "180": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "181": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "186": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "187": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "184": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "185": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2110": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2111": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "188": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2113": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2114": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2115": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2116": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2117": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1919": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1918": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1911": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1910": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1913": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1912": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1915": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1914": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1917": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1916": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "869": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "868": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "189": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "861": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "860": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "863": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "862": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "865": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "864": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "867": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "866": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2024": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2025": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2026": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2027": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2020": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2021": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2022": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2023": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2028": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2029": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1502": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "883": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "882": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "881": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "880": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "887": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "886": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "885": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "884": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "889": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "888": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1503": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "775": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "774": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "777": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "776": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "771": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "770": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "773": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "772": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "779": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "778": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "77": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "76": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "75": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "74": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "73": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "72": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "71": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "70": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "79": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "78": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1043": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1042": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1041": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1040": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1047": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1046": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1045": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1044": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1049": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1048": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1681": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1680": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1683": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1682": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1685": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1684": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1687": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1686": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1689": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1688": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1269": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1268": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "669": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "668": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "667": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1262": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "665": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "664": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "663": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "662": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1265": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1264": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "640": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1469": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1468": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1465": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "520": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1467": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1466": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1461": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1460": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1463": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1019": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1317": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1316": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1315": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1314": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1313": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1312": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1311": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1310": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1319": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1318": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1010": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "464": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1011": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "319": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "318": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "313": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "312": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "311": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "310": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "317": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "316": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "315": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "314": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1335": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1334": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1337": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1336": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1331": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1330": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1333": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1332": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "630": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "631": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "632": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3374": {"dna_sequence": {"fmax": "685", "fmin": "19", "accession": "JQ340367", "strand": "+", "sequence": "ATGAGAATACTGCTGGCCGAGGACGACCTGCTGCTCGGCGACGGCATCCGCGCCGGGCTGCGCCTGGAAGGCGATACCGTGGAATGGGTGACCGACGGCGTGGCCGCGGAGAACGCGCTGGTCACCGACGAGTTCGACCTGCTGGTGCTCGACATCGGACTGCCGCGCCGCAGCGGCCTGGACATCCTGCGTAACCTGCGCCACCAGGGCCGGCTCACCCCGGTGCTGCTGCTCACCGCGCGGGACAAGGTGGCCGACCGGGTCGCCGGGCTCGACAGCGGTGCCGACGACTACCTGACCAAGCCCTTCGATCTCGACGAACTGCAGGCACGGGTGCGCGCCCTGACCCGCCGCACCACCGGTCGCGCCCTGCCGCAACTGGTGCACGGCGAGCTGCGCCTGGACCCGGCGACCCACCAAGTGACCCTGTCCGGGCAGGCGGTGGAACTGGCGCCGCGCGAATACGCACTGCTGCGCCTGCTGCTGGAGAACAGCGGCAAGGTGCTCTCGCGCAACCAACTGGAGCAGAGCCTCTACGGCTGGAGCGGCGACGTCGAGAGCAACGCCATCGAAGTCCACGTCCACCACCTGCGGCGCAAGCTCGGCAACCAGTTGATCCGCACCGTCCGCGGCATCGGCTACGGCATCGACCAGCCGGCGCCCTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AEX49909.1", "sequence": "MRILLAEDDLLLGDGIRAGLRLEGDTVEWVTDGVAAENALVTDEFDLLVLDIGLPRRSGLDILRNLRHQGRLTPVLLLTARDKVADRVAGLDSGADDYLTKPFDLDELQARVRALTRRTTGRALPQLVHGELRLDPATHQVTLSGQAVELAPREYALLRLLLENSGKVLSRNQLEQSLYGWSGDVESNAIEVHVHHLRRKLGNQLIRTVRGIGYGIDQPAP"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "403": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1521": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1612": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1861": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1860": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1863": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1862": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1865": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1864": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1867": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1866": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1869": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1868": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "964": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "965": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "966": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "967": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "960": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "961": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "962": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "963": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "968": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "969": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2109": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2108": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2103": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2102": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2101": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2100": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2107": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2106": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2105": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2104": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "635": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1560": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "641": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "878": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "879": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "876": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "877": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "874": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "875": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "872": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "643": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "870": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "871": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2037": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2036": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2035": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1242": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2033": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2032": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2031": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2030": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "9": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "645": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2039": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1244": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "890": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "891": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "892": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "893": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "894": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "895": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "896": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "897": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "898": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "899": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "646": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1249": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "648": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1964": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1965": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1966": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1788": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1789": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "768": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "769": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1780": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1781": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "760": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "761": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "766": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "767": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "764": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "765": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1962": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1963": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1078": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1079": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1076": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1077": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1074": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1075": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1072": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1073": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1070": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1071": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1678": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1679": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1674": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1675": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1676": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1677": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1670": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1671": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1672": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1673": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1094": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1095": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1096": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1097": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1090": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1091": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1092": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1093": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "674": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "675": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "676": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "677": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1098": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1099": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "672": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "673": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1997": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1418": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1419": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1410": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1411": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1412": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1413": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1414": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1415": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1416": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1417": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1322": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1323": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1320": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1321": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1326": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1327": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1324": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1325": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1328": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1329": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "5": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1531": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1256": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1257": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1254": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1255": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1520": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1253": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1250": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1251": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1528": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1529": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1258": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1259": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "308": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "309": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "300": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "301": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "302": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "303": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "304": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "305": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "306": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "307": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1792": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "473": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "_timestamp": "2015-12-14T16:04:28+00:00", "470": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "471": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1898": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1899": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1894": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1895": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1896": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1897": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1890": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1891": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1892": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1893": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "959": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "958": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2134": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2135": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2132": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2133": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2130": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2131": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "951": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "950": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "953": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "952": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "955": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "954": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "957": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "956": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "477": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2002": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2003": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2000": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2001": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2006": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2007": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2004": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2005": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2008": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2009": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2034": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1263": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "666": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2176": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "1261": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2177": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "1799": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1798": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "719": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "718": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "717": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1267": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "715": {"$update": {"ARO_description": "PDC-3 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1790": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "713": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "712": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "711": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "710": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "661": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "716": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "505": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "660": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2178": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "1069": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1068": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2179": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "1061": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1060": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1063": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1062": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1065": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1064": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1067": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1066": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1669": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1668": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1667": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1666": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1665": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1664": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1663": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1662": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1661": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1660": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "591": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "590": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "593": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "592": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "595": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "594": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "597": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "596": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "599": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "598": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1089": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1088": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "714": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1526": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1409": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1408": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1403": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1402": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1401": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1400": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1407": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1406": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1405": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1404": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1546": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "449": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "448": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1339": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1338": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1547": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "443": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "442": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "441": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "440": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "447": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "446": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "445": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "444": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1545": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1542": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1543": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "39": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3369": {"dna_sequence": {"fmax": "5520", "fmin": "5055", "accession": "U12338", "strand": "+", "sequence": "ATGGGCATCATTCGCACATGTAGGCTCGGCCCTGACCAAGTCAAATCCATGCGGGCTGCTCTTGATCTTTTCGGTCGTGAGTTCGGAGACGTAGCCACCTACTCCCAACATCAGCCGGACTCCGATTACCTCGGGAACTTGCTCCGTAGTAAGACATTCATCGCGCTTGCTGCCTTCGACCAAGAAGCGGTTGTTGGCGCTCTCGCGGCTTACGTTCTGCCCAGGTTTGAGCAGCCGCGTAGTGAGATCTATATCTATGATCTCGCAGTCTCCGGCGAGCACCGGAGGCAGGGCATTGCCACCGCGCTCATCAATCTCCTCAAGCATGAGGCCAACGCGCTTGGTGCTTATGTGATCTACGTGCAAGCAGATTACGGTGACGATCCCGCAGTGGCTCTCTATACAAAGTTGGGCATACGGGAAGAAGTGATGCACTTTGATATCGACCCAAGTACCGCCACCTAA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AAG15269.1", "sequence": "MGIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTAT"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "38": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1540": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "33": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "32": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "31": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "30": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "37": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "36": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "35": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "34": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1537": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1240": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1243": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "642": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1533": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "644": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "647": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1246": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "649": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1248": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1539": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1538": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "339": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "338": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "335": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "334": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "337": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "336": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "331": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "330": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "333": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "332": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2118": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "8": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1464": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2119": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1462": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1889": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1888": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1887": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1886": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1885": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1884": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1883": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1882": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1881": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1880": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2121": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2120": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2123": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2122": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2125": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2124": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "948": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "949": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "946": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "947": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "944": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1084": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "942": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "943": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "940": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "941": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "133": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "132": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "131": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "130": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "137": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "136": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "135": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "134": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "139": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "138": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1354": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2019": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2018": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2015": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2014": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2017": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2016": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2011": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2010": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2013": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2012": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1793": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2112": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "708": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "709": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "704": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "705": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "706": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "707": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "700": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "701": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "702": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "703": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "88": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "89": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "82": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "83": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "80": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "81": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "86": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "87": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "84": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "85": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "762": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1658": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1659": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1652": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1388": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1650": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1651": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1656": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1657": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1654": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1655": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "586": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "587": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "584": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "585": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "763": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "583": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "580": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "581": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1984": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "588": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "589": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1985": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1982": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1983": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1436": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1437": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1434": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1435": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1432": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1433": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1430": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1431": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "418": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1981": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1438": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1439": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1260": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1349": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1541": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1348": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "459": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "450": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "451": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "452": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1343": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1344": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1345": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "456": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "457": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1082": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "517": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1266": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "656": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "657": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "654": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "655": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "652": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "653": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "650": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "651": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1508": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1509": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "658": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "516": {"$update": {"ARO_description": "PmrC mediates the modification of Lipid A by the addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) and phosphoethanolamine, resulting in a less negative cell membrane and decreased binding of polymyxin B.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1992": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2127": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2126": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2129": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2128": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "945": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1376": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1081": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "322": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "323": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "320": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "321": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "326": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "327": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "324": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "325": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "328": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "329": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1340": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1594": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1341": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1995": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1598": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "995": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "994": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "997": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "996": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "991": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "990": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "993": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "992": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "999": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "998": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "120": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "121": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "122": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "123": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "124": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "125": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "126": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "127": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "128": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "129": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2068": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2069": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2060": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2061": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2062": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2063": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2064": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2065": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2066": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2067": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1748": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1749": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1645": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1644": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1647": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1646": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1641": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1640": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1643": {"$update": {"ARO_description": "arnA modifies lipid A with 4-amino-4-deoxy-L-arabinose (Ara4N) which allows gram-negative bacteria to resist the antimicrobial activity of cationic antimicrobial peptides and antibiotics such as polymyxin. arnA is found in E. coli and P. aeruginosa.", "model_type": "protein homolog model", "model_sequences": {"$update": {"sequence": {"$insert": {"3373": {"dna_sequence": {"fmax": "3984009", "fmin": "3982020", "accession": "NC_002516.2", "strand": "+", "sequence": "ATGACCTCGAAAGCCGTCGTCTTCGCCTACCACGACATCGGTTGCACCGGTATCGAAGCCCTGCTCAATGCCGGCTACGAGATCGCCGCCGTCTTCACCCATGCCGACGACCCACGGGAAAACACCTTCTACGCCTCGGTCGCACGCCTCTGCGCCGAGCGCGGCATTCCGCTGCACGCGCCCGAGGACGTGAACCATCCGCTGTGGCTGGAGCGTATCCGCCAACTGCGCCCGGACTTCCTGTTCTCCTTCTACTACCGCCGCCTGCTCGGCGCCGAGCTGCTCGCCTGCGCCGCACGCGGCGCCTACAACCTGCACGGTTCGCTGCTGCCGCGCTACCGCGGACGCGCCCCGGCGAACTGGGTGCTGGTCAACGGCGAAACGCAGACCGGGGTGACCCTGCATCGCATGATCGAGCGCGCCGACGCCGGGCCGATCCTCGCCCAGCAGGCCGTCGCCATCGACCCCGAGGACACCGCCCTGAGCCTGCACGGCAAGCTGCGCAAGGCCGCCGGCGCCCTGCTGCGCGACAGCCTGCCGCTGCTCGCCCTCGGCGTGCTGCCGGAAGTCGAGCAGGACGAGAGCCAGGCCAGCCACTTCGGCCGGCGCACCCCGGCGGACGGCCTGCTCGACTGGCACAGGCCGGCACGGCAGTTGTACGACCTGGTGCGCGCGGTGACCCAGCCCTACCCTGGCGCCTTCTGCCAGGTCGGCGAACAGAAGCTGATCGTCTGGAGCGCCGAGGTGGTCGCCGGCAACCACGGCCGCGAGCCGGGCAGCGTACTGTCCTGCGACCCGCTGCGGATCGCCTGCGGCGAGGACTCGCTGGTGCTGCGCTTCGGCCAGCGCGGCGAGCGCGGCCTGTACCTGGCCGGCACGCAACTGGCCACCGAGCTGGGCCTGGTCGAGGGCGCGCGCCTGCGTGGCGCGGCATGCAGTCCGCAGCGCCGCACGCGGGTGCTGATCCTCGGGGTCAACGGCTTCATCGGCAACCACCTGTCCGAACGCCTGCTGCGCGACGGTCGCTACGAGGTCCACGGCATGGACATCGGCTCCGACGCCATCGAACGGCTCAAGGCCGACCCGCATTTCCACTTCGTCGAAGGCGACATCGGCATCCATTCGGAGTGGCTCGAATACCATGTGAAGAAATGCGACGTGATCCTGCCGCTGGTGGCCATCGCCACGCCCATCGAGTACACGCGCAACCCGCTGCGGGTGTTCGAACTGGACTTCGAGGAAAACCTGCGGATCGTCCGCTACTGCGTGAAATACGGCAAACGCGTGGTGTTCCCTTCCACCTCCGAGGTCTACGGCATGTGCCAGGACCCGGACTTCGACGAAGACCGCTCGAACCTGGTGGTCGGGCCGATCAACAAGCAGCGCTGGATCTACTCGGTGTCCAAGCAGTTGCTCGACCGGGTGATCTGGGCCTACGGCCAGCAGGGCCTGCGCTTCACCCTGTTCCGTCCGTTCAACTGGATGGGCCCGCGCCTGGACCGCCTGGATTCGGCGCGGATCGGCAGCTCGCGGGCGATCACCCAGCTCATCCTGCACCTGGTCGAAGGCACGCCGATCCGCCTGGTCGACGGCGGCGCGCAGAAGCGCTGCTTCACCGACGTCGACGACGGCATCGAGGCCCTCGCGCGGATCATCGACAACCGCGACGGCCGCTGCGACGGGCAGATCGTCAACATCGGCAACCCGGACAACGAGGCGAGCATCCGCCAGCTCGGCGAGGAACTGCTGCGCCAGTTCGAGGCCCACCCGCTGCGCGCGCAGTTCCCGCCCTTCGCCGGCTTCCGCGAGGTGGAGAGCCGCAGCTTCTACGGCGACGGCTACCAGGACGTGGCCCACCGCAAGCCGAGCATCGACAACGCCCGGCGCCTGCTCGACTGGCAGCCCACCATCGAACTGCGCGAGACCATCGGCAAGACCCTCGACTTCTTCCTCCACGAAGCGCTCCGCGAGCGCGAGGCACAGGCGTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_252244", "sequence": "MTSKAVVFAYHDIGCTGIEALLNAGYEIAAVFTHADDPRENTFYASVARLCAERGIPLHAPEDVNHPLWLERIRQLRPDFLFSFYYRRLLGAELLACAARGAYNLHGSLLPRYRGRAPANWVLVNGETQTGVTLHRMIERADAGPILAQQAVAIDPEDTALSLHGKLRKAAGALLRDSLPLLALGVLPEVEQDESQASHFGRRTPADGLLDWHRPARQLYDLVRAVTQPYPGAFCQVGEQKLIVWSAEVVAGNHGREPGSVLSCDPLRIACGEDSLVLRFGQRGERGLYLAGTQLATELGLVEGARLRGAACSPQRRTRVLILGVNGFIGNHLSERLLRDGRYEVHGMDIGSDAIERLKADPHFHFVEGDIGIHSEWLEYHVKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLRIVRYCVKYGKRVVFPSTSEVYGMCQDPDFDEDRSNLVVGPINKQRWIYSVSKQLLDRVIWAYGQQGLRFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILHLVEGTPIRLVDGGAQKRCFTDVDDGIEALARIIDNRDGRCDGQIVNIGNPDNEASIRQLGEELLRQFEAHPLRAQFPPFAGFREVESRSFYGDGYQDVAHRKPSIDNARRLLDWQPTIELRETIGKTLDFFLHEALREREAQA"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1642": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1396": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1649": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1648": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1742": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1743": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1252": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "579": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "578": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "573": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "572": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "571": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "570": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "577": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "576": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "575": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "574": {"$update": {"ARO_description": "AAC(6')-Ia is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in Citrobacter diversus, E. coli, K. pneumoniae, Shigella sonnei, and P. aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1209": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1208": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1421": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1420": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1423": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1422": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1425": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1424": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1427": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1426": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1429": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1428": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$delete": ["1332"]}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2156": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "731": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "730": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "733": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "938": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "735": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "734": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "737": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "736": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "739": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "738": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1359": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1358": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "469": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "468": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1353": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1352": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1351": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1350": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "461": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1356": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "463": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "608": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1273": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2158": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2159": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1519": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1518": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1515": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1514": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1517": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1516": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1511": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1510": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1513": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1512": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1275": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "280": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "582": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "357": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "356": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "355": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "354": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "353": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "352": {"$update": {"ARO_description": "PDC-5 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "351": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "350": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "359": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "358": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1033": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1447": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1446": {"$update": {"ARO_description": "PDC-6 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1445": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "289": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "288": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1444": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "281": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1443": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "283": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "282": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "285": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "284": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "287": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1442": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1441": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1116": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "263": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "262": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "261": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "260": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "267": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "266": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "265": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "264": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "286": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "269": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "268": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1562": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1563": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1564": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1565": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1566": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1567": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "988": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "989": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "982": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "983": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "980": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "981": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "986": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "987": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "984": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "985": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "115": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "114": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "117": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "116": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "111": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$insert": {"36616": {"category_aro_name": "aminocoumarin resistance gene", "category_aro_cvterm_id": "36616", "category_aro_accession": "3000477", "category_aro_description": "Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance"}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "110": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "113": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "112": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "119": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "118": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1797": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2079": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2078": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2073": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2072": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2071": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2070": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2077": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2076": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2075": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2074": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1796": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1035": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1389": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1630": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1631": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1632": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1633": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1634": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1635": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1636": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1637": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1638": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1639": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1988": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1989": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "568": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "569": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "560": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "561": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "562": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "563": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "564": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "565": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "566": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "567": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1188": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1189": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1186": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1187": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1184": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1185": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1182": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1183": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1180": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1181": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "726": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "727": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "724": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibioti