{"$update": {"344": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "345": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "346": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "347": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "340": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "341": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "342": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "343": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "348": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "349": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1653": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "298": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "299": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "296": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "297": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "294": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "295": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "292": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "293": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "290": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "291": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "270": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "271": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "272": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "273": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "274": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "275": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "276": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "277": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "278": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "279": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1132": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1004": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2189": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "108": {"$update": {"ARO_description": "PDC-8 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "109": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "102": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "103": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "100": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "101": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "106": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "107": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "104": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "105": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2046": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2047": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2044": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2045": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2042": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2043": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2040": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2041": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2048": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2049": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2038": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "99": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "98": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "91": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "90": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "93": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "92": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "95": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "94": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "97": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "96": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1623": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1622": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1621": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1620": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1627": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1626": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1625": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1624": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1999": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1998": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1629": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1628": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "559": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "558": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "555": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "554": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "557": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "556": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "551": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "550": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "553": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "552": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1199": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1198": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1191": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1190": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1193": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1192": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1195": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1194": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1197": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1196": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1759": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1758": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1757": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1756": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1755": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1754": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1753": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1752": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1751": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1750": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1177": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1176": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1175": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1174": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1173": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1172": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1171": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1170": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1179": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1178": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "511": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "510": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1005": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1285": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1284": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1287": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "512": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1281": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1280": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1283": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1282": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1003": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1289": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1288": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "514": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1579": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1578": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "689": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "688": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "685": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "684": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "687": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "686": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "681": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "680": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "683": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "682": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "623": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1226": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "621": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "873": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1224": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "627": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1222": {"$update": {"ARO_description": "An enzyme that confers resistance to fosfomycin in Serratia marcescens by breaking the epoxide ring of the molecule. It depends on the cofactors Manganese (II) and Potassium and uses Glutathione (GSH) as the nucleophilic molecule. In Pseudomonas aeruginosa, FosA catalyzes the conjugation of glutathione to carbon-1 of fosfomycin, rendering it ineffective as an antibacterial drug.", "model_type": "protein homolog model", "model_sequences": {"$update": {"sequence": {"$insert": {"3366": {"dna_sequence": {"fmax": "1222098", "fmin": "1221690", "accession": "NC002516", "strand": "+", "sequence": "ATGCTTACCGGTCTCAATCACCTGACCCTGGCGGTCGCCGACCTGCCGGCCAGCATCGCCTTCTACCGCGATCTTCTCGGCTTTCGCCTGGAAGCGCGCTGGGACCAGGGCGCCTATCTCGAACTGGGTTCGCTGTGGCTGTGCCTGTCCCGGGAGCCGCAGTACGGCGGGCCGGCCGCGGACTACACGCACTACGCCTTCGGCATCGCCGCCGCGGATTTCGCCCGCTTCGCCGCGCAGCTGCGCGCGCATGGCGTGCGCGAATGGAAGCAGAACCGCAGCGAGGGCGATTCGTTCTACTTCCTCGACCCGGACGGCCATCGCCTGGAGGCCCACGTCGGCGACCTGCGCAGCCGGCTCGCGGCGTGCCGGCAAGCGCCCTATGCGGGAATGCGTTTCGCCGACTAG"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_249820.1", "sequence": "MLTGLNHLTLAVADLPASIAFYRDLLGFRLEARWDQGAYLELGSLWLCLSREPQYGGPAADYTHYAFGIAAADFARFAAQLRAHGVREWKQNRSEGDSFYFLDPDGHRLEAHVGDLRSRLAACRQAPYAGMRFAD"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1221": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "624": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "407": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1370": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "405": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1372": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1375": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1374": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1377": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "400": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1379": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1378": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1342": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "409": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "408": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "453": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "454": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "455": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1346": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1347": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1245": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "379": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "378": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "371": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "370": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "373": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "372": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "375": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "374": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "377": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "376": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "393": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "392": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "391": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "390": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "397": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "396": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "395": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "394": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "399": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "398": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1247": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "245": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "244": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "247": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "246": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "241": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "240": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "243": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "242": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "249": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3375": {"dna_sequence": {"fmax": "1434", "fmin": "0", "accession": "JQ340365", "strand": "+", "sequence": "ATGTCCCGTGCCGCCGTCCCCTCCGTCCGCCGGCGCCTGCTGGTCAACCTGCTGGTCGGCTTCGTGCTGTGCTGGCTGAGCGTGGCGGCGCTGACCTACCACCTCTCGCTGAAGCAGGTGAACCGCCTGTTCGACGACGACATGGTGGACTTCGGCGAAGCCGCCCTGCGCCTGCTCGACCTTGCCACCGAAGACCAGGCCGGCGAGGACGGCTCCATCACCGAGATCATCGAACGCAGCCGCGAAGCGATCCAGGGTCTGCCCCTGCTGCGCCGCGAAAGCGCCCTCGGCTACGCCCTGTGGCGCGACGGCCAGCCGCTGCTGTCGAGCCTCAACCTGCCGCCGGAGATCACGGCCCAGGGCCCCGGCTTCAGCACCGTGGAAGCCCAGGGCACCCACTGGCGGGTGCTCCAGCTGAACATCGACGGCTTCCAGATCTGGATCAGCGAAAACCTGATCTACCGCCAGCACACCATGAACCTGCTGCTGTTCTACTCGCTGTTCCCACTGCTGCTGGCGCTGCCGTTGCTCGGCGGCCTGGTCTGGTTCGGCGTTGCCCGCGGCCTGGCGCCGCTACGCGAAGTGCAGGCCGAGGTCCAGCAGCGCTCCGCGCGACACCTGCAGCCGATCGCGGTGGAAGCGGTGCCGCTGGAGATCCGCGGCCTCATCGACGAACTCAACCTCCTGCTGGAGCGTCTGCGCACCGCCCTCGAGGCCGAACGCCGACTGACCAGCGACGCCGCCCATGAAATCCGCACGCCACTGGCCAGCCTGCGCACCCATGCCCAGGTCGCGCTGCGTTCGGAAGACCCCAAGGCCCACGCCCGCGGCCTGCTGCAAGTCAGTCGCAGCGTCGAGCGGATCAGCACCTTGATGGAGCAGATCCTGCTCCTCGCCCGCCTCGACGGCGACGCCCTGCTGGAGCAATTCCACCCGGTCAACCTCGCCACCCTGGCCGAAGACGTACTCTCCGAACTGGCGCGCCAGGCCATCGACAAGGACATCGAGCTGTCGTTGCACCAGGAGACCGTGCACGTGATGGGCATCGACCTGTGGCTGAAGGCGATGGTCGGCAACCTGGTGGGCAACGCCCTGCGCTACACACCGGCCGGGGGCCAGGTCGAGATCCGCGTCGAGAATCGCGCCCAGCACGCCGTGCTGCGGGTGCGCGACAACGGCCCCGGGGTCGCCCTGGAAGAGCAGCAGGCGATCTTCACCCGCTTCTACCGCAGCCCCGCCACCAGCAGCGGCGAGGGCAGCGGCCTGGGCCTGCCGATCGTCAAGCGCATCGTCGAACTGCACTTCGGCAGTATCGGCCTGGGCAAGGGACTGGAGGGCAAAGGGCTGGAAGTGCAGGTGTTCCTGCCGAAGACCCAGCCGGACGCGACGCGGCCGCCGGCCAGAGGTCCGGACAGCGGGCGGTCACATATCTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AEX49906.1", "sequence": "MSRAAVPSVRRRLLVNLLVGFVLCWLSVAALTYHLSLKQVNRLFDDDMVDFGEAALRLLDLATEDQAGEDGSITEIIERSREAIQGLPLLRRESALGYALWRDGQPLLSSLNLPPEITAQGPGFSTVEAQGTHWRVLQLNIDGFQIWISENLIYRQHTMNLLLFYSLFPLLLALPLLGGLVWFGVARGLAPLREVQAEVQQRSARHLQPIAVEAVPLEIRGLIDELNLLLERLRTALEAERRLTSDAAHEIRTPLASLRTHAQVALRSEDPKAHARGLLQVSRSVERISTLMEQILLLARLDGDALLEQFHPVNLATLAEDVLSELARQAIDKDIELSLHQETVHVMGIDLWLKAMVGNLVGNALRYTPAGGQVEIRVENRAQHAVLRVRDNGPGVALEEQQAIFTRFYRSPATSSGEGSGLGLPIVKRIVELHFGSIGLGKGLEGKGLEVQVFLPKTQPDATRPPARGPDSGRSHI"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "248": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "179": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "178": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "177": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "176": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "175": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "174": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "173": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "172": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "171": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "170": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2051": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2050": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2053": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2052": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2055": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2054": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2057": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2056": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2059": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2058": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1500": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1501": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1506": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1507": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1504": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1505": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1977": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1976": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "659": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1975": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1974": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1973": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1972": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1971": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1970": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1968": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1969": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1618": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1619": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1616": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1617": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1614": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1615": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1960": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1613": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1610": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1611": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1768": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1769": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1762": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1763": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1760": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1761": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1766": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1767": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1764": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1765": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1142": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1143": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1140": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1141": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1146": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1147": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1144": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1145": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1148": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1149": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "690": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "692": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "693": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1544": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "691": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "696": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "697": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "694": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "695": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "698": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "699": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1548": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1549": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "542": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "543": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "540": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "541": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "546": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "547": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "544": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "545": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "548": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "549": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1782": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1783": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1784": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1785": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1786": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1787": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "414": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "415": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "416": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "417": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "410": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "411": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "412": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "413": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1384": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1385": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1386": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1387": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1380": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "419": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1382": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1383": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "368": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "369": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "366": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "367": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "364": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "365": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "362": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "363": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "360": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "361": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "380": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "381": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "382": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "383": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3372": {"dna_sequence": {"fmax": "2029", "fmin": "682", "accession": "JN868716", "strand": "+", "sequence": "GTGATCCGTTCCCTGCGCATCCGTCTGATGCTCGGCGCCGCCGCCCTGGCGGTGCTGTTCATGCTGGCGCTGCTGCCGGCCCTGCAGCGGGCCTTCGGCATCGCCCTGGAGAACACCATCGAGCAGCGCCTGGCCGCCGACGTGGCGACCCTGGTCTCGGCGGCGCGGGTGGAGAAGGGCCGCCTGGTGATGCCCGAGCACCTGCCGGTGGAGGAGTTCAACCTGCCGGAGGCCAAGGTCCTCGGCTATATCTACGACCAGAATGGCGATCTGCTCTGGCGCTCCACCTCGGCGGCCGACGAGTCGATCAACTACACGCCGCGCTACGACGGCCGCGGCAACGAATTCCACACCACCCGCGATGCGAAGGGCGAGGAGTTCTTCGTGTTCGACGTCGAGATCGACCTGCTGCGCGGCAAGCAGGCGGCCTACAGCATCGTCACCATGCAATCGGTCAGCGAGTTCGAGAGCCTGCTCAAGGGGTTCCGCGAGCAGCTCTACCTGTGGCTCGGCGGCGCCCTGCTGGTCTTGCTCGGGCTGCTCTGGCTGGGTCTGACCTGGGGCTTCCGGGCGATGCGCGGGTTGAGTTCCGAGCTGGACCAGATCGAATCCGGCGAGCGCGAGAGCCTGAGCGAGGAGCATCCGCGCGAGCTGCTGCGCCTGACCCACTCGCTGAACCGCCTGTTGCGCAGCGAGCACAAGCAGCGCGAGCGCTACCGCCACTCCCTCGGCGACCTGGCGCACAGTCTGAAGACGCCGCTGGCGGTCTTGCAGGGGGTCGGCGACCAGCTCGCCGAGGAGCCCGGCAACCGCGAGCAGGTGCGGGTGCTACAGGGCCAGATCGAGCGCATGAGCCAGCAGATAGGCTATCAGTTGCAGCGCGCCAGCCTGCGCAAGAGCGGCCTGGTACGCCATCGCGAGCAACTGGCGCCGCTGGTGGAGACCCTGTGCGACGCGCTGGACAAGGTCTATCGCGACAAGCGGGTAAGCCTGCAGCGGGACTTCTCGCCGTCCTTCAGCGTGCCGGTGGAGCGCGGCGCGCTGCTGGAACTGCTCGGCAACCTGCTGGAGAACGCCTATCGCCTGTGCCTGGGCCGGGTCCGCGTGGGCGCCCGGCTGGGGCCGGGTTACTCGGAGCTGTGGGTCGAGGACGACGGTCCCGGAGTGCCTGCCGAACAGCGCGCACGAATCATCCGCCGCGGCGAGCGCGCCGATACCCAGCACCCGGGGCAGGGCATCGGCCTGGCCGTGGCGCTGGACATCATCGAGAGCTACGACGGCGAACTGAGCCTGGACGATTCCGAGCTGGGCGGCGCCTGCTTCCGCATACGTTTCGCTACAGTCTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AEU17992.1", "sequence": "MIRSLRIRLMLGAAALAVLFMLALLPALQRAFGIALENTIEQRLAADVATLVSAARVEKGRLVMPEHLPVEEFNLPEAKVLGYIYDQNGDLLWRSTSAADESINYTPRYDGRGNEFHTTRDAKGEEFFVFDVEIDLLRGKQAAYSIVTMQSVSEFESLLKGFREQLYLWLGGALLVLLGLLWLGLTWGFRAMRGLSSELDQIESGERESLSEEHPRELLRLTHSLNRLLRSEHKQRERYRHSLGDLAHSLKTPLAVLQGVGDQLAEEPGNREQVRVLQGQIERMSQQIGYQLQRASLRKSGLVRHREQLAPLVETLCDALDKVYRDKRVSLQRDFSPSFSVPVERGALLELLGNLLENAYRLCLGRVRVGARLGPGYSELWVEDDGPGVPAEQRARIIRRGERADTQHPGQGIGLAVALDIIESYDGELSLDDSELGGACFRIRFATV"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "384": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "385": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "386": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "387": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "388": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "389": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "258": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "259": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "252": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "253": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "250": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "251": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "256": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "257": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "254": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "255": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1849": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1848": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "168": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "169": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "164": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "165": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "166": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "167": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "160": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "161": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "162": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "163": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1980": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1841": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1840": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "678": {"$update": {"ARO_description": "PDC-10 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "679": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1814": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1815": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1816": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1817": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1810": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1811": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1812": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1813": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1818": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1819": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "670": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "671": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1609": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1608": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1979": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1978": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1601": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1600": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3371": {"dna_sequence": {"fmax": "686", "fmin": "8", "accession": "JN868721", "strand": "+", "sequence": "ATGAAACTGCTGGTAGTGGAAGACGAGGCGCTGTTGCGCCACCACCTCTATACCCGCCTGGGTGAACAGGGGCACGTGGTGGACGCGGTACCGGATGCCGAGGAAGCCCTCTACCGGGTCAGCGAATACCACCACGACCTGGCGGTGATCGACCTCGGCCTGCCGGGCATGAGCGGCCTGGACCTGATCCGCGAGCTGCGTTCGCAGGGCAAGTCCTTCCCGATCCTGATCCTCACCGCCCGCGGCAACTGGCAGGACAAGGTCGAAGGCCTGGCCGCCGGGGCCGACGACTACGTGGTCAAGCCGTTCCAGTTCGAGGAACTGGAAGCGCGCCTGAACGCGTTGCTGCGACGCTCCTCGGGGTTCGTCCAGTCGACCATCGAGGCCGGCCCCCTGGTCCTCGACCTGAACCGCAAGCAGGCGCTGGTCGAGGAGCAACCGGTGGCGCTGACCGCCTACGAATACCGCATCCTCGAATACCTCATGCGGCATCACCAGCAGGTGGTGGCCAAGGAACGCCTGATGGAACAGCTCTACCCCGACGACGAGGAGCGCGACGCCAACGTCATCGAGGTGCTGGTCGGCCGCCTGCGGCGCAAGCTGGAGGCCTGCGGCGGCTTCAAGCCGATCGATACGGTGCGCGGCCAGGGCTACCTGTTCACCGAGCGCTGCCGGTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AEU18003.1", "sequence": "MKLLVVEDEALLRHHLYTRLGEQGHVVDAVPDAEEALYRVSEYHHDLAVIDLGLPGMSGLDLIRELRSQGKSFPILILTARGNWQDKVEGLAAGADDYVVKPFQFEELEARLNALLRRSSGFVQSTIEAGPLVLDLNRKQALVEEQPVALTAYEYRILEYLMRHHQQVVAKERLMEQLYPDDEERDANVIEVLVGRLRRKLEACGGFKPIDTVRGQGYLFTERCR"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1603": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1602": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1605": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1604": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1607": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1606": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "809": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "808": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "803": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "802": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "801": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "800": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "807": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "806": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "805": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "804": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1775": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1774": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1777": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1776": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1771": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1770": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1773": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1772": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1779": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1778": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1159": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1158": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1155": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1154": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1157": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1156": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1151": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1150": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1153": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1152": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1555": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1554": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1551": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1550": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1553": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1552": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "59": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "58": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1557": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1556": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1559": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "54": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "57": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "56": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "51": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "50": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "53": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "52": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "537": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "55": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "535": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "534": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "533": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "532": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "531": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "530": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "539": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "538": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1558": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "536": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "429": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "428": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1399": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1398": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1397": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "420": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "423": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "422": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "425": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1392": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "427": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1390": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2183": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2182": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2181": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2180": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2187": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2186": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "229": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "228": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "227": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "226": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "225": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "224": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "223": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "222": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "221": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "220": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "151": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "150": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "153": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "152": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "155": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "154": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "157": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "156": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "159": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "158": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1807": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1806": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1805": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1804": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1803": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1802": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1801": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1800": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1809": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1808": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1524": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1948": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1949": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1525": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1942": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1943": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1940": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1941": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1946": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1947": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1944": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1945": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "818": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "819": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1527": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "810": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "811": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "812": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "813": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "814": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "815": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "816": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "817": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1991": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1522": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1990": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1523": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1993": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1490": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "421": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1492": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1493": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1494": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1495": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1496": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1497": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1498": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1499": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1395": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1994": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1700": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1701": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1702": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1703": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1704": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1705": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1706": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1707": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1708": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1709": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1996": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "424": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1391": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "426": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1128": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1129": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1120": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1121": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1122": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1123": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1124": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1125": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1126": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1127": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "524": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "525": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "526": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "527": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1018": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "521": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "522": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "523": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1014": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1015": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1016": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1017": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "528": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "529": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1012": {"$update": {"ARO_description": "KPC-5 is a beta-lactamase found in Klebsiella pneumoniae and Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1013": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1234": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1235": {"$update": {"ARO_accession": "3003676", "ARO_name": "AAC(6')-Ib'", "ARO_description": "AAC(6')-Ib' is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in P. aeruginosa and P. fluorescens.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40308"}}, "1236": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1237": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1230": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1231": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1232": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1233": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1238": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1239": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "438": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "439": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "436": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "437": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "434": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "435": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "432": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "433": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "430": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "431": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1967": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1961": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "238": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "239": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "234": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "235": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "236": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "237": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "230": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "231": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "232": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "233": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1": {"$update": {"ARO_description": "PDC-4 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "146": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "147": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "144": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "145": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "142": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "143": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "140": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "141": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "148": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "149": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2088": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2089": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2082": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2083": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2080": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2081": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2086": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2087": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2084": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2085": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1832": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1833": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1830": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$delete": ["544"]}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1831": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1836": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1837": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1834": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1835": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1838": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1839": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2154": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2155": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "939": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2157": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2150": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2151": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2152": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2153": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "933": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "932": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "931": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "930": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "937": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "936": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "935": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "934": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1955": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1954": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1957": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1956": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1951": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1950": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1953": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1952": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1959": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1958": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "829": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "828": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "825": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "824": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "827": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "826": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "821": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "820": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "823": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "822": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1536": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1483": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1482": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1481": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1480": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1487": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1486": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1485": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1484": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1489": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1488": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "797": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "928": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "795": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "794": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "793": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "792": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "791": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2146": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1719": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1718": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "799": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "798": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1270": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "613": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1272": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1139": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1138": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1133": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "616": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1131": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1130": {"$update": {"ARO_description": "PDC-9 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1137": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1136": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1135": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$insert": {"36616": {"category_aro_name": "aminocoumarin resistance gene", "category_aro_cvterm_id": "36616", "category_aro_accession": "3000477", "category_aro_description": "Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance"}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1134": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "614": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "476": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1277": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "519": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "518": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "926": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1009": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1008": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1007": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1006": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "513": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "927": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "515": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1002": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1001": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1000": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1227": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "622": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1225": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "620": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1223": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "626": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "625": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1220": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "629": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "628": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1229": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1228": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1535": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1561": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1286": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "11": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "10": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "13": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "12": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "15": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "14": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "17": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "16": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "19": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "18": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1534": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "201": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "200": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "203": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "202": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "205": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "204": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "207": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "206": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "209": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "208": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1573": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1572": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1571": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1570": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1577": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1576": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1575": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1574": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2185": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2184": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "2095": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2094": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2097": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2096": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2091": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2090": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2093": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2092": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2099": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2098": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2188": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1829": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1828": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1825": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1824": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1827": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1826": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1821": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1820": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1823": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1822": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$insert": {"36616": {"category_aro_name": "aminocoumarin resistance gene", "category_aro_cvterm_id": "36616", "category_aro_accession": "3000477", "category_aro_description": "Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance"}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2147": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "929": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2145": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2144": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2143": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2142": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2141": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2140": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "920": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "921": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "922": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "923": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "924": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "925": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2149": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2148": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1920": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1921": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1922": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1923": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1924": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1925": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1926": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1927": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1928": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1929": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "832": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "833": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "830": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "831": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "836": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "837": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "834": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "835": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "838": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "839": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "3": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1986": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1987": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1532": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "784": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "785": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "786": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "787": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "780": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "781": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "782": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1729": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1726": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1727": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1724": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1725": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "788": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "789": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1720": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1721": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "60": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "61": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "62": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "63": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3370": {"dna_sequence": {"fmax": "2604", "fmin": "1965", "accession": "AY954726", "strand": "+", "sequence": "TTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAACCCTTCCATCGAGGGGGACGTCCAAGGGCTGGCGCCCTTGGCCGCCCCTCATGTCAAACG"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AAX54878.1", "sequence": "MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "64": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "65": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "66": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "67": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "68": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "69": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1371": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1588": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1589": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "406": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1582": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1583": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1580": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1581": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1586": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1373": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1584": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1585": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1038": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "404": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "508": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "509": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1032": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "507": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "504": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1031": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "502": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "503": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1034": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "402": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1212": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1213": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1210": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1211": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1216": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "401": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "636": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "637": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "638": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "639": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1218": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1219": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1394": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "465": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1728": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "783": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1106": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1107": {"$update": {"ARO_description": "PDC-2 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1104": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1105": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1450": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1103": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1100": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1101": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1458": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1459": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1108": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1109": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1722": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1723": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2136": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2137": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1393": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "216": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "217": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "214": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "215": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "212": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "213": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "210": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "211": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1530": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "218": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "219": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2138": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2139": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "462": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "4": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1858": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1859": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1850": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1851": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1852": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1853": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1854": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1855": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1856": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1857": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2172": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2173": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2170": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2171": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "919": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "918": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2174": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "915": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "914": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "917": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "916": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "911": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "910": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "913": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "912": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1933": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1932": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1931": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1930": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1937": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1936": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1935": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1934": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1939": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1938": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "458": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "847": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "846": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "845": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "844": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "843": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "842": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "841": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "840": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "849": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "848": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1587": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1739": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1738": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1731": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1730": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1733": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1732": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1735": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1734": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1737": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1736": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1039": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "796": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "753": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "752": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "751": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "750": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "757": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "756": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "755": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "754": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "759": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "758": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1595": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "506": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1597": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1596": {"$update": {"ARO_description": "OXA-24 is a beta-lactamase found in A. baumannii and P. aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1591": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1590": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1593": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1592": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1599": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1030": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1025": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1024": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1027": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1026": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1021": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1020": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1023": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1022": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1036": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1029": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1028": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1037": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "500": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "501": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "605": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "604": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "607": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "606": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "601": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "600": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "603": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "602": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1205": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1204": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1207": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1206": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "609": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1200": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1203": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1202": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "633": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "634": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1217": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1214": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1215": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1111": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1110": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1113": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1112": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1115": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1114": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1117": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1440": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1119": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1118": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "467": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1449": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1448": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "466": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1357": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "460": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1355": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "489": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "488": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "487": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "486": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "485": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "484": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "483": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "482": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "481": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "480": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "790": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "199": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "198": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "195": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "194": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "197": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "196": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "191": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "190": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "193": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "192": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1454": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1455": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1456": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1457": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1102": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1451": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1452": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1453": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "902": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "903": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "900": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "901": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "906": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "907": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "904": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "905": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1843": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3367": {"dna_sequence": {"fmax": "9632", "fmin": "8888", "accession": "DQ914960", "strand": "-", "sequence": "TCATTTTCGTTTCAGCACGTAAAACAGCTCGTTTTCGCCGGTCAGCCGCGCGGCAATCGCGCGATTTTCCGGCACGTGCGCCTCCATCCATTCGGAATAGTGCTTTTCCATGCCGACGTTGCGCCCGCCGAGCGAACGCGTCGGAAACGATGCGACGATCCATTCCGCATTCACGCGCATTAGCGCATCCATCGCCGCGCCCGCACGCTGGCGCTCCAAAAGCGGCAGCACCTTAAACAGCAGCGCCGCATTCGCCTCGTCTTCCGGGATTTCGCACAGCAAATCGCCCAAACGCGCTTCCGCGCCGCCAAACGCACGAATTACGTTTACGCACTGACCGCTGATATCCACGCCGGTAATCGCCGCATTTGGCAATCGATGCGCGAGGTAGACAGGATTCAGCCCGCACGCGAGATCGAGGATTCGCGCCGGCGTTCCGCTGGCTTCAAACAGCTGATCGAACACGCGATCCATCGATTCCACAGGCAGCCGTTCGCGCGTGGACGCGTGCATTCCAAGCAGCGCTTCCCAATCGCGTGCCGCCGCCATTTCCATTGCGCGTTTGTATTCGCGCTCGGTCATGAACGCGCCGGTCACGCCGTGAAGCGCTTCGCGCGCCGCCTTGTCCACGTCCTTTTCCTTTTTGAATTTCGCGCTGCATTCACGCCATATGCGCTCGATCGTGTCCGGGCAAACGTCGCGATATTTTTTCGAAGCGAGCAGTTTTTCCTTCAGTTCGCTCAT"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "ABJ53409.1", "sequence": "MSELKEKLLASKKYRDVCPDTIERIWRECSAKFKKEKDVDKAAREALHGVTGAFMTEREYKRAMEMAAARDWEALLGMHASTRERLPVESMDRVFDQLFEASGTPARILDLACGLNPVYLAHRLPNAAITGVDISGQCVNVIRAFGGAEARLGDLLCEIPEDEANAALLFKVLPLLERQRAGAAMDALMRVNAEWIVASFPTRSLGGRNVGMEKHYSEWMEAHVPENRAIAARLTGENELFYVLKRK"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1842": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "908": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "909": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1847": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1846": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1845": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1844": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2169": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2168": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2165": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2164": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2167": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2166": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2161": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2160": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2163": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2162": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1908": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1909": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1906": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1907": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1904": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1905": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1902": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1903": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1900": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1901": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "854": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "855": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "856": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "857": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "850": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "851": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "852": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "853": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "858": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "859": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "6": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "740": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "741": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "742": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "743": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "744": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "745": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "746": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "747": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "748": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "749": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1050": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1051": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1052": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1053": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1054": {"$update": {"ARO_description": "EmrE is a small multidrug transporter that functions as a homodimer and that couples the efflux of small polyaromatic cations from the cell with the import of protons down an electrochemical gradient. EmrE is found in E. coli and P. aeruginosa.", "model_type": "protein homolog model", "model_sequences": {"$update": {"sequence": {"$insert": {"3368": {"dna_sequence": {"fmax": "5606435", "fmin": "5606102", "accession": "NC_002516.2", "strand": "+", "sequence": "ATGACCAACTATCTCTACCTCGCCATCGCCATCGCCGCCGAAGTGGTCGCCACCACCTCGCTGAAAGCCGTCGCCGGATTCAGCAAGCCACTGCCGCTGCTGCTGGTGGTGGGCGGCTACGTGCTCGCCTTCAGCATGCTCGTGCTGGTCATGCGCACCCTGCCGGTCGGCGTGGTCTACGCCATCTGGTCCGGACTCGGCATCGTCCTGGTCAGCCTGGTGGCGATGTTCGTCTACGGCCAGCGCCTGGACCCCGCCGCCCTCCTCGGCATCGGCCTGATCATCGCCGGCGTGCTGGTGATCCAGTTGTTCTCCCGCGCTTCGGGGCACTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_253677.1", "sequence": "MTNYLYLAIAIAAEVVATTSLKAVAGFSKPLPLLLVVGGYVLAFSMLVLVMRTLPVGVVYAIWSGLGIVLVSLVAMFVYGQRLDPAALLGIGLIIAGVLVIQLFSRASGH"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1055": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1056": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1057": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1058": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1059": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1696": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1697": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1694": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1695": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1692": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1693": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1690": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1691": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1791": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1698": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1699": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1278": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1279": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "618": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "619": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "612": {"$update": {"ARO_description": "PDC-7 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1271": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "610": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "611": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1274": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "617": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1276": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "615": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1795": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1794": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1491": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1472": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1473": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1470": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1471": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1476": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1477": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1474": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1475": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1478": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1479": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1304": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1305": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1306": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1307": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1300": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1301": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1302": {"$update": {"ARO_description": "tet34 causes the activation of Mg2+-dependent purine nucleotide synthesis, which protects the protein synthesis pathway. It is found in Gram-negative Vibrio", "model_type": "protein homolog model", "ARO_category": {"36021": {"category_aro_name": "gene conferring antibiotic resistance via molecular bypass", "category_aro_cvterm_id": "36021", "category_aro_accession": "3000012", "category_aro_description": "Genes involved in restructuring of the cell wall"}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1303": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1308": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1309": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "498": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "499": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "494": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "495": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "496": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "497": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "490": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "491": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "492": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "493": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "24": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "25": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "26": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "27": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "20": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "21": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "22": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "23": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "28": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "29": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1241": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "7": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1087": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1086": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1085": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1876": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1877": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1874": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1875": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1872": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1873": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1870": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1871": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1083": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1878": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1879": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "977": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "976": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "975": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "974": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "973": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "972": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "971": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "970": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1080": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "979": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "978": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "182": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "183": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "180": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "181": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "186": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "187": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "184": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "185": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2110": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2111": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "188": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2113": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2114": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2115": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2116": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2117": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1919": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1918": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1911": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1910": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1913": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1912": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1915": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1914": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1917": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1916": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "869": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "868": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "189": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "861": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "860": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "863": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "862": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "865": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "864": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "867": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "866": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2024": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2025": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2026": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2027": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2020": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2021": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2022": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2023": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2028": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2029": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1502": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "883": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "882": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "881": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "880": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "887": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "886": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "885": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "884": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "889": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "888": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1503": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "775": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "774": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "777": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "776": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "771": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "770": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "773": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "772": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "779": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "778": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "77": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "76": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "75": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "74": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "73": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "72": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "71": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "70": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "79": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "78": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1043": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1042": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1041": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1040": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1047": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1046": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1045": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1044": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1049": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1048": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1681": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1680": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1683": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1682": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1685": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1684": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1687": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1686": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1689": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1688": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1269": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1268": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "669": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "668": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "667": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1262": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "665": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "664": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "663": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "662": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1265": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1264": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "640": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1469": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1468": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1465": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "520": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1467": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1466": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1461": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1460": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1463": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1019": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1317": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1316": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1315": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1314": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1313": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1312": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1311": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1310": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1319": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1318": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1010": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "464": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1011": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "319": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "318": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "313": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "312": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "311": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "310": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "317": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "316": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "315": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "314": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1335": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1334": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1337": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1336": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1331": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1330": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1333": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1332": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "630": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "631": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "632": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3374": {"dna_sequence": {"fmax": "685", "fmin": "19", "accession": "JQ340367", "strand": "+", "sequence": "ATGAGAATACTGCTGGCCGAGGACGACCTGCTGCTCGGCGACGGCATCCGCGCCGGGCTGCGCCTGGAAGGCGATACCGTGGAATGGGTGACCGACGGCGTGGCCGCGGAGAACGCGCTGGTCACCGACGAGTTCGACCTGCTGGTGCTCGACATCGGACTGCCGCGCCGCAGCGGCCTGGACATCCTGCGTAACCTGCGCCACCAGGGCCGGCTCACCCCGGTGCTGCTGCTCACCGCGCGGGACAAGGTGGCCGACCGGGTCGCCGGGCTCGACAGCGGTGCCGACGACTACCTGACCAAGCCCTTCGATCTCGACGAACTGCAGGCACGGGTGCGCGCCCTGACCCGCCGCACCACCGGTCGCGCCCTGCCGCAACTGGTGCACGGCGAGCTGCGCCTGGACCCGGCGACCCACCAAGTGACCCTGTCCGGGCAGGCGGTGGAACTGGCGCCGCGCGAATACGCACTGCTGCGCCTGCTGCTGGAGAACAGCGGCAAGGTGCTCTCGCGCAACCAACTGGAGCAGAGCCTCTACGGCTGGAGCGGCGACGTCGAGAGCAACGCCATCGAAGTCCACGTCCACCACCTGCGGCGCAAGCTCGGCAACCAGTTGATCCGCACCGTCCGCGGCATCGGCTACGGCATCGACCAGCCGGCGCCCTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AEX49909.1", "sequence": "MRILLAEDDLLLGDGIRAGLRLEGDTVEWVTDGVAAENALVTDEFDLLVLDIGLPRRSGLDILRNLRHQGRLTPVLLLTARDKVADRVAGLDSGADDYLTKPFDLDELQARVRALTRRTTGRALPQLVHGELRLDPATHQVTLSGQAVELAPREYALLRLLLENSGKVLSRNQLEQSLYGWSGDVESNAIEVHVHHLRRKLGNQLIRTVRGIGYGIDQPAP"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "403": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1521": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1612": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1861": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1860": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1863": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1862": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1865": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1864": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1867": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1866": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1869": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1868": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "964": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "965": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "966": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "967": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "960": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "961": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "962": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "963": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "968": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "969": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2109": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2108": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2103": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2102": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2101": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2100": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2107": {"$update": {"model_type": "protein wild type model", "model_description": "A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2106": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2105": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2104": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "635": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1560": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "641": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "878": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "879": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "876": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "877": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "874": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "875": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "872": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "643": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "870": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "871": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2037": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2036": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2035": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1242": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2033": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2032": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2031": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2030": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "9": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "645": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2039": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1244": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "890": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "891": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "892": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "893": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "894": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "895": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "896": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "897": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "898": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "899": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "646": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1249": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "648": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1964": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1965": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1966": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1788": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1789": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "768": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "769": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1780": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1781": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "760": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "761": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "766": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "767": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "764": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "765": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1962": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1963": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1078": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1079": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1076": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1077": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1074": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1075": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1072": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1073": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1070": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1071": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1678": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1679": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1674": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1675": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1676": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1677": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1670": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1671": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1672": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1673": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1094": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1095": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1096": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1097": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1090": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1091": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1092": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1093": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "674": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "675": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "676": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "677": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1098": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1099": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "672": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "673": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1997": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1418": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1419": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1410": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1411": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1412": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1413": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1414": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1415": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1416": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1417": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1322": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1323": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1320": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1321": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1326": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1327": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1324": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1325": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1328": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1329": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "5": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1531": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1256": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1257": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1254": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1255": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1520": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1253": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1250": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1251": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1528": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1529": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1258": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1259": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "308": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "309": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "300": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "301": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "302": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "303": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "304": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "305": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "306": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "307": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1792": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "473": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "_timestamp": "2015-12-14T16:04:28+00:00", "470": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "471": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1898": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1899": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1894": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1895": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1896": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1897": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1890": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1891": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1892": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1893": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "959": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "958": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2134": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2135": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2132": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2133": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2130": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2131": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "951": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "950": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "953": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "952": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "955": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "954": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "957": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "956": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "477": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2002": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2003": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2000": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2001": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2006": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2007": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2004": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2005": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2008": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2009": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2034": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1263": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "666": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2176": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "1261": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2177": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "1799": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1798": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "719": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "718": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "717": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1267": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "715": {"$update": {"ARO_description": "PDC-3 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1790": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "713": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "712": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "711": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "710": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "661": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "716": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "505": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "660": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2178": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "1069": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1068": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2179": {"$update": {"model_type": "gene order model", "model_description": "A meta-model to detect a defined gene order based on gene detection by other models.", "model_param": {"$update": {"40297": {"$update": {"param_type": "gene order", "param_description": "A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas."}}}}}}, "1061": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1060": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1063": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1062": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1065": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1064": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1067": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1066": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1669": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1668": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1667": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1666": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1665": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1664": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1663": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1662": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1661": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1660": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "591": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "590": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "593": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "592": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "595": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "594": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "597": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "596": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "599": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "598": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1089": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1088": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "714": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1526": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1409": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1408": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1403": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1402": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1401": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1400": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1407": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1406": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1405": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1404": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1546": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "449": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "448": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1339": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1338": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1547": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "443": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "442": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "441": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "440": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "447": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "446": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "445": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "444": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1545": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1542": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1543": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "39": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$insert": {"3369": {"dna_sequence": {"fmax": "5520", "fmin": "5055", "accession": "U12338", "strand": "+", "sequence": "ATGGGCATCATTCGCACATGTAGGCTCGGCCCTGACCAAGTCAAATCCATGCGGGCTGCTCTTGATCTTTTCGGTCGTGAGTTCGGAGACGTAGCCACCTACTCCCAACATCAGCCGGACTCCGATTACCTCGGGAACTTGCTCCGTAGTAAGACATTCATCGCGCTTGCTGCCTTCGACCAAGAAGCGGTTGTTGGCGCTCTCGCGGCTTACGTTCTGCCCAGGTTTGAGCAGCCGCGTAGTGAGATCTATATCTATGATCTCGCAGTCTCCGGCGAGCACCGGAGGCAGGGCATTGCCACCGCGCTCATCAATCTCCTCAAGCATGAGGCCAACGCGCTTGGTGCTTATGTGATCTACGTGCAAGCAGATTACGGTGACGATCCCGCAGTGGCTCTCTATACAAAGTTGGGCATACGGGAAGAAGTGATGCACTTTGATATCGACCCAAGTACCGCCACCTAA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AAG15269.1", "sequence": "MGIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTAT"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "38": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1540": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "33": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "32": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "31": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "30": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "37": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "36": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "35": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "34": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1537": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1240": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1243": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "642": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1533": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "644": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "647": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1246": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "649": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1248": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1539": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1538": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "339": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "338": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "335": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "334": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "337": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "336": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "331": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "330": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "333": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "332": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2118": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "8": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1464": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2119": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1462": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1889": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1888": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1887": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1886": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1885": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1884": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1883": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1882": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1881": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1880": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2121": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2120": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2123": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2122": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2125": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2124": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "948": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "949": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "946": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "947": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "944": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1084": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "942": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "943": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "940": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "941": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "133": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "132": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "131": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "130": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "137": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "136": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "135": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "134": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "139": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "138": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1354": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2019": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2018": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2015": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2014": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2017": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2016": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2011": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2010": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2013": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2012": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1793": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2112": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "708": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "709": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "704": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "705": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "706": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "707": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "700": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "701": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "702": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "703": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "88": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "89": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "82": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "83": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "80": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "81": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "86": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "87": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "84": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "85": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "762": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1658": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1659": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1652": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1388": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1650": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1651": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1656": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1657": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1654": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1655": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "586": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "587": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "584": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "585": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "763": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "583": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "580": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "581": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1984": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "588": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "589": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1985": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1982": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1983": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1436": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1437": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1434": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1435": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1432": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1433": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1430": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1431": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "418": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1981": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1438": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1439": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1260": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1349": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1541": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1348": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "459": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "450": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "451": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "452": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1343": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1344": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1345": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "456": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "457": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1082": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "517": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1266": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "656": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "657": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "654": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "655": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "652": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "653": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "650": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "651": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1508": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1509": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "658": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "516": {"$update": {"ARO_description": "PmrC mediates the modification of Lipid A by the addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) and phosphoethanolamine, resulting in a less negative cell membrane and decreased binding of polymyxin B.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1992": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2127": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2126": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2129": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2128": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "945": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1376": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1081": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "322": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "323": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "320": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "321": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "326": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "327": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "324": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "325": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "328": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "329": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1340": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1594": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1341": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1995": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1598": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "995": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "994": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "997": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "996": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "991": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "990": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "993": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "992": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "999": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "998": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "120": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "121": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "122": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "123": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "124": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "125": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "126": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "127": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "128": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "129": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2068": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2069": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2060": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2061": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2062": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2063": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2064": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2065": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2066": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2067": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1748": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1749": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1645": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1644": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1647": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1646": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1641": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1640": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1643": {"$update": {"ARO_description": "arnA modifies lipid A with 4-amino-4-deoxy-L-arabinose (Ara4N) which allows gram-negative bacteria to resist the antimicrobial activity of cationic antimicrobial peptides and antibiotics such as polymyxin. arnA is found in E. coli and P. aeruginosa.", "model_type": "protein homolog model", "model_sequences": {"$update": {"sequence": {"$insert": {"3373": {"dna_sequence": {"fmax": "3984009", "fmin": "3982020", "accession": "NC_002516.2", "strand": "+", "sequence": "ATGACCTCGAAAGCCGTCGTCTTCGCCTACCACGACATCGGTTGCACCGGTATCGAAGCCCTGCTCAATGCCGGCTACGAGATCGCCGCCGTCTTCACCCATGCCGACGACCCACGGGAAAACACCTTCTACGCCTCGGTCGCACGCCTCTGCGCCGAGCGCGGCATTCCGCTGCACGCGCCCGAGGACGTGAACCATCCGCTGTGGCTGGAGCGTATCCGCCAACTGCGCCCGGACTTCCTGTTCTCCTTCTACTACCGCCGCCTGCTCGGCGCCGAGCTGCTCGCCTGCGCCGCACGCGGCGCCTACAACCTGCACGGTTCGCTGCTGCCGCGCTACCGCGGACGCGCCCCGGCGAACTGGGTGCTGGTCAACGGCGAAACGCAGACCGGGGTGACCCTGCATCGCATGATCGAGCGCGCCGACGCCGGGCCGATCCTCGCCCAGCAGGCCGTCGCCATCGACCCCGAGGACACCGCCCTGAGCCTGCACGGCAAGCTGCGCAAGGCCGCCGGCGCCCTGCTGCGCGACAGCCTGCCGCTGCTCGCCCTCGGCGTGCTGCCGGAAGTCGAGCAGGACGAGAGCCAGGCCAGCCACTTCGGCCGGCGCACCCCGGCGGACGGCCTGCTCGACTGGCACAGGCCGGCACGGCAGTTGTACGACCTGGTGCGCGCGGTGACCCAGCCCTACCCTGGCGCCTTCTGCCAGGTCGGCGAACAGAAGCTGATCGTCTGGAGCGCCGAGGTGGTCGCCGGCAACCACGGCCGCGAGCCGGGCAGCGTACTGTCCTGCGACCCGCTGCGGATCGCCTGCGGCGAGGACTCGCTGGTGCTGCGCTTCGGCCAGCGCGGCGAGCGCGGCCTGTACCTGGCCGGCACGCAACTGGCCACCGAGCTGGGCCTGGTCGAGGGCGCGCGCCTGCGTGGCGCGGCATGCAGTCCGCAGCGCCGCACGCGGGTGCTGATCCTCGGGGTCAACGGCTTCATCGGCAACCACCTGTCCGAACGCCTGCTGCGCGACGGTCGCTACGAGGTCCACGGCATGGACATCGGCTCCGACGCCATCGAACGGCTCAAGGCCGACCCGCATTTCCACTTCGTCGAAGGCGACATCGGCATCCATTCGGAGTGGCTCGAATACCATGTGAAGAAATGCGACGTGATCCTGCCGCTGGTGGCCATCGCCACGCCCATCGAGTACACGCGCAACCCGCTGCGGGTGTTCGAACTGGACTTCGAGGAAAACCTGCGGATCGTCCGCTACTGCGTGAAATACGGCAAACGCGTGGTGTTCCCTTCCACCTCCGAGGTCTACGGCATGTGCCAGGACCCGGACTTCGACGAAGACCGCTCGAACCTGGTGGTCGGGCCGATCAACAAGCAGCGCTGGATCTACTCGGTGTCCAAGCAGTTGCTCGACCGGGTGATCTGGGCCTACGGCCAGCAGGGCCTGCGCTTCACCCTGTTCCGTCCGTTCAACTGGATGGGCCCGCGCCTGGACCGCCTGGATTCGGCGCGGATCGGCAGCTCGCGGGCGATCACCCAGCTCATCCTGCACCTGGTCGAAGGCACGCCGATCCGCCTGGTCGACGGCGGCGCGCAGAAGCGCTGCTTCACCGACGTCGACGACGGCATCGAGGCCCTCGCGCGGATCATCGACAACCGCGACGGCCGCTGCGACGGGCAGATCGTCAACATCGGCAACCCGGACAACGAGGCGAGCATCCGCCAGCTCGGCGAGGAACTGCTGCGCCAGTTCGAGGCCCACCCGCTGCGCGCGCAGTTCCCGCCCTTCGCCGGCTTCCGCGAGGTGGAGAGCCGCAGCTTCTACGGCGACGGCTACCAGGACGTGGCCCACCGCAAGCCGAGCATCGACAACGCCCGGCGCCTGCTCGACTGGCAGCCCACCATCGAACTGCGCGAGACCATCGGCAAGACCCTCGACTTCTTCCTCCACGAAGCGCTCCGCGAGCGCGAGGCACAGGCGTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_252244", "sequence": "MTSKAVVFAYHDIGCTGIEALLNAGYEIAAVFTHADDPRENTFYASVARLCAERGIPLHAPEDVNHPLWLERIRQLRPDFLFSFYYRRLLGAELLACAARGAYNLHGSLLPRYRGRAPANWVLVNGETQTGVTLHRMIERADAGPILAQQAVAIDPEDTALSLHGKLRKAAGALLRDSLPLLALGVLPEVEQDESQASHFGRRTPADGLLDWHRPARQLYDLVRAVTQPYPGAFCQVGEQKLIVWSAEVVAGNHGREPGSVLSCDPLRIACGEDSLVLRFGQRGERGLYLAGTQLATELGLVEGARLRGAACSPQRRTRVLILGVNGFIGNHLSERLLRDGRYEVHGMDIGSDAIERLKADPHFHFVEGDIGIHSEWLEYHVKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLRIVRYCVKYGKRVVFPSTSEVYGMCQDPDFDEDRSNLVVGPINKQRWIYSVSKQLLDRVIWAYGQQGLRFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILHLVEGTPIRLVDGGAQKRCFTDVDDGIEALARIIDNRDGRCDGQIVNIGNPDNEASIRQLGEELLRQFEAHPLRAQFPPFAGFREVESRSFYGDGYQDVAHRKPSIDNARRLLDWQPTIELRETIGKTLDFFLHEALREREAQA"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1642": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1396": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1649": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1648": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1742": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1743": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1252": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "579": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "578": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "573": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "572": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "571": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "570": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "577": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "576": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "575": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "574": {"$update": {"ARO_description": "AAC(6')-Ia is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in Citrobacter diversus, E. coli, K. pneumoniae, Shigella sonnei, and P. aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1209": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1208": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1421": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1420": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1423": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1422": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1425": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1424": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1427": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1426": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1429": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1428": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_sequences": {"$update": {"sequence": {"$delete": ["1332"]}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2156": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "731": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "730": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "733": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "938": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "735": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "734": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "737": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "736": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "739": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "738": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1359": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1358": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "469": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "468": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1353": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1352": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1351": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1350": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "461": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1356": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "463": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "608": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1273": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2158": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2159": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1519": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1518": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1515": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1514": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1517": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1516": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1511": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1510": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1513": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1512": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1275": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "280": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "582": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "357": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "356": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "355": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "354": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "353": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "352": {"$update": {"ARO_description": "PDC-5 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "351": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "350": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "359": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "358": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1033": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1447": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1446": {"$update": {"ARO_description": "PDC-6 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1445": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "289": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "288": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1444": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "281": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1443": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "283": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "282": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "285": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "284": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "287": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1442": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1441": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1116": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "263": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "262": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "261": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "260": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "267": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "266": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "265": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "264": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "286": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "269": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "268": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1562": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1563": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1564": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1565": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1566": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1567": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "988": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "989": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "982": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "983": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "980": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "981": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "986": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "987": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "984": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "985": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "115": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "114": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "117": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "116": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "111": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$insert": {"36616": {"category_aro_name": "aminocoumarin resistance gene", "category_aro_cvterm_id": "36616", "category_aro_accession": "3000477", "category_aro_description": "Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance"}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "110": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "113": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "112": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "119": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "118": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1797": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2079": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2078": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2073": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2072": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2071": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2070": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2077": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2076": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "2075": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "2074": {"$update": {"model_type": "rRNA mutation model", "model_description": "A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.", "model_param": {"$update": {"snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1796": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1035": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1389": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1630": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1631": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1632": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1633": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1634": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1635": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1636": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1637": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1638": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1639": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1988": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1989": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "568": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "569": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "560": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "561": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "562": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "563": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "564": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "565": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "566": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "567": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1188": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1189": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1186": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1187": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1184": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1185": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1182": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1183": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1180": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1181": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "726": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "727": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "724": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "725": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "722": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "723": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "720": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "721": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1744": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1745": {"$update": {"ARO_description": "KPC-2 is a beta-lactamase found in Klebsiella pneumoniae and Pseudomonas aeruginosa.", "model_type": "protein homolog model", "model_sequences": {"$update": {"sequence": {"$insert": {"3377": {"dna_sequence": {"fmax": "18021", "fmin": "17139", "accession": "NC_022346.1", "strand": "+", "sequence": "ATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCTGGCTTTTCTGCCACCGCGCTGACCAACCTCGTCGCGGAACCATTCGCTAAACTCGAACAGGACTTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGTTACCGCGCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCTGTGCTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTGGACACACCCATCCGTTACGGCAAAAATGCGCTGGTTCCGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTGGCGGAGCTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTGAAGGAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTCATGCGCTCTATCGGCGATACCACGTTCCGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGATACCTCATCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTGGCTGCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTAAAGGGAAACACGACCGGCAACCACCGCATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGAGTGTATGGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTGTTGGCCGTCTACACCCGGGCGCCTAACAAGGATGACAAGCACAGCGAGGCCGTCATCGCCGCTGCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGGCAGTAA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "YP_008532725.1", "sequence": "MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ"}}}}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1746": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1747": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1740": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1741": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "728": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "729": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1164": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1165": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1166": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1167": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1160": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1161": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1162": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1163": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1168": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1169": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "472": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "48": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "49": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "46": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "47": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "44": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "45": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "42": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "43": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "40": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "41": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1568": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1569": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1298": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1299": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1292": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1293": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1290": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1291": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1296": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1297": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1294": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1295": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1713": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1360": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_category": {"$insert": {"36616": {"category_aro_name": "aminocoumarin resistance gene", "category_aro_cvterm_id": "36616", "category_aro_accession": "3000477", "category_aro_description": "Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance"}}}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1712": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "475": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1711": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1381": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1710": {"$update": {"model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "snp": {"$update": {"param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}}}}}, "1717": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1716": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1715": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "732": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1201": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1714": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1366": {"$update": {"ARO_description": "cmx is a plasmid or transposon-encoded chloramphenicol exporter that is found in Corynebacterium striatum and Pseudomonas aeruginosa.", "model_type": "protein homolog model", "ARO_category": {"$delete": ["36191"]}, "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "1367": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1364": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1365": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1362": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1363": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "474": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1361": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "478": {"$update": {"ARO_description": "AAC(3)-IIa is a plasmid-encoded aminoglycoside acetyltransferase in K. pneumoniae, E. cloacae, Actinobacillus pleuropneumoniae, S. typhimurium, Citrobacter freundii, and P. aeruginosa.", "model_type": "protein homolog model", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}, "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off."}}, "479": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1368": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}, "1369": {"$update": {"model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "model_param": {"$update": {"blastp_evalue": {"$update": {"param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}}}}}}, "$insert": {"2200": {"model_id": "2200", "ARO_accession": "3003687", "ARO_description": "APH(3')-VI is an aminoglycoside phosphoryltransferase that acts on the 3-OH of target of aminoglycosides.", "model_sequences": {"sequence": {"3387": {"dna_sequence": {"fmax": "9142", "fmin": "8362", "accession": "470266717", "strand": "+", "sequence": "ATGGAATTGCCCAATATTATTCAACAATTTATTGGAAACAGCGTTTTAGAGCCAAATAAAATTGGTCAGTCGCCATCGGATGTTTATTCTTTTAATCGAAATAATGAAACTTTTTTTCTTAAGCGATCTAGCACTTTATATACAGAGACCACATACAGTGTCTCTCGCGAAGCGAAAATGTTGAGTTGGCTCTCTGAGAAATTAAAGGTGCCTGAACTCATCATGACTTTTCAGGATGAGCAGTTTGAATTAATGATCACTAAAGCGATCAATGCAAAACCAATTTCAGCGCTTTTTTTAACAGACCAAGAATTGCTTGCTATCTATAAGGAGGCACTCAATCTGTTAAATTCAGTTGCTATTATTGATTGTCCATTTATTTCAAACATTGATCATCGGTTAAAAGAGTCAAAATTTTTTATTGATAACCAACTCCTTGACGATATAGATCAAGATGATTTTGACGCTGAATTATGGGGAGACCATAGAACTTACCTAAGTCTATGGAATGAGTTAACTGAGACTCGTGTTGAAGAAAGATTGGTTTTTTCTCATGGCGATATCACGGATAGTAATATTTTTATAGATAAATTCAATGAAATTTACTTTTTAGATCTTGGCCGTGCTGGGTTAGCTGATGAATTTGTAGATATATCCTTTGTTGAACGTTGCCTAAGAGAGGATGCCTCGGAGGAAACTGCTAAAATATTTTTAAAGCATTTAAAAAATGATAGACCTGACAAAAGGAATTATTTTTTAAAACTTGATGAATTGAATTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AGI04227.1", "sequence": "MELPNIIQQFIGNSVLEPNKIGQSPSDVYSFNRNNETFFLKRSSTLYTETTYSVSREAKMLSWLSEKLKVPELIMTFQDEQFELMITKAINAKPISALFLTDQELLAIYKEALNLLNSVAIIDCPFISNIDHRLKESKFFIDNQLLDDIDQDDFDAELWGDHRTYLSLWNELTETRVEERLVFSHGDITDSNIFIDKFNEIYFLDLGRAGLADEFVDISFVERCLREDASEETAKIFLKHLKNDRPDKRNYFLKLDELN"}}}}, "ARO_category": {"36696": {"category_aro_name": "antibiotic inactivation enzyme", "category_aro_cvterm_id": "36696", "category_aro_accession": "3000557", "category_aro_description": "Enzyme that catalyzes the inactivation of an antibiotic resulting in resistance.  Inactivation includes chemical modification, destruction, etc."}, "36243": {"category_aro_name": "aminoglycoside resistance gene", "category_aro_cvterm_id": "36243", "category_aro_accession": "3000104", "category_aro_description": "Genes conferring resistance to aminoglycoside antibiotics."}}, "ARO_name": "APH(3')-VI", "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40322", "model_name": "APH(3')-VI", "model_type_id": "40292"}, "2201": {"model_id": "2201", "ARO_accession": "3003688", "ARO_description": "PvrR is a two-component response regulator that controls the conversion between antibiotic-resistant and antibiotic-susceptible forms of Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"3389": {"dna_sequence": {"fmax": "3996", "fmin": "2796", "accession": "AF482691.2", "strand": "+", "sequence": "ATGAGCTGGAAATCCTATCGGGTGCTGGTGGTCGAAGATCAGCCGTTTCAGCGCGAATACCTGCTCAACCTGTTTCGCGAGCGCGGCGTGCAGTACCTGGTAGGTGCCGGCGACGGCGCGGAGGCGTTGCGCTGCCTGAAGCAGGACAGGTTCGACCTGATCCTCAGCGATCTGATGATGCCGGGCATGGATGGTATCCAAATGATCCTGCAACTGCCGTATCTCAAGCATCGTCCGAAGCTGGCGCTGATGAGCTCCTCGTCGCAGCGGATGATGCTCAGTGCCAGCCGGGTCGCCCAGAGTCTCGGCTTGTCGGTAATCGACCTGTTGCCCAAGCCGACTCTGCCCAAGGCCATCGGCCAACTTCTGGAACACCTGGAAAGATGCCTCAGGCAGAAGCTGGAGCCGGAAACCGACGAGACTCCGCATGGGCGCACGGCGTTGCTGGATGCCCTGCATAACGAGCAACTGGTGACCTGGTTCCAGGCTAAGAAATCCCTCCACACCGGGCGCATAGTCGGCGCCGAGGCGTTGATACGCTGGAGCCACCCGCAGCATGGCCTGTTGCTGCCCAGCTGTTTCATGAGTGATGTCGACGCTACCGGTCTGCACGAGGCGTTGCTCTGGCGCGTGCTCGAACAGACCCTGAACGCCCAGGAATCGTGGCGCAGGGCGGGTTACGAGATTCCGGTTTCGGTGAATCTGCCGCCGCACCTGCTCGATAACCAGGAACTTCCGGATCGACTCTATGAGTACGTCGGCGCTCGCGGGGCTTGTACCAGCTCACTATGTTTCGAGTTGACCGAGAGCAGTGTCACAACTCTGTCAAGTAACTACTATGCAGGTGCCTGTCGCTTGCGCATGAAAGGGTTCGGATTGGCCCAGGACGACTTTGGCCAGGGTTACAGCTCGTTCTATAACCTGGTCACGACGCCTTTCACGGAGCTGAAGATCGACCGCTCCCTAGTCCAGGGATGCGTAGAGGATAACGGCCTCAATGCAGCTGTCATCAGTTGTATTGAGTTGGGTCACCGCCTGAATCTCGACGTGGTGGCCGAAGGCGTGGAGACCTGCGAGGAACTGAATCTTCTTCGTCGTCTTGGCTGCGACCGGGCGCAGGGTTTCCTGATTTCTAAGGCAGTGTCTGCTCGTGAGTTCGAGCGGCAGTTAAGGGAGGACGGCCCCAGCCTCCTTGTTTAA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "AAM15533.1", "sequence": "MSWKSYRVLVVEDQPFQREYLLNLFRERGVQYLVGAGDGAEALRCLKQDRFDLILSDLMMPGMDGIQMILQLPYLKHRPKLALMSSSSQRMMLSASRVAQSLGLSVIDLLPKPTLPKAIGQLLEHLERCLRQKLEPETDETPHGRTALLDALHNEQLVTWFQAKKSLHTGRIVGAEALIRWSHPQHGLLLPSCFMSDVDATGLHEALLWRVLEQTLNAQESWRRAGYEIPVSVNLPPHLLDNQELPDRLYEYVGARGACTSSLCFELTESSVTTLSSNYYAGACRLRMKGFGLAQDDFGQGYSSFYNLVTTPFTELKIDRSLVQGCVEDNGLNAAVISCIELGHRLNLDVVAEGVETCEELNLLRRLGCDRAQGFLISKAVSAREFERQLREDGPSLLV"}}}}, "ARO_category": [], "ARO_name": "PvrR", "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40325", "model_name": "PvrR", "model_type_id": "40292"}, "2202": {"model_id": "2202", "ARO_accession": "3002600", "ARO_name": "AAC(3)-Ib/AAC(6')-Ib''", "ARO_description": "AAC(3)-Ib/AAC(6')-Ib'' is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa", "ARO_category": {"36696": {"category_aro_name": "antibiotic inactivation enzyme", "category_aro_cvterm_id": "36696", "category_aro_accession": "3000557", "category_aro_description": "Enzyme that catalyzes the inactivation of an antibiotic resulting in resistance.  Inactivation includes chemical modification, destruction, etc."}, "36243": {"category_aro_name": "aminoglycoside resistance gene", "category_aro_cvterm_id": "36243", "category_aro_accession": "3000104", "category_aro_description": "Genes conferring resistance to aminoglycoside antibiotics."}}, "model_param": {"40328": {"param_value": {"3155": "38930, 38946"}, "param_type_id": "40328", "param_type": "domain direction or strand", "param_description": "A parameter to describe the order of the fusion protein domains from N terminus to C terminus. The parameter is defined by Cvterm IDs separated by commas (if known)."}, "40327": {"param_value": {"3154": "38930, 38946"}, "param_type_id": "40327", "param_type": "domain order", "param_description": "A parameter to describe the genes in a fusion protein. The parameter is defined by Cvterm IDs, separated by commas."}}, "model_type": "protein domain model", "model_description": "A model to detect specific domains of proteins that confer resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off for each of the genes, and directionality of the fused genes (if known).", "ARO_id": "39000", "model_name": "AAC(3)-Ib/AAC(6')-Ib''", "model_type_id": "40326"}, "2203": {"model_id": "2203", "ARO_accession": "3003689", "model_param": {"blastp_evalue": {"param_value": "1e-150", "param_type_id": "36302", "param_type": "BLASTP e-value", "param_description": "A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence."}}, "ARO_description": "MCR-1 is a plasmid-borne phosphoethanolamine transferase that interferes with binding of colistin to the cell membrane via addition of phosphoethanolamine to lipid A, resulting reduction in negative charge of the cell membrane.", "model_sequences": {"sequence": {"3390": {"dna_sequence": {"fmax": "24038", "fmin": "22412", "accession": "KP347127", "strand": "+", "sequence": "ATGATGCAGCATACTTCTGTGTGGTACCGACGCTCGGTCAGTCCGTTTGTTCTTGTGGCGAGTGTTGCCGTTTTCTTGACCGCGACCGCCAATCTTACCTTTTTTGATAAAATCAGCCAAACCTATCCCATCGCGGACAATCTCGGCTTTGTGCTGACGATCGCTGTCGTGCTCTTTGGCGCGATGCTACTGATCACCACGCTGTTATCATCGTATCGCTATGTGCTAAAGCCTGTGTTGATTTTGCTATTAATCATGGGCGCGGTGACCAGTTATTTTACTGACACTTATGGCACGGTCTATGATACGACCATGCTCCAAAATGCCCTACAGACCGACCAAGCCGAGACCAAGGATCTATTAAACGCAGCGTTTATCATGCGTATCATTGGTTTGGGTGTGCTACCAAGTTTGCTTGTGGCTTTTGTTAAGGTGGATTATCCGACTTGGGGCAAGGGTTTGATGCGCCGATTGGGCTTGATCGTGGCAAGTCTTGCGCTGATTTTACTGCCTGTGGTGGCGTTCAGCAGTCATTATGCCAGTTTCTTTCGCGTGCATAAGCCGCTGCGTAGCTATGTCAATCCGATCATGCCAATCTACTCGGTGGGTAAGCTTGCCAGTATTGAGTATAAAAAAGCCAGTGCGCCAAAAGATACCATTTATCACGCCAAAGACGCGGTACAAGCAACCAAGCCTGATATGCGTAAGCCACGCCTAGTGGTGTTCGTCGTCGGTGAGACGGCACGCGCCGATCATGTCAGCTTCAATGGCTATGAGCGCGATACTTTCCCACAGCTTGCCAAGATCGATGGCGTGACCAATTTTAGCAATGTCACATCGTGCGGCACATCGACGGCGTATTCTGTGCCGTGTATGTTCAGCTATCTGGGCGCGGATGAGTATGATGTCGATACCGCCAAATACCAAGAAAATGTGCTGGATACGCTGGATCGCTTGGGCGTAAGTATCTTGTGGCGTGATAATAATTCGGACTCAAAAGGCGTGATGGATAAGCTGCCAAAAGCGCAATTTGCCGATTATAAATCCGCGACCAACAACGCCATCTGCAACACCAATCCTTATAACGAATGCCGCGATGTCGGTATGCTCGTTGGCTTAGATGACTTTGTCGCTGCCAATAACGGCAAAGATATGCTGATCATGCTGCACCAAATGGGCAATCACGGGCCTGCGTATTTTAAGCGATATGATGAAAAGTTTGCCAAATTCACGCCAGTGTGTGAAGGTAATGAGCTTGCCAAGTGCGAACATCAGTCCTTGATCAATGCTTATGACAATGCCTTGCTTGCCACCGATGATTTCATCGCTCAAAGTATCCAGTGGCTGCAGACGCACAGCAATGCCTATGATGTCTCAATGCTGTATGTCAGCGATCATGGCGAAAGTCTGGGTGAGAACGGTGTCTATCTACATGGTATGCCAAATGCCTTTGCACCAAAAGAACAGCGCAGTGTGCCTGCATTTTTCTGGACGGATAAGCAAACTGGCATCACGCCAATGGCAACCGATACCGTCCTGACCCATGACGCGATCACGCCGACATTATTAAAGCTGTTTGATGTCACCGCGGACAAAGTCAAAGACCGCACCGCATTCATCCGCTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"GI": "AKF16168", "sequence": "MMQHTSVWYRRSVSPFVLVASVAVFLTATANLTFFDKISQTYPIADNLGFVLTIAVVLFGAMLLITTLLSSYRYVLKPVLILLLIMGAVTSYFTDTYGTVYDTTMLQNALQTDQAETKDLLNAAFIMRIIGLGVLPSLLVAFVKVDYPTWGKGLMRRLGLIVASLALILLPVVAFSSHYASFFRVHKPLRSYVNPIMPIYSVGKLASIEYKKASAPKDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSTAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQTHSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFIR"}}}}, "ARO_category": {"39418": {"category_aro_name": "polymyxin resistance gene", "category_aro_cvterm_id": "39418", "category_aro_accession": "3002984", "category_aro_description": "Genes conferring resistance to polymyxins"}, "40190": {"category_aro_name": "gene altering cell wall charge conferring antibiotic resistance", "category_aro_cvterm_id": "40190", "category_aro_accession": "3003580", "category_aro_description": "Genes involved in alteration of the cell wall overall charge, leading to antimicrobial resistance due to reduced binding"}}, "ARO_name": "MCR-1", "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40335", "model_name": "MCR-1", "model_type_id": "40292"}, "2191": {"model_id": "2191", "ARO_accession": "3003677", "ARO_description": "AAC(6\u2032)-Iaj is a functional acetyltransferase that modifies the amino groups at the 6\u2032 positions of aminoglycosides and contributes to aminoglycoside resistance of P. aeruginosa", "model_sequences": {"sequence": {"3379": {"dna_sequence": {"fmax": "1749", "fmin": "1194", "accession": "AB709942", "strand": "+", "sequence": "ATGGAATATTCAATTATCAATATAGTAGAGCAAAACAATTATCAGATCGATGCTGCAAGAATTCTTACAAATACTTTTCTTGATATAGGTAATAAAACTTGGCCAACTATTCAAAGCGCAATCGATGAAGTCGAAGAGTGTATTGATCTGCCCAATATATGTATAGGTTTAATTCATAACAATCAATTAATTGGATGGGTCGGATTACGTCCGATGTATGATAAAACGTGGGAATTGCACCCATTAGTTGTAAGAACTGACTATCAAAGTAAGGGGATCGGTAGTGTATTACTTGCTGAAGTTGAAAAAAGGGCAAGAGAAGTTGGAATAATTGGAATAATATTAGGAACTGATGATGAATATAACAAAACAAGTCTTTCTGAAATAACTATAGATGAAAATAATATATTCGATGCAATACAAAATATTAAGAATATACATAATCATCCATATGAGTTTTACCAAAAAAATGGATATATGATTGTTGGAATAATTCCAAATGCAAATGGACTAAGAAAACCCGATATTTGGATGTGGAAAAGTCTACTCAATTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"GI": "BAM46120.1", "sequence": "MEYSIINIVEQNNYQIDAARILTNTFLDIGNKTWPTIQSAIDEVEECIDLPNICIGLIHNNQLIGWVGLRPMYDKTWELHPLVVRTDYQSKGIGSVLLAEVEKRAREVGIIGIILGTDDEYNKTSLSEITIDENNIFDAIQNIKNIHNHPYEFYQKNGYMIVGIIPNANGLRKPDIWMWKSLLN"}}}}, "ARO_category": {"36696": {"category_aro_name": "antibiotic inactivation enzyme", "category_aro_cvterm_id": "36696", "category_aro_accession": "3000557", "category_aro_description": "Enzyme that catalyzes the inactivation of an antibiotic resulting in resistance.  Inactivation includes chemical modification, destruction, etc."}, "36243": {"category_aro_name": "aminoglycoside resistance gene", "category_aro_cvterm_id": "36243", "category_aro_accession": "3000104", "category_aro_description": "Genes conferring resistance to aminoglycoside antibiotics."}}, "ARO_name": "AAC(6')-Iaj", "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40309", "model_name": "AAC(6\u2032)-Iaj", "model_type_id": "40292"}, "2192": {"model_id": "2192", "ARO_accession": "3003679", "ARO_description": "TriA is a membrane protein that is fused to TriB and both are required for the triclosan efflux pump function of TriABC-OpmH in P. aeruginosa.", "model_sequences": {"sequence": {"3380": {"dna_sequence": {"fmax": "178458", "fmin": "177306", "accession": "110645304", "strand": "+", "sequence": "ATGTCAGACGCCAGAGGCGCTTTTCATTCCAAAGGTCGCTGGTCGCGGATGGCGCTGCCCGCCATCCTGTGCGCCGGCCTGCTTGTCGGTTGCGGCGCCGAGCCGCCCGCCGAGGAACACGTCCGTGTGCTGGCGCAGACGGTGAAGATGGCCGAGTTCGCCTCGGCCACCTCGATCACCGGCGACATCCAGGCACGGGTACAGGCCGACCAGTCGTTCCGTGTCGGCGGCAAGATCGTCGAGCGCCTGGTCGATGTCGGCGACCACGTCGCGGCTGGCCAGGTGCTGGCGCGGCTCGACCCGCAGGACCAGCGCAGCAACGTGGAGAACGCCCAGGCGGCGGTCGCCGCGCAGCAGGCGCAGTCGAAGCTCGCCGACCTCAACTACCAGCGGCAGAAGGCGCTGCTGCCCAAGGGCTACACCAGCCAGAGCGAGTACGACCAGGCGCTGGCCTCGGTGCGCAGCGCGCAGAGTTCGCTGAAGGCCGCCCAGGCGCAGTTGGCCAACGCCCGCGACCTGCTTTCCTATACCGAGCTGCGTGCCTCCGACGCCGGGGTCATCACCGCCCGCCAGGCCGAGGTCGGCCAGGTGGTGCAGGCCACCGTGCCGATCTTCACCCTGGCCCGCGACGGCGAGCGCGACGCGGTGTTCAACGTCTACGAGTCGTTGTTCAGCCACGATGTCGACGGCCAGCGGATCACCGTCAGCCTGCTCGGCAAGCCGGAAGTCACCGCCAGCGGCAAGGTCCGCGAGATCACCCCCACGGTGGACGAGCGCAGCGGTACGCTGAAGGTCAAGGTCGGCCTCGACTCGGTGCCGGCGGAAATGAGCCTCGGCAGCGTGGTCAACGCCAGCGTCGCCGCGCCGGCCGAGCACAGCGTGGTGCTGCCCTGGTCGGCGCTGTCCAAGGTCGGCGAGCAGCCGGCGGTCTGGTTGCTCGACCAGCAAGGCAAGGCGCGTCTGCAACCGGTGCGGGTGGCACGCTACGCCAGCGAGAAGGTGGTCATCGACGGTGGCCTGGAGGCGGGCCAGACGGTGGTCACGGTGGGCGGCCAACTGCTCCATCCGGGCCAGGTGGTCGAGGTGGCCCAGCCGCCGCAGCCGACCCAGAGCACCGCCAGCCGCGACGCCGTGGGCGGAGGCCAGCCATGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_248846.1", "sequence": "MSDARGAFHSKGRWSRMALPAILCAGLLVGCGAEPPAEEHVRVLAQTVKMAEFASATSITGDIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQDQRSNVENAQAAVAAQQAQSKLADLNYQRQKALLPKGYTSQSEYDQALASVRSAQSSLKAAQAQLANARDLLSYTELRASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFNVYESLFSHDVDGQRITVSLLGKPEVTASGKVREITPTVDERSGTLKVKVGLDSVPAEMSLGSVVNASVAAPAEHSVVLPWSALSKVGEQPAVWLLDQQGKARLQPVRVARYASEKVVIDGGLEAGQTVVTVGGQLLHPGQVVEVAQPPQPTQSTASRDAVGGGQP"}}}}, "ARO_category": {"36298": {"category_aro_name": "efflux pump conferring antibiotic resistance", "category_aro_cvterm_id": "36298", "category_aro_accession": "3000159", "category_aro_description": "Efflux proteins that pump antibiotic out of a cell to confer resistance."}}, "ARO_name": "TriA", "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40314", "model_name": "TriA", "model_type_id": "40292"}, "2193": {"model_id": "2193", "ARO_accession": "3003680", "ARO_description": "TriB is a membrane protein that is fused to TriA and both are required for the triclosan efflux pump function of TriABC-OpmH in P. aeruginosa.", "model_sequences": {"sequence": {"3381": {"dna_sequence": {"fmax": "179525", "fmin": "178454", "accession": "NC_002516.2", "strand": "+", "sequence": "ATGAAGCCGTTTTCCCTCGCCGGCCTGTTCGGCTTCGCCCTGCTCCTCTCCGGCTGCGGCGACGAGCCGCCGCCGGCACCGCCGCGGCCGGTGCTGACGGTGACCGTGAAGACCCTGAAGAACGACGACCTCGGTCGCTTCGCCGGGAGCATCCAGGCGCGCTACGAGAGCGTGCTCGGCTTCCGCACCAACGGACGGATCGCCTCGCGCCTGTTCGACGTCGGTGACTTCGTCGGCAAGGGCGCGCTGCTGGCGACCCTCGACCCCACCGACCAGCAGAACCAGTTGCGCGCCAGCCAGGGCGACCTGGCCAGCGCCGAGGCACAGTTGATCGACGCCCAGGCCAATGCCCGGCGCCAGGAAGAACTGTTCGCCCGCAGCGTCACCGCCCAGGCGCGCCTGGACGATGCGCGGACCCGCCTGAAGACCAGCCAGGCCAGCTTCGACCAGGCCAAAGCGGCGGTGCAGCAGGCCAGGGACCAGCTTTCCTACACGCGCCTGGTGACCGATTTCGACGGCGTCATCACCACCTGGCACGCCGAGGCCGGGCAAGTGGTCAGCGCCGGCCAGGCGGTGGTCACCCTGGCCCGGCCCGAAGTGCGCGAGGCAGTCTTCGACCTGCCCACCGAGGTCGCCGAGAGCCTGCCGGCCGACGCGCGCTTCCTGGTCAGCGCCCAGCTCGACCCGCAGGCCAGGACCACCGGCAGCATCCGCGAGCTGGGTCCGCAGGCCGACGCCTCGACCCGCACCCGTCGCGTGCGCCTGAGCCTGGCGCAGACGCCGGAGGCGTTTCGCCTCGGTTCGACCATCCAGGTCCAGCTGAGCAGCGCCGGTAGCGTGCGCAGCGTGCTGCCGGCCAGCGTGCTGCTGGAGCGCGACGGCAAGACCCAGGTCTGGGTCGTCGATGGGAAACAGTCCAGCGTGGCCCTGCGCGAGGTACAGGTGCTCAGCCGCGACGAACGCCAGGTGGTGATCGGACAGGGCCTGGCCGACGGCGACCGGGTGGTCCGCGCCGGAGTCAACAGCCTCAAGCCCGGCCAGAAGATCAAACTCGACGAGGATGCGCGATGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_248847.1", "sequence": "MKPFSLAGLFGFALLLSGCGDEPPPAPPRPVLTVTVKTLKNDDLGRFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGDLASAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAAVQQARDQLSYTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPADARFLVSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSSAGSVRSVLPASVLLERDGKTQVWVVDGKQSSVALREVQVLSRDERQVVIGQGLADGDRVVRAGVNSLKPGQKIKLDEDAR"}}}}, "ARO_category": {"36298": {"category_aro_name": "efflux pump conferring antibiotic resistance", "category_aro_cvterm_id": "36298", "category_aro_accession": "3000159", "category_aro_description": "Efflux proteins that pump antibiotic out of a cell to confer resistance."}}, "ARO_name": "TriB", "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40315", "model_name": "TriB", "model_type_id": "40292"}, "2194": {"model_id": "2194", "ARO_accession": "3003681", "ARO_description": "TriC is a resistance nodulation cell division (RND) transporter that is a part of TriABC-OpmH, a triclosan-specific efflux protein.", "model_sequences": {"sequence": {"3382": {"dna_sequence": {"fmax": "182569", "fmin": "179521", "accession": "NC_002516.2", "strand": "+", "sequence": "ATGAAGGGCGGTTTCAACCTGTCGGACTGGGCCCTGCGCCACCAGTCCCTGGTCTGGTACCTGATGGCGGTATCGCTGGTGATGGGCGTGTTCTCCTACCTCAACCTGGGGCGCGAGGAGGATCCCTCGTTCGCCATCAAGACCATGGTCATCCAGACCCGCTGGCCGGGCGCCACGGTGGACGACACCCTGGAGCAGGTCACCGACCGCATCGAGAAGAAGCTCGAGGAGCTGGACTCGCTGGATTACGTGAAGAGCTACACGCGACCCGGCGAATCGACGGTCTTCGTCTACCTCAAGGACACCACCAAGGCCGGCGACATCCCGGATATCTGGTACCAGGTGCGCAAGAAGATATCCGACATCCAGGGCGAATTCCCCCAGGGCATCCAGGGACCGGGTTTCAACGACGAGTTCGGCGACGTGTTCGGCAGCGTCTACGCCTTCACCGCCGATGGCCTGGACTTCCGCCAGCTGCGCGACTACGTGGAGAAGGTGCGCCTGGACATCCGCTCGGTGAAAGACCTGGGCAAGGTGCAGATGATCGGTGCGCAGAACGAGGTCATCTACCTCAACTTCTCTACCCGCAAGCTGGCCGCCCTCGGTCTCGACCAGCGCCAGGTCGTGCAGAGCCTGCAGGCGCAGAACGCGGTGACCCCGTCCGGCGTGGTCGAGGCCGGCCCCGAGCGCATCTCGGTGCGCACCTCCGGCAACTTCCGTTCGGAAAAGGACCTGCAGGCGGTCAACCTGCGGGTCAACGATCGTTTCTACCGGCTGTCCGACCTGGCCAGCATCAGCCGCGATTTCGTCGACCCGCCGACCTCGCTGTTCCGCTACAAGGGCGAGCCGGCCATCGGCCTGGCGGTGGCGATGAAGGAGGGCGGCAATATCCTCGAGTTCGGCGAGGCGCTCAATGCGCGCATGCAGGAGATCACCGGCGAACTGCCGGTTGGCGTCGGCGTGCACCAGGTGTCGAACCAGGCCCAGGTGGTGAAGAAGGCGGTCGGCGGTTTCACCCGGGCGCTGTTCGAGGCGGTGGTGATCGTCCTCATCGTCAGCTTCGTCAGCCTCGGCCTGCGCGCCGGGCTGGTGGTGGCCTGCTCGATCCCGCTGGTGCTGGCGATGGTCTTCGTGTTCATGGAATACACCGACATCACCATGCAGCGGGTTTCCCTCGGCGCGCTGATCATCGCCCTCGGCCTGCTGGTGGACGATGCCATGATCACCGTGGAGATGATGATCACGCGCCTCGAACTGGGCGACTCGCTACACGACTCGGCGACCTACGCCTACACCTCGACGGCCTTCCCGATGCTCACCGGGACCCTGGTGACGGTGGCCGGCTTCGTACCCATCGGGCTCAACGCCAGCTCCGCCGGCGAGTACACCTTCACCCTGTTCGCAGTGATCGCCGTGGCGCTGCTGCTGTCGTGGATCGTCGCGGTGCTGTTCGCCCCGGTGATCGCCGTGCACATCCTGCCGAAGACTCTCAAGCACAAGTCGGAGCAGAAGAAGGGCCGCATTGCCGAGCGTTTCGACAGCCTGCTGCACCTGGCGATGCGCCGGCGCTGGACGACCATCTTCCTCACCGCGCTGCTGTTCGGCGTGTCGCTGTTCCTGATGAAGTTCGTCCAGCACCAGTTCTTCCCGTCTTCCGACCGTCCGGAACTGCTGGTCGACCTCAACCTGCCGCAGAACAGCAGCATCCACGAGACCAGGGCGGTGATGGACCGCCTGGAAGCGACGCTGAAGGACGACGAGGACATCGACCACTGGAGCGCCTACGTCGGCGAAGGCGCGATCCGCTTCTACCTGCCGCTGGACCAGCAGTTGCAGAACAACTTCTATGGCCAGCTGGTGATCGTCACCAAGGACCTGGAGGCCCGCGAGCGCGTCGCCGCACGCCTGCGCGATCGCTTGCGCAAGGACTACGTCGGCATCAGCACCTACGTGCAGCCGCTGGAGATGGGGCCGCCGGTGGGACGGCCGATCCAGTACCGGGTCAGCGGACCGCAGATCGACAAGGTCCGCGAGTACGCCATGGGCCTGGCCGGCGTGCTCGACGGCAACCCGAACATCGGCGATATCGTCTACGACTGGAACGAGCCCGGGAAGATGCTCAAGATCGACATCGCCCAGGACAAGGCGCGCCAGCTCGGGCTTTCCTCCGAGGACGTGGCGCAGATCATGAACAGCGTGGTGACCGGCAGCGCGGTGACCCAGGTGCGCGACGACATCTACCTGGTGAACGTCATCGGCCGCGCCGAGGATAGCGAGCGCGGCTCGCTGGAGACCCTGGAGAGCCTGCAGATCGTCACGCCCAGCGGCACCTCGATCCCGCTCAAGGCGTTCGCCAAGGTCAGCTACGAGCTGGAGCAGCCGCTGGTGTGGCGCCGCGACCGCAAGCCGACGATCACGGTGAAGGCGTCGCTGCGCGGCGAGATCCAGCCCACCGACCTGGTCGCCCGGCTGGCGCCGGAGGTCAAGCGCTTCGCCGACGGCCTGCCGGCGAACTACCGGATCGAAGTGGGCGGCACGGTGGAGGAGAGCGGCAAGGCCGAGGGCCCGATCGCCAAGGTGGTGCCGCTGATGCTGTTCCTCATGGCGACCTTCCTGATGATCCAGTTGCAGAGCGTGCAGAAGCTATTCCTGGTGGCCAGCGTCGCGCCGCTGGGGCTGATCGGGGTGGTCGCGGCGTTGCTGCCGACCGGCACGCCGATGGGCTTCGTGGCGATCCTCGGGATTCTCGCGCTGATCGGCATCATCATCCGCAACTCGGTGATCCTGGTGACCCAGATCGATGCCTTCGAGAAAGACGGCAAGACGCCCTGGGAAGCCGTGCTGGAAGCCACCCACCACCGCACCCGGCCGATCCTGCTGACGGCGGCGGCGGCCAGCCTGGGGATGATCCCCATCGCCCGCGAAGTGTTCTGGGGGCCGATGGCCTATGCGATGATCGGCGGCATCGTCGCCGCCACGCTGCTCACGCTGATCTTCCTGCCGGCGCTGTACGTCGCCTGGTACCGGATTCCGGAACCGGGACGCTGA"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_248848.1", "sequence": "MKGGFNLSDWALRHQSLVWYLMAVSLVMGVFSYLNLGREEDPSFAIKTMVIQTRWPGATVDDTLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLKDTTKAGDIPDIWYQVRKKISDIQGEFPQGIQGPGFNDEFGDVFGSVYAFTADGLDFRQLRDYVEKVRLDIRSVKDLGKVQMIGAQNEVIYLNFSTRKLAALGLDQRQVVQSLQAQNAVTPSGVVEAGPERISVRTSGNFRSEKDLQAVNLRVNDRFYRLSDLASISRDFVDPPTSLFRYKGEPAIGLAVAMKEGGNILEFGEALNARMQEITGELPVGVGVHQVSNQAQVVKKAVGGFTRALFEAVVIVLIVSFVSLGLRAGLVVACSIPLVLAMVFVFMEYTDITMQRVSLGALIIALGLLVDDAMITVEMMITRLELGDSLHDSATYAYTSTAFPMLTGTLVTVAGFVPIGLNASSAGEYTFTLFAVIAVALLLSWIVAVLFAPVIAVHILPKTLKHKSEQKKGRIAERFDSLLHLAMRRRWTTIFLTALLFGVSLFLMKFVQHQFFPSSDRPELLVDLNLPQNSSIHETRAVMDRLEATLKDDEDIDHWSAYVGEGAIRFYLPLDQQLQNNFYGQLVIVTKDLEARERVAARLRDRLRKDYVGISTYVQPLEMGPPVGRPIQYRVSGPQIDKVREYAMGLAGVLDGNPNIGDIVYDWNEPGKMLKIDIAQDKARQLGLSSEDVAQIMNSVVTGSAVTQVRDDIYLVNVIGRAEDSERGSLETLESLQIVTPSGTSIPLKAFAKVSYELEQPLVWRRDRKPTITVKASLRGEIQPTDLVARLAPEVKRFADGLPANYRIEVGGTVEESGKAEGPIAKVVPLMLFLMATFLMIQLQSVQKLFLVASVAPLGLIGVVAALLPTGTPMGFVAILGILALIGIIIRNSVILVTQIDAFEKDGKTPWEAVLEATHHRTRPILLTAAAASLGMIPIAREVFWGPMAYAMIGGIVAATLLTLIFLPALYVAWYRIPEPGR"}}}}, "ARO_category": {"36298": {"category_aro_name": "efflux pump conferring antibiotic resistance", "category_aro_cvterm_id": "36298", "category_aro_accession": "3000159", "category_aro_description": "Efflux proteins that pump antibiotic out of a cell to confer resistance."}}, "ARO_name": "TriC", "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40316", "model_name": "TriC", "model_type_id": "40292"}, "2195": {"model_id": "2195", "ARO_accession": "3003682", "ARO_description": "OpmH is an outer membrane efflux protein required in TriABC-OpmH for triclosan-specific efflux pump function.", "model_sequences": {"sequence": {"3383": {"dna_sequence": {"fmax": "5585549", "fmin": "5584100", "accession": "NC_002516.2", "strand": "+", "sequence": "ATGCTGCGCAGACTCTCCCTGGCGGCCGCCGTGGCCGCTGCTACCGGTGTCGCCTGGGCCGCCCAGCCGACCCCGCTGCCGACCAAGACCGACCTGATCAGCGTCTACAAGGAAGCCGTCGACAACAACGCCGACCTCGCCGCCGCCCAGGCCGACTACCTGGCGCGCAAGGAAGTGGTGCCCCAGGCCCGCGCCGGCCTGCTGCCGCAACTCGGCGCCGGCGCCCGCGTCGGAGACACCCGGATCGCATTCGACGAGCGTCCGGCGACCGTCAAGCGCAACAGCCAGGTCGTCCAGGCCACCCTCAGCCAGCCGTTGTTCCGCGCCGACCGCTGGTTCCAGTGGCAGGCCGCCAAGGAAACCAGCGACCAGGCCCGGCTGGAATTCTCCGCGACCCAGCAGGACCTGATCCTGCGCAGCGCCGAGACCTACTTCACGGTGCTCCGCGCCCAGGACAACCTGGCCACCAGCAAGGCCGAGGAAGCCGCCTTCAAGCGCCAGCTGGACCAGGCCAACGAGCGCTTCGACGTGGGCCTTTCCGACAAGACCGACGTGCTCGAGGCCCAGGCCAGCTACGACACCGCCCGCGCCAACCGGTTGATCGCCGAACAGCGCGTGGACGATGCCTTCCAGGCCCTGGTGACCCTGACCAACCGCGACTACAGCGCCATCGAGGGCATGCGCCACACCCTGCCGGTGGTGCCGCCGGCGCCGAACGACGCCAAGGCCTGGGTCGACACCGCGGTGCAGCAGAACCTGCGCCTGCTGGCCAGCAACTACGCGGTCAACGCCGCCGAGGAAACCCTCCGCCAGCGCAAGGCCGGGCACCTGCCGACCCTCGATGCCGTGGCCCAGTACCAGAAGGGCGACAACGACGCCCTCGGCTTCGCCAACAGCGCCGCCAATCCGCTGGTGCACTATGGCAAGTATGTCGACGAGCGCAGCATTGGCCTGGAACTGAACATCCCGATCTACAGCGGCGGCCTGACCTCCTCCCAGGTCCGCGAGTCCTACCAGCGCCTCAACCAGAGCGAGCAATCCCGCGAAGGCCAGCGCCGCCAGGTGGTGCAGGATACCCGCAACCTGCACCGCGCGGTGAATACCGACGTCGAGCAGGTCCAGGCGCGGCGCCAGGCGATCATCTCCAACCAGAGTTCGCTGGAAGCCACCGAGATCGGCTACCAGGTCGGCACCCGCAACATCGTCGACGTGCTCAACGCCCAGCGCCAGCTGTACGCCGCCGTGCGCGACTACAACAACAGCCGCTACGACTACATCCTCGATACCCTGCGCCTGAAGCAGGCGGCCGGCACCCTCAGCCCGGCCGACCTGGAGGCGCTCAGCGCCTACCTGAAGCAGGACTACGATCCGGACAAGGACTTCCTCCCGCCGGACCTGGCCAAGGCCGCCGCCGAGCAGTTACAGAGCAAGCCGCGCCAGCAGTACTAG"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_253661.1", "sequence": "MLRRLSLAAAVAAATGVAWAAQPTPLPTKTDLISVYKEAVDNNADLAAAQADYLARKEVVPQARAGLLPQLGAGARVGDTRIAFDERPATVKRNSQVVQATLSQPLFRADRWFQWQAAKETSDQARLEFSATQQDLILRSAETYFTVLRAQDNLATSKAEEAAFKRQLDQANERFDVGLSDKTDVLEAQASYDTARANRLIAEQRVDDAFQALVTLTNRDYSAIEGMRHTLPVVPPAPNDAKAWVDTAVQQNLRLLASNYAVNAAEETLRQRKAGHLPTLDAVAQYQKGDNDALGFANSAANPLVHYGKYVDERSIGLELNIPIYSGGLTSSQVRESYQRLNQSEQSREGQRRQVVQDTRNLHRAVNTDVEQVQARRQAIISNQSSLEATEIGYQVGTRNIVDVLNAQRQLYAAVRDYNNSRYDYILDTLRLKQAAGTLSPADLEALSAYLKQDYDPDKDFLPPDLAKAAAEQLQSKPRQQY"}}}}, "ARO_category": {"36298": {"category_aro_name": "efflux pump conferring antibiotic resistance", "category_aro_cvterm_id": "36298", "category_aro_accession": "3000159", "category_aro_description": "Efflux proteins that pump antibiotic out of a cell to confer resistance."}}, "ARO_name": "OpmH", "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40317", "model_name": "OpmH", "model_type_id": "40292"}, "2196": {"model_id": "2196", "ARO_accession": "3003684", "model_param": {"snp": {"param_value": {"3143": "T83I", "3144": "H80R", "3145": "D87N"}, "param_type_id": "36301", "param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}, "ARO_description": "Point mutation of Pseudomonas aeruginosa gyrA resulted in the lowered affinity between fluoroquinolones and gyrA. Thus, conferring resistance.", "model_sequences": {"sequence": {"3384": {"dna_sequence": {"fmax": "3559198", "fmin": "3556426", "accession": "NC_002516.2", "strand": "-", "sequence": "TTACTCTTCGTTGCCTTCCGCTTCCGCCGCGGGCTCGGACTCGGACTCGGCCGACTCGCCCAGAGATTCGGCAGCTTCCTCGCCCTCGGGCAGGTCCTCGTCATCTCCGCCCGACGGCTCCTGGACACGCTCCAGACCGACCAGTACCTCGTCGCTGGCGAGCTTGATCAGGGTTACGCCCTGGGTATTGCGGCCGGACAGGGAGACTTCGTCGACACGCGTCCGCACCAGGGTGCCCTGGTCGGAAATCAGCATGATCTCCTCGCCTTCCTGGACCTGTACCGCGGCGATCAGCGCGCCGTTGCGCTCGTTGGTGACCATGGCGATCACCCCCTGGCCGCCGCGGCCGCGACGCGGGAACTTGCTCAGCGGGGTACGCTTGCCGAAGCCGCGCTCGGAGGCGGTGAGGATCTGCGCCCCGGACTCCGGAATCAGCATGGAGATCAGCTGCTGCCCCTTGCCCAGGCGCATGCCACGTACGCCGCGGGCGTTGCGGCCCATGATGCGCACCACGCTCTCGGCGAAGCGGATCACCTTGCCGGCGCTGGAGAACAGCATGACTTCCTTGGCGCCATCGGTGATCGCGGCGGCGATCAGGGTGTCGCCCTCTTCCAGCTTGAGCGCGATCAGGCCGCTGCTGCGCGGACGGCTGAACTGCACCAGCGGGGTCTTCTTCACGGTACCGAAGGCGGTGGCCATGAAGATGTAGGCGCCGGTCGGCTCGGCCACCAGCTCGGCGGTCTCGCCCTCGACTTCCTCGACCTCGGCGGCCTCGACCACCTCGCCCTCGAGCACCGCGCCTTCGGCTTCGTCGAGGTCGTCATCGGCGCCACCGTTCTGCTGCAGCGCCTCCAGGTCGATCTGCAACATCGCGGTGATCCGCTCGCCCTCATCCAGCGGCAGCAGGTTCACCAGCGGCCGGCCACGCGCGGTACGCGAGGCTTCCGGAATCTCGAAGGTACGCAGCCAGTAGACCTTGCCCTTGCTGGAGAACAGCAGGAGGGTCGCATGGCTGTTGGCCACCAGCAGGTGTTCGATGTAGTCCTCGTCCTTCATCCCGGTGGCGGACTTGCCTTTGCCGCCGCGACGCTGCGCCTGGTAGGCGGCCAGCGGCTGGGACTTGGCGTAGCCGCCGTGCGAGATGGTCACCACGCGGTCTTCCTCGGTGATCAGGTCGGCGATGGTCAGGTCGACCTGGGAAGCCACGATCTCGGTGCGGCGAGCATCGCCGAATTCGGCCTTGACCGCTTCCAGTTCCTCACGGATCACCTCCATCAGGCGCGCCGGGTTGGTCAGGATGCGGATCAGCTCGCCGATCAGGTTGAGGATTTCCTGGTATTCGGAGAGCAGCTTCTCGTGCTCCAGGCCGGTCAGGCGATGCAGGCGCAGCTCGAGGATCGCCTGGGCCTGCTCCGGCGACAGGTAGTACTTGCCGTCGCGCAGGCCGTACTGCGGATCCAGGTCTTCCGGACGACAGGCGTCGGCGCCGGCACGCTCGACCATCGCTTCCACCGCGCTGGACTCCCAGGCAGTGGCGATCAGGCGTTCCTTGGCCTCGGCCGGGGTCGGCGAACTCTTGATCAGCTCGATCACCGGGTCGATGTTCGACAGGGCGACCGCCTGGCCTTCCAGGATGTGCCCGCGCTCGCGGGCCTTGCGCAGCTCGTAGACGGTACGCCGGGTCACCACTTCGCGGCGGTGGCGGACGAACACCTCGAGCATGTCCTTCAGGTTCAGCGTGCGCGGCTGGCCGTCGACCAGGGCCACCACGTTGATGCCGAACACGCTCTGCAGCTGGGTCTGGGCATAGAGGTTGTTGAGGACCACCTCGCCCACCTCGCCGCGACGCAGCTCGATGACCACGCGCATGCCGTCCTTGTCAGACTCGTCGCGCAGCTCGGAAATACCCTCGATCTTCTTCTCTTTCACCAGCTCGGCGATCTTCTCGATCAACCGCGCCTTGTTCAACTGGTACGGCAGCTCGGTGATGATAATCTGCTCGCGACCGCCGCCCTTCTCCATCTCCTCGACGACGGCGCGGGCACGGATGTAGATGCGCCCGCGACCGGTGCGGTAGGCCTCGATGATCCCGGCGCGGCCGTTGATGATGCCGGCGGTGGGGAAGTCCGGACCGGGGATGTACTGCATCAGCTCATCGACGGTCAGGTCGGGGTTGTCCATCAGCGCCAGGCAGCCGTCGATCACTTCGCCGAGGTTGTGCGGCGGGATGTTGGTCGCCATGCCCACGGCGATACCGCTGGAACCGTTGACCAGCAGGTTGGGAATCTTGGTCGGCATGACCGCCGGGATCTGCTCGGTGCCATCGTAGTTGGGCACCCAGTCGACGGTTTCCTTTTCCAGGTCCGCCAGCAGTTCGTGGGCCAGCTTGGCCATGCGCACTTCGGTGTATCGCATGGCTGCGGCGTTGTCGCCGTCCACCGAACCGAAGTTGCCCTGGCCGTCTACCAGCATGTAGCGCAGCGAGAACGGCTGCGCCATGCGCACGATGGTGTCGTAGACCGCGGTGTCGCCGTGCGGGTGGTACTTACCGATCACGTCGCCGACCACACGGGCGGATTTCTTGTAGGGCTTGTTCCAGTCGTTGCCCAGCTCGCTCATGGCATAAAGCACACGGCGGTGCACCGGCTTCAGGCCGTCACGTGCATCCGGCAGGGCCCGCCCGACGATCACGCTCATCGCGTAGTCGAGATAGGACTGTTTCAGCTCGTCTTCGATATTGACCGGGAGAATTTCTTTGGCCAGTTCGCCCAT"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_251858.1", "sequence": "MGELAKEILPVNIEDELKQSYLDYAMSVIVGRALPDARDGLKPVHRRVLYAMSELGNDWNKPYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDNAAAMRYTEVRMAKLAHELLADLEKETVDWVPNYDGTEQIPAVMPTKIPNLLVNGSSGIAVGMATNIPPHNLGEVIDGCLALMDNPDLTVDELMQYIPGPDFPTAGIINGRAGIIEAYRTGRGRIYIRARAVVEEMEKGGGREQIIITELPYQLNKARLIEKIAELVKEKKIEGISELRDESDKDGMRVVIELRRGEVGEVVLNNLYAQTQLQSVFGINVVALVDGQPRTLNLKDMLEVFVRHRREVVTRRTVYELRKARERGHILEGQAVALSNIDPVIELIKSSPTPAEAKERLIATAWESSAVEAMVERAGADACRPEDLDPQYGLRDGKYYLSPEQAQAILELRLHRLTGLEHEKLLSEYQEILNLIGELIRILTNPARLMEVIREELEAVKAEFGDARRTEIVASQVDLTIADLITEEDRVVTISHGGYAKSQPLAAYQAQRRGGKGKSATGMKDEDYIEHLLVANSHATLLLFSSKGKVYWLRTFEIPEASRTARGRPLVNLLPLDEGERITAMLQIDLEALQQNGGADDDLDEAEGAVLEGEVVEAAEVEEVEGETAELVAEPTGAYIFMATAFGTVKKTPLVQFSRPRSSGLIALKLEEGDTLIAAAITDGAKEVMLFSSAGKVIRFAESVVRIMGRNARGVRGMRLGKGQQLISMLIPESGAQILTASERGFGKRTPLSKFPRRGRGGQGVIAMVTNERNGALIAAVQVQEGEEIMLISDQGTLVRTRVDEVSLSGRNTQGVTLIKLASDEVLVGLERVQEPSGGDDEDLPEGEEAAESLGESAESESEPAAEAEGNEE"}}}}, "ARO_category": {"35950": {"category_aro_name": "antibiotic resistant gene variant or mutant", "category_aro_cvterm_id": "35950", "category_aro_accession": "0000031", "category_aro_description": "Resistance to antibiotics is often conferred by single nucleotide polymorphisms (SNPs) and other mutations in target genes."}, "36241": {"category_aro_name": "fluoroquinolone resistance gene", "category_aro_cvterm_id": "36241", "category_aro_accession": "3000102", "category_aro_description": "Genes conferring resistance to fluoroquinolones."}}, "ARO_name": "Pseudomonas aeruginosa gyrA conferring resistance to fluoroquinolones", "model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_id": "40319", "model_name": "Pseudomonas aeruginosa gyrA conferring resistance to fluoroquinolones", "model_type_id": "40293"}, "2198": {"model_id": "2198", "ARO_accession": "3003685", "model_param": {"snp": {"param_value": {"3149": "M437I", "3150": "A473V"}, "param_type_id": "36301", "param_type": "resistance variant", "param_description": "A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s)."}}, "ARO_description": "Point mutation in Pseudomonas aeruginosa parE resulting in fluoroquinolones resistance", "model_sequences": {"sequence": {"3386": {"dna_sequence": {"fmax": "5577917", "fmin": "5576027", "accession": "110645304", "strand": "-", "sequence": "TCAGACCAGCACCTCGGCCAGGTTGCCCTTGCTTTCCAGCCAGGACTTGCGGTCACCGGCGCGCTTCTTGGCCAGCAGCATGTCCATGATCTCCAGGGTACCGGTGGCGTCCTCCAGGGTGAGCTGGACCAGCCGCCGGGTATTCGGATCCATGGTGGTCTCGCGCAGTTGCAACGGATTCATTTCGCCAAGGCCCTTGAAGCGGGTGACCTGCGGCTTGCCGCGCTTCTTCTCTGCGGCCAGGCGCTCGAGGATGCCGTCGCGCTCGGCTTCGTCGAGGGCGTAGTAGATGTCCTTGCCGAGGTCGATGCGGTACAGCGGCGGCATCGCCACGTAGACGTGGCCGGCTTCCACCAGCGGGCGGAAATGGCGGACGAACAGCGCGCAGAGCAGCGTGGCGATGTGCAGCCCGTCGGAGTCGGCATCCGCGAGGATACAGATCTTGCCGTAGCGCAGCTGGGCCAGGTCACTGGCACCCGGATCGACGCCGATGGCCACCGCGATGTCGTGGACCTCCTGGCTGGCGAGCACCTCGCCGCCGTCCACTTCCCAGGTGTTCAGGATCTTTCCGCGCAGCGGCATGATCGCCTGGAATTCCTTGTCCCGCGCCTGCTTCGCCGAGCCGCCGGCGGAGTCGCCCTCGACCAGGAACAGTTCCGCGCGCATCGGTTCCTGTCCGGCGCAGTCGGCCAGTTTGCCGGGCAGCGCCGGCCCCTGGGTGATCTTCTTGCGCTCGACCTTCTTGCCCGCCTTGAGGCGACGCCCGGCGTTGCTGATCGCCAGTTCCGCCAGTTGCAGGCCGATTTCGGCGTGCTCGTTGAGCCACAGGCTGAAGGCGTCCTTCACCACGCCCGAGACGAACGCCGCCGCCTCGCGGGACGACAGGCGCTCCTTGGTCTGCCCGGAGAACTGCGGCTCCTGCATCTTCATCGAGAGGACGAAGGCGATCCGCTCCCAGACGTCCTCGGGCGCCAGCTTGACGCCGCGCGGCAACAGGTTGCGGAACTCGCAGAACTCGCGCATGGCGTCGAGCAGGCCCTGGCGCAGGCCGTTCACATGGGTGCCGCCCTGGGCCGTGGGAATCAGGTTGACGTAGCTTTCCTGCACCGACTCACCGCCCTCGGGCAGCCACAGCAGGGCCCAGCTCACCGCTTCCTTGGAACCTTCGAGGTTGCCGCAGAAGGGTTCATCGGGCAGGCGCGGCAGCTCGGCGACCGCGTCGGTCAGGTAGGAGCGCAGGCCGTCCTCGAAGTGCCACTCGACGCGCTCGCCGGTGTTCTTGTCCTCGAACACCACGCTCAGGCCCGGGCACAGCACCGCCTTGGCCTTGAGCACATGCTTGAGGCGGCTGACCGAGAACTTCGCCGAATCGAAATACTTCGGATCCGGCCAGAAATGCACGCTGGTACCGGTATTGCGCTTGCCGACCGTGCCGATGACTTCCAGATCGCTGTCCTTGAAGCCGTCGGCGAAGGTCATCCGGTACTCGTTGGCGTCGCGCTTGACGCGTACCTCGACCCGGGTCGAGAGCGCGTTCACCACCGAGATGCCGACCCCGTGCAAGCCGCCGGAGAACTGGTAGTTCTTGTTCGAGAACTTGCCGCCGGCATGCAGCTTGGTAAGGATCAGCTCGACGCCCGGCACGCCCTCTTCCGGGTGGATGTCCACCGGCATGCCGCGGCCATCGTCGATGACTTCCAGCGAGTTGTCCTGGTGCAGGATCACCTGCACGCTCTTCGCATGGCCGGCCAGGGCTTCGTCGACGCTGTTGTCGATGACTTCCTGGGCCAGATGGTTGGGGCGGGTGGTGTCGGTGTACATCCCCGGGCGCTTGCGCACCGGGTCGAGGCCGGAAAGGACTTCGATGGCGTCTGCGTTGTAAGTAGCCAT"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa PAO1", "NCBI_taxonomy_id": "208964", "NCBI_taxonomy_cvterm_id": "36804"}, "protein_sequence": {"GI": "NP_253654.1", "sequence": "MATYNADAIEVLSGLDPVRKRPGMYTDTTRPNHLAQEVIDNSVDEALAGHAKSVQVILHQDNSLEVIDDGRGMPVDIHPEEGVPGVELILTKLHAGGKFSNKNYQFSGGLHGVGISVVNALSTRVEVRVKRDANEYRMTFADGFKDSDLEVIGTVGKRNTGTSVHFWPDPKYFDSAKFSVSRLKHVLKAKAVLCPGLSVVFEDKNTGERVEWHFEDGLRSYLTDAVAELPRLPDEPFCGNLEGSKEAVSWALLWLPEGGESVQESYVNLIPTAQGGTHVNGLRQGLLDAMREFCEFRNLLPRGVKLAPEDVWERIAFVLSMKMQEPQFSGQTKERLSSREAAAFVSGVVKDAFSLWLNEHAEIGLQLAELAISNAGRRLKAGKKVERKKITQGPALPGKLADCAGQEPMRAELFLVEGDSAGGSAKQARDKEFQAIMPLRGKILNTWEVDGGEVLASQEVHDIAVAIGVDPGASDLAQLRYGKICILADADSDGLHIATLLCALFVRHFRPLVEAGHVYVAMPPLYRIDLGKDIYYALDEAERDGILERLAAEKKRGKPQVTRFKGLGEMNPLQLRETTMDPNTRRLVQLTLEDATGTLEIMDMLLAKKRAGDRKSWLESKGNLAEVLV"}}}}, "ARO_category": {"35950": {"category_aro_name": "antibiotic resistant gene variant or mutant", "category_aro_cvterm_id": "35950", "category_aro_accession": "0000031", "category_aro_description": "Resistance to antibiotics is often conferred by single nucleotide polymorphisms (SNPs) and other mutations in target genes."}, "36241": {"category_aro_name": "fluoroquinolone resistance gene", "category_aro_cvterm_id": "36241", "category_aro_accession": "3000102", "category_aro_description": "Genes conferring resistance to fluoroquinolones."}}, "ARO_name": "Pseudomonas aeruginosa parE conferring resistance to fluoroquinolones", "model_type": "protein variant model", "model_description": "A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.", "ARO_id": "40320", "model_name": "Pseudomonas aeruginosa parE conferring resistance to fluoroquinolones", "model_type_id": "40293"}, "2199": {"model_id": "2199", "ARO_accession": "3003686", "ARO_description": "oprD is an outer membrane porin which facilitates the uptake of basic amino acids and imipenem in Pseudomonas aeruginosa.", "ARO_category": [], "ARO_name": "oprD", "model_type": "protein homolog model", "model_description": "Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.", "ARO_id": "40321", "model_name": "oprD", "model_type_id": "40292"}}}