Model_id	Action	ARO_name	ARO_category	Changes To	Summary
344	UPDATE	SHV-188	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
345	UPDATE	bcrA	 efflux pump conferring antibiotic resistance;  peptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
346	UPDATE	QnrB23	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
347	UPDATE	Sfh-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
340	UPDATE	CMY-51	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
341	UPDATE	IMP-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
342	UPDATE	smeS	 efflux pump conferring antibiotic resistance;  beta-lactam resistance gene;  aminoglycoside resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
343	UPDATE	OXA-31	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
348	UPDATE	OXY-3-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
349	UPDATE	vanL	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
298	UPDATE	vanYG1	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
299	UPDATE	CepS beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
296	UPDATE	VIM-23	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
297	UPDATE	CMY-98	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
294	UPDATE	CfxA4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
295	UPDATE	OXA-145	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
292	UPDATE	TEM-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
293	UPDATE	SHV-180	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
290	UPDATE	vatD	 antibiotic inactivation enzyme;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
291	UPDATE	APH(3')-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
270	UPDATE	LEN-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
271	UPDATE	CMY-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
272	UPDATE	QnrB36	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
273	UPDATE	VEB-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
274	UPDATE	OXA-174	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
275	UPDATE	OKP-B-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
276	UPDATE	tetR	 efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
277	UPDATE	TEM-91	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
278	UPDATE	imiS	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
279	UPDATE	CTX-M-107	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
642	UPDATE	aadA25	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1781	UPDATE	AAC(2')-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2189	UPDATE	Ureaplasma urealyticum parC conferring resistance to fluoroquinolone		model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
108	UPDATE	PDC-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PDC-8 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
109	UPDATE	ErmE	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
102	UPDATE	TLA-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
103	UPDATE	SHV-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
100	UPDATE	mycobacterium tuberculosis ethA mutant conferring resistance to ethionamide	 antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
101	UPDATE	TEM-109	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
106	UPDATE	catB9	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
107	UPDATE	TEM-43	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
104	UPDATE	OXA-61	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
105	UPDATE	CARB-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2046	UPDATE	tet33	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2047	UPDATE	OXA-322	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2044	UPDATE	QnrB31	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2045	UPDATE	OXY-2-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2042	UPDATE	IND-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2043	UPDATE	aadA8	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2040	UPDATE	TEM-60	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2041	UPDATE	OXA-424	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2048	UPDATE	OXA-57	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2049	UPDATE	QnrB72	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
99	UPDATE	QnrB38	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
98	UPDATE	CMY-48	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
91	UPDATE	gadX	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  beta-lactam resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
90	UPDATE	Staphylococcus aureus rpoB mutants conferring resistance to rifampicin	 rifampin resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
93	UPDATE	SHV-105	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
92	UPDATE	CTX-M-42	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
95	UPDATE	CMY-56	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
94	UPDATE	CMY-79	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
97	UPDATE	vanXYC	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
96	UPDATE	OXA-426	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1991	UPDATE	otrC	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1990	UPDATE	CMY-82	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1993	UPDATE	QnrB74	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1620	UPDATE	CTX-M-156	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1627	UPDATE	CTX-M-95	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1994	UPDATE	gimA glycosyltransferase	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1625	UPDATE	OXA-179	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1996	UPDATE	vanXM	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1999	UPDATE	TEM-215	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1998	UPDATE	CTX-M-83	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1629	UPDATE	TEM-197	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1628	UPDATE	SHV-154	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
559	UPDATE	vanXYE	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
558	UPDATE	qacB	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
555	UPDATE	OXA-133	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
554	UPDATE	OXA-163	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
557	UPDATE	SHV-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
556	UPDATE	vanYB	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
551	UPDATE	CTX-M-117	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
550	UPDATE	CMY-71	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
553	UPDATE	VIM-35	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
552	UPDATE	QnrB28	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1199	UPDATE	SHV-168	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1198	UPDATE	mefB	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1191	UPDATE	mdtM	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1190	UPDATE	OXA-354	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1193	UPDATE	ErmH	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1192	UPDATE	VEB-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1195	UPDATE	SHV-55	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1194	UPDATE	OXA-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1197	UPDATE	Mycobacterium tuberculosis rpsL mutations conferring resistance to Streptomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1196	UPDATE	OXA-71	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1759	UPDATE	vanF	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1758	UPDATE	OXA-326	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1757	UPDATE	emrA	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1756	UPDATE	CMY-93	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1755	UPDATE	CTX-M-23	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1754	UPDATE	vanO	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1753	UPDATE	SHV-148	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1752	UPDATE	mdtK	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1751	UPDATE	Erm(33)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1750	UPDATE	OXA-254	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1177	UPDATE	KPC-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1176	UPDATE	Mycobacterium tuberculosis katG mutations conferring resistance to isoniazid	 antibiotic resistant gene variant or mutant;  isoniazid resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1175	UPDATE	Enterococcus faecium cls conferring resistance to daptomycin	 antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1174	UPDATE	QnrB22	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1173	UPDATE	TEM-54	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1172	UPDATE	OXA-194	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1171	UPDATE	tet44	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1170	UPDATE	CMY-46	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1179	UPDATE	IMP-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1178	UPDATE	CMY-81	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
511	UPDATE	dfrA3	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
510	UPDATE	CTX-M-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1005	UPDATE	Escherichia coli soxR mutants	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
644	UPDATE	OXY-2-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1285	UPDATE	sat-1	 streptothricin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1284	UPDATE	IND-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1287	UPDATE	CTX-M-110	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1004	UPDATE	vanRD	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1281	UPDATE	OXA-110	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1280	UPDATE	QnrB12	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1283	UPDATE	KPC-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1282	UPDATE	SIM-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1003	UPDATE	OXA-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
879	UPDATE	TEM-185	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1289	UPDATE	OKP-B-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1288	UPDATE	OXA-82	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
514	UPDATE	LEN-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1579	UPDATE	QnrB9	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1578	UPDATE	SHV-123	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
689	UPDATE	CTX-M-123	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
688	UPDATE	MOX-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
685	UPDATE	OXA-239	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
684	UPDATE	SHV-37	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
687	UPDATE	APH(3')-Vc	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
686	UPDATE	OXA-162	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
681	UPDATE	TEM-120	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
680	UPDATE	CMY-54	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
683	UPDATE	CMY-75	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
682	UPDATE	QnrS4	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
623	UPDATE	OXA-68	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1226	UPDATE	adeG	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1240	UPDATE	Bacillus intrinsic mph	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
621	UPDATE	ErmF	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1224	UPDATE	Erm(30)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
627	UPDATE	Escherichia coli rpoB mutants conferring resistance to rifampicin	 rifampin resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1222	UPDATE	FosA	 fosfomycin resistance gene;  antibiotic inactivation enzyme; 	ARO_description; model_type; model_sequences; model_param; model_description	"UPDATED ARO_description with An enzyme that confers resistance to fosfomycin in Serratia marcescens by breaking the epoxide ring of the molecule. It depends on the cofactors Manganese (II) and Potassium and uses Glutathione (GSH) as the nucleophilic molecule. In Pseudomonas aeruginosa, FosA catalyzes the conjugation of glutathione to carbon-1 of fosfomycin, rendering it ineffective as an antibacterial drug.
UPDATED model_type with protein homolog model
UPDATED fmax with 1222098
UPDATED strand with +
UPDATED accession with NC002516
UPDATED fmin with 1221690
UPDATED sequence with ATGCTTACCGGTCTCAATCACCTGACCCTGGCGGTCGCCGACCTGCCGGCCAGCATCGCCTTCTACCGCGATCTTCTCGGCTTTCGCCTGGAAGCGCGCTGGGACCAGGGCGCCTATCTCGAACTGGGTTCGCTGTGGCTGTGCCTGTCCCGGGAGCCGCAGTACGGCGGGCCGGCCGCGGACTACACGCACTACGCCTTCGGCATCGCCGCCGCGGATTTCGCCCGCTTCGCCGCGCAGCTGCGCGCGCATGGCGTGCGCGAATGGAAGCAGAACCGCAGCGAGGGCGATTCGTTCTACTTCCTCGACCCGGACGGCCATCGCCTGGAGGCCCACGTCGGCGACCTGCGCAGCCGGCTCGCGGCGTGCCGGCAAGCGCCCTATGCGGGAATGCGTTTCGCCGACTAG
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa PAO1
UPDATED NCBI_taxonomy_id with 208964
UPDATED NCBI_taxonomy_cvterm_id with 36804
UPDATED GI with NP_249820.1
UPDATED sequence with MLTGLNHLTLAVADLPASIAFYRDLLGFRLEARWDQGAYLELGSLWLCLSREPQYGGPAADYTHYAFGIAAADFARFAAQLRAHGVREWKQNRSEGDSFYFLDPDGHRLEAHVGDLRSRLAACRQAPYAGMRFAD
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1221	UPDATE	OXA-231	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1243	UPDATE	mphA	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1220	UPDATE	OCH-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
407	UPDATE	OXA-352	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1370	UPDATE	AAC(6')-Ib10	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
405	UPDATE	OXA-202	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
404	UPDATE	OXA-217	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1375	UPDATE	CMY-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1374	UPDATE	blaI	 antibiotic resistance gene cluster, cassette, or operon;  beta-lactam resistance gene;  gene modulating beta-lactam resistance;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1377	UPDATE	CTX-M-60	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
400	UPDATE	PDC-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1379	UPDATE	OXA-313	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1378	UPDATE	AAC(3)-IIc	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
452	UPDATE	QnrVC4	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
409	UPDATE	vanRL	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
408	UPDATE	OXA-380	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1343	UPDATE	OXA-166	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1344	UPDATE	mexH	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1345	UPDATE	tetK	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
456	UPDATE	adeR	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
457	UPDATE	OXA-93	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
379	UPDATE	OXA-148	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
378	UPDATE	TEM-214	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
647	UPDATE	TEM-89	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
371	UPDATE	SHV-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
370	UPDATE	SHV-112	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
373	UPDATE	MIR-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
372	UPDATE	qacA	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
375	UPDATE	mdtH	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
374	UPDATE	SHV-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
377	UPDATE	mepA	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
376	UPDATE	lnuC	 lincosamide resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1244	UPDATE	OXY-5-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
393	UPDATE	QnrS5	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
392	UPDATE	TUS-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
391	UPDATE	VIM-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
390	UPDATE	vanSG	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
397	UPDATE	OXA-357	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
396	UPDATE	sul3	 antibiotic target replacement protein;  sulfonamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
395	UPDATE	TLE beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
394	UPDATE	OXA-130	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
399	UPDATE	MIR-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
398	UPDATE	TEM-71	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1246	UPDATE	AAC(2')-Ic	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
245	UPDATE	cmlA5	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
244	UPDATE	SHV-164	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
247	UPDATE	TEM-158	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
246	UPDATE	CTX-M-126	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
241	UPDATE	ACT-30	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
240	UPDATE	vanRF	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
243	UPDATE	OXA-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
242	UPDATE	SHV-152	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
249	UPDATE	PmrB	 polymyxin resistance gene;  gene altering cell wall charge conferring antibiotic resistance; 	model_type; model_description; model_sequences; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED fmax with 1434
UPDATED strand with +
UPDATED accession with JQ340365
UPDATED fmin with 0
UPDATED sequence with ATGTCCCGTGCCGCCGTCCCCTCCGTCCGCCGGCGCCTGCTGGTCAACCTGCTGGTCGGCTTCGTGCTGTGCTGGCTGAGCGTGGCGGCGCTGACCTACCACCTCTCGCTGAAGCAGGTGAACCGCCTGTTCGACGACGACATGGTGGACTTCGGCGAAGCCGCCCTGCGCCTGCTCGACCTTGCCACCGAAGACCAGGCCGGCGAGGACGGCTCCATCACCGAGATCATCGAACGCAGCCGCGAAGCGATCCAGGGTCTGCCCCTGCTGCGCCGCGAAAGCGCCCTCGGCTACGCCCTGTGGCGCGACGGCCAGCCGCTGCTGTCGAGCCTCAACCTGCCGCCGGAGATCACGGCCCAGGGCCCCGGCTTCAGCACCGTGGAAGCCCAGGGCACCCACTGGCGGGTGCTCCAGCTGAACATCGACGGCTTCCAGATCTGGATCAGCGAAAACCTGATCTACCGCCAGCACACCATGAACCTGCTGCTGTTCTACTCGCTGTTCCCACTGCTGCTGGCGCTGCCGTTGCTCGGCGGCCTGGTCTGGTTCGGCGTTGCCCGCGGCCTGGCGCCGCTACGCGAAGTGCAGGCCGAGGTCCAGCAGCGCTCCGCGCGACACCTGCAGCCGATCGCGGTGGAAGCGGTGCCGCTGGAGATCCGCGGCCTCATCGACGAACTCAACCTCCTGCTGGAGCGTCTGCGCACCGCCCTCGAGGCCGAACGCCGACTGACCAGCGACGCCGCCCATGAAATCCGCACGCCACTGGCCAGCCTGCGCACCCATGCCCAGGTCGCGCTGCGTTCGGAAGACCCCAAGGCCCACGCCCGCGGCCTGCTGCAAGTCAGTCGCAGCGTCGAGCGGATCAGCACCTTGATGGAGCAGATCCTGCTCCTCGCCCGCCTCGACGGCGACGCCCTGCTGGAGCAATTCCACCCGGTCAACCTCGCCACCCTGGCCGAAGACGTACTCTCCGAACTGGCGCGCCAGGCCATCGACAAGGACATCGAGCTGTCGTTGCACCAGGAGACCGTGCACGTGATGGGCATCGACCTGTGGCTGAAGGCGATGGTCGGCAACCTGGTGGGCAACGCCCTGCGCTACACACCGGCCGGGGGCCAGGTCGAGATCCGCGTCGAGAATCGCGCCCAGCACGCCGTGCTGCGGGTGCGCGACAACGGCCCCGGGGTCGCCCTGGAAGAGCAGCAGGCGATCTTCACCCGCTTCTACCGCAGCCCCGCCACCAGCAGCGGCGAGGGCAGCGGCCTGGGCCTGCCGATCGTCAAGCGCATCGTCGAACTGCACTTCGGCAGTATCGGCCTGGGCAAGGGACTGGAGGGCAAAGGGCTGGAAGTGCAGGTGTTCCTGCCGAAGACCCAGCCGGACGCGACGCGGCCGCCGGCCAGAGGTCCGGACAGCGGGCGGTCACATATCTGA
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa
UPDATED NCBI_taxonomy_id with 287
UPDATED NCBI_taxonomy_cvterm_id with 36752
UPDATED GI with AEX49906.1
UPDATED sequence with MSRAAVPSVRRRLLVNLLVGFVLCWLSVAALTYHLSLKQVNRLFDDDMVDFGEAALRLLDLATEDQAGEDGSITEIIERSREAIQGLPLLRRESALGYALWRDGQPLLSSLNLPPEITAQGPGFSTVEAQGTHWRVLQLNIDGFQIWISENLIYRQHTMNLLLFYSLFPLLLALPLLGGLVWFGVARGLAPLREVQAEVQQRSARHLQPIAVEAVPLEIRGLIDELNLLLERLRTALEAERRLTSDAAHEIRTPLASLRTHAQVALRSEDPKAHARGLLQVSRSVERISTLMEQILLLARLDGDALLEQFHPVNLATLAEDVLSELARQAIDKDIELSLHQETVHVMGIDLWLKAMVGNLVGNALRYTPAGGQVEIRVENRAQHAVLRVRDNGPGVALEEQQAIFTRFYRSPATSSGEGSGLGLPIVKRIVELHFGSIGLGKGLEGKGLEVQVFLPKTQPDATRPPARGPDSGRSHI
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
248	UPDATE	OKP-B-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
179	UPDATE	QnrA5	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
178	UPDATE	vanHA	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
177	UPDATE	IMP-51	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
176	UPDATE	CMY-25	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
175	UPDATE	CTX-M-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
174	UPDATE	CfxA2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
173	UPDATE	arr-4	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
172	UPDATE	oprN	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  trimethoprim resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
171	UPDATE	TEM-78	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
170	UPDATE	IMP-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2051	UPDATE	dfrA15	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2050	UPDATE	OXA-331	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2053	UPDATE	dfrA7	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2052	UPDATE	APH(3'')-Ic	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2055	UPDATE	LRA-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2054	UPDATE	msrC	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2057	UPDATE	SHV-179	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2056	UPDATE	mdtO	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2059	UPDATE	OKP-A-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2058	UPDATE	pp-flo	 efflux pump conferring antibiotic resistance;  phenicol resistance gene;  chloramphenicol resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
654	UPDATE	dfrA26	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
655	UPDATE	OXA-243	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
652	UPDATE	tcr3	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
653	UPDATE	AAC(3)-VIIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1367	UPDATE	oleD	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
650	UPDATE	aadA	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
651	UPDATE	mprF	 antibiotic target modifying enzyme;  peptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1364	UPDATE	CMY-101	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1977	UPDATE	AAC(6')-Ik	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1976	UPDATE	mefA	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1975	UPDATE	blt	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1365	UPDATE	AAC(6')-I30	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1974	UPDATE	emrD	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1973	UPDATE	TEM-111	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1972	UPDATE	OXA-149	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1971	UPDATE	dfrB2	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1970	UPDATE	SHV-44	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1362	UPDATE	IMP-31	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1968	UPDATE	SHV-189	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1969	UPDATE	tet35	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1618	UPDATE	OXA-362	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1619	UPDATE	L1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1616	UPDATE	CTX-M-152	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1617	UPDATE	vanE	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1614	UPDATE	TEM-194	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1615	UPDATE	APH(2'')-IIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1960	UPDATE	smeB	 efflux pump conferring antibiotic resistance;  beta-lactam resistance gene;  aminoglycoside resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1613	UPDATE	CMY-38	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1610	UPDATE	OXA-74	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1611	UPDATE	SME-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1363	UPDATE	CARB-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1768	UPDATE	CTX-M-144	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1769	UPDATE	CTX-M-115	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1762	UPDATE	aadA16	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1763	UPDATE	NDM-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1760	UPDATE	QnrB35	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1761	UPDATE	OXA-351	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1766	UPDATE	VIM-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1767	UPDATE	OKP-A-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1764	UPDATE	OXA-97	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1765	UPDATE	OXA-56	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1142	UPDATE	dfrA17	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1143	UPDATE	OXA-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1140	UPDATE	CMY-86	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1141	UPDATE	OXA-169	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1146	UPDATE	TEM-156	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1147	UPDATE	CMY-63	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1144	UPDATE	VgbB	 antibiotic inactivation enzyme;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1145	UPDATE	CTX-M-124	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1148	UPDATE	OXA-363	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1149	UPDATE	AER-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
769	UPDATE	KPC-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
692	UPDATE	TEM-159	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
693	UPDATE	OXA-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1544	UPDATE	dfrE	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
691	UPDATE	vanRE	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
696	UPDATE	cfrA	 linezolid resistance gene;  lincosamide resistance gene;  macrolide resistance gene;  antibiotic target modifying enzyme;  phenicol resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
697	UPDATE	Erm(42)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
694	UPDATE	CTX-M-40	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
695	UPDATE	CMY-66	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
698	UPDATE	TEM-205	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
699	UPDATE	QnrS9	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1548	UPDATE	APH(3')-Vb	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1549	UPDATE	ErmB	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
542	UPDATE	adeH	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
543	UPDATE	TEM-106	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
540	UPDATE	emrY	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
541	UPDATE	TEM-133	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
546	UPDATE	TLA-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
547	UPDATE	arr-5	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
544	UPDATE	AAC(6')-Is	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
545	UPDATE	GES-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
548	UPDATE	QnrB3	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
549	UPDATE	TEM-107	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
760	UPDATE	TEM-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
761	UPDATE	GES-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
766	UPDATE	SHV-102	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
767	UPDATE	OXA-207	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
764	UPDATE	FOX-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
765	UPDATE	QnrB7	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
414	UPDATE	OXA-377	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
415	UPDATE	TEM-33	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
416	UPDATE	OXA-204	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
417	UPDATE	QnrB6	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
410	UPDATE	AAC(3)-IIIb	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
411	UPDATE	QnrB11	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
412	UPDATE	OXA-117	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
413	UPDATE	OXA-144	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1384	UPDATE	OXA-382	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1385	UPDATE	mdsB	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1386	UPDATE	ANT(9)-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1387	UPDATE	OXA-99	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1380	UPDATE	TEM-193	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
419	UPDATE	SLB-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1382	UPDATE	rmtG	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1383	UPDATE	IMI-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
368	UPDATE	CARB-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
369	UPDATE	SHV-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
366	UPDATE	Mycobacterium tuberculosis iniA mutant conferring resistance to Ethambutol	 efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  ethambutol resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
367	UPDATE	CTX-M-25	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
364	UPDATE	CMY-83	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
365	UPDATE	TEM-122	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
362	UPDATE	CTX-M-151	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
363	UPDATE	TEM-155	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
360	UPDATE	AAC(6')-Iy	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
361	UPDATE	OXA-278	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
380	UPDATE	CTX-M-147	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
381	UPDATE	QnrS1	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
382	UPDATE	QnrB61	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
383	UPDATE	phoQ	 efflux pump conferring antibiotic resistance;  polymyxin resistance gene;  macrolide resistance gene;  gene modulating antibiotic efflux;  gene altering cell wall charge conferring antibiotic resistance; 	model_type; model_description; model_sequences; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED fmax with 2029
UPDATED strand with +
UPDATED accession with JN868716
UPDATED fmin with 682
UPDATED sequence with GTGATCCGTTCCCTGCGCATCCGTCTGATGCTCGGCGCCGCCGCCCTGGCGGTGCTGTTCATGCTGGCGCTGCTGCCGGCCCTGCAGCGGGCCTTCGGCATCGCCCTGGAGAACACCATCGAGCAGCGCCTGGCCGCCGACGTGGCGACCCTGGTCTCGGCGGCGCGGGTGGAGAAGGGCCGCCTGGTGATGCCCGAGCACCTGCCGGTGGAGGAGTTCAACCTGCCGGAGGCCAAGGTCCTCGGCTATATCTACGACCAGAATGGCGATCTGCTCTGGCGCTCCACCTCGGCGGCCGACGAGTCGATCAACTACACGCCGCGCTACGACGGCCGCGGCAACGAATTCCACACCACCCGCGATGCGAAGGGCGAGGAGTTCTTCGTGTTCGACGTCGAGATCGACCTGCTGCGCGGCAAGCAGGCGGCCTACAGCATCGTCACCATGCAATCGGTCAGCGAGTTCGAGAGCCTGCTCAAGGGGTTCCGCGAGCAGCTCTACCTGTGGCTCGGCGGCGCCCTGCTGGTCTTGCTCGGGCTGCTCTGGCTGGGTCTGACCTGGGGCTTCCGGGCGATGCGCGGGTTGAGTTCCGAGCTGGACCAGATCGAATCCGGCGAGCGCGAGAGCCTGAGCGAGGAGCATCCGCGCGAGCTGCTGCGCCTGACCCACTCGCTGAACCGCCTGTTGCGCAGCGAGCACAAGCAGCGCGAGCGCTACCGCCACTCCCTCGGCGACCTGGCGCACAGTCTGAAGACGCCGCTGGCGGTCTTGCAGGGGGTCGGCGACCAGCTCGCCGAGGAGCCCGGCAACCGCGAGCAGGTGCGGGTGCTACAGGGCCAGATCGAGCGCATGAGCCAGCAGATAGGCTATCAGTTGCAGCGCGCCAGCCTGCGCAAGAGCGGCCTGGTACGCCATCGCGAGCAACTGGCGCCGCTGGTGGAGACCCTGTGCGACGCGCTGGACAAGGTCTATCGCGACAAGCGGGTAAGCCTGCAGCGGGACTTCTCGCCGTCCTTCAGCGTGCCGGTGGAGCGCGGCGCGCTGCTGGAACTGCTCGGCAACCTGCTGGAGAACGCCTATCGCCTGTGCCTGGGCCGGGTCCGCGTGGGCGCCCGGCTGGGGCCGGGTTACTCGGAGCTGTGGGTCGAGGACGACGGTCCCGGAGTGCCTGCCGAACAGCGCGCACGAATCATCCGCCGCGGCGAGCGCGCCGATACCCAGCACCCGGGGCAGGGCATCGGCCTGGCCGTGGCGCTGGACATCATCGAGAGCTACGACGGCGAACTGAGCCTGGACGATTCCGAGCTGGGCGGCGCCTGCTTCCGCATACGTTTCGCTACAGTCTGA
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa
UPDATED NCBI_taxonomy_id with 287
UPDATED NCBI_taxonomy_cvterm_id with 36752
UPDATED GI with AEU17992.1
UPDATED sequence with MIRSLRIRLMLGAAALAVLFMLALLPALQRAFGIALENTIEQRLAADVATLVSAARVEKGRLVMPEHLPVEEFNLPEAKVLGYIYDQNGDLLWRSTSAADESINYTPRYDGRGNEFHTTRDAKGEEFFVFDVEIDLLRGKQAAYSIVTMQSVSEFESLLKGFREQLYLWLGGALLVLLGLLWLGLTWGFRAMRGLSSELDQIESGERESLSEEHPRELLRLTHSLNRLLRSEHKQRERYRHSLGDLAHSLKTPLAVLQGVGDQLAEEPGNREQVRVLQGQIERMSQQIGYQLQRASLRKSGLVRHREQLAPLVETLCDALDKVYRDKRVSLQRDFSPSFSVPVERGALLELLGNLLENAYRLCLGRVRVGARLGPGYSELWVEDDGPGVPAEQRARIIRRGERADTQHPGQGIGLAVALDIIESYDGELSLDDSELGGACFRIRFATV
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
384	UPDATE	APH(2'')-IVa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
385	UPDATE	OXA-46	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
386	UPDATE	LEN-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
387	UPDATE	mdtA	 efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
388	UPDATE	QnrB71	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
389	UPDATE	tetW	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1253	UPDATE	GES-23	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1077	UPDATE	OXA-420	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
258	UPDATE	OXA-208	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
259	UPDATE	PBP1b	 antibiotic target replacement protein;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
252	UPDATE	APH(9)-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
253	UPDATE	vanXYG	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
250	UPDATE	cmr	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
251	UPDATE	APH(3')-VIIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
256	UPDATE	CMY-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
257	UPDATE	ACT-37	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
254	UPDATE	OXA-150	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
255	UPDATE	bleomycin resistance protein (BRP)	 glycopeptide resistance gene;  gene involved in antibiotic sequestration; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1849	UPDATE	Mycobacterium tuberculosis tlyA mutations conferring resistance to aminoglycosides	 antibiotic target modifying enzyme;  antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1848	UPDATE	CTX-M-75	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
168	UPDATE	VIM-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
169	UPDATE	IMP-33	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
164	UPDATE	vanN	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
165	UPDATE	VIM-29	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
166	UPDATE	TEM-77	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
167	UPDATE	CMY-39	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
160	UPDATE	OXA-236	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
161	UPDATE	SHV-56	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
162	UPDATE	KPC-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
163	UPDATE	OXA-376	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
908	UPDATE	CTX-M-139	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
909	UPDATE	OXA-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1090	UPDATE	TEM-169	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1091	UPDATE	IMP-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1814	UPDATE	AAC(6')-Ie-APH(2'')-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1815	UPDATE	CTX-M-134	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1816	UPDATE	TEM-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1817	UPDATE	vgaB	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1810	UPDATE	VIM-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1811	UPDATE	CARB-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1812	UPDATE	KHM-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1813	UPDATE	MOX-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1818	UPDATE	GES-26	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1819	UPDATE	TEM-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1098	UPDATE	vanB	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1099	UPDATE	OXA-48	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1609	UPDATE	QnrC	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1608	UPDATE	mexT	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  trimethoprim resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1979	UPDATE	FosA4	 fosfomycin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1978	UPDATE	OXA-200	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1601	UPDATE	LRA-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1600	UPDATE	phoP	 efflux pump conferring antibiotic resistance;  polymyxin resistance gene;  macrolide resistance gene;  gene modulating antibiotic efflux;  gene altering cell wall charge conferring antibiotic resistance; 	model_type; model_description; model_sequences; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED fmax with 686
UPDATED strand with +
UPDATED accession with JN868721
UPDATED fmin with 8
UPDATED sequence with ATGAAACTGCTGGTAGTGGAAGACGAGGCGCTGTTGCGCCACCACCTCTATACCCGCCTGGGTGAACAGGGGCACGTGGTGGACGCGGTACCGGATGCCGAGGAAGCCCTCTACCGGGTCAGCGAATACCACCACGACCTGGCGGTGATCGACCTCGGCCTGCCGGGCATGAGCGGCCTGGACCTGATCCGCGAGCTGCGTTCGCAGGGCAAGTCCTTCCCGATCCTGATCCTCACCGCCCGCGGCAACTGGCAGGACAAGGTCGAAGGCCTGGCCGCCGGGGCCGACGACTACGTGGTCAAGCCGTTCCAGTTCGAGGAACTGGAAGCGCGCCTGAACGCGTTGCTGCGACGCTCCTCGGGGTTCGTCCAGTCGACCATCGAGGCCGGCCCCCTGGTCCTCGACCTGAACCGCAAGCAGGCGCTGGTCGAGGAGCAACCGGTGGCGCTGACCGCCTACGAATACCGCATCCTCGAATACCTCATGCGGCATCACCAGCAGGTGGTGGCCAAGGAACGCCTGATGGAACAGCTCTACCCCGACGACGAGGAGCGCGACGCCAACGTCATCGAGGTGCTGGTCGGCCGCCTGCGGCGCAAGCTGGAGGCCTGCGGCGGCTTCAAGCCGATCGATACGGTGCGCGGCCAGGGCTACCTGTTCACCGAGCGCTGCCGGTGA
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa
UPDATED NCBI_taxonomy_id with 287
UPDATED NCBI_taxonomy_cvterm_id with 36752
UPDATED GI with AEU18003.1
UPDATED sequence with MKLLVVEDEALLRHHLYTRLGEQGHVVDAVPDAEEALYRVSEYHHDLAVIDLGLPGMSGLDLIRELRSQGKSFPILILTARGNWQDKVEGLAAGADDYVVKPFQFEELEARLNALLRRSSGFVQSTIEAGPLVLDLNRKQALVEEQPVALTAYEYRILEYLMRHHQQVVAKERLMEQLYPDDEERDANVIEVLVGRLRRKLEACGGFKPIDTVRGQGYLFTERCR
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1603	UPDATE	SHV-86	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1602	UPDATE	AAC(6')-Iai	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1605	UPDATE	cphA5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1604	UPDATE	CTX-M-84	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1607	UPDATE	PBP1a	 antibiotic target replacement protein;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1606	UPDATE	CTX-M-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
809	UPDATE	lnuB	 lincosamide resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
808	UPDATE	TEM-171	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
803	UPDATE	cphA4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
802	UPDATE	QnrA3	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
801	UPDATE	mfpA	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
800	UPDATE	CTX-M-87	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
807	UPDATE	OKP-B-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
806	UPDATE	SHV-150	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
805	UPDATE	mexC	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
804	UPDATE	tetB(P)	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1775	UPDATE	QnrS7	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1774	UPDATE	CTX-M-106	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1777	UPDATE	OXA-177	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1776	UPDATE	SHV-159	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1771	UPDATE	TEM-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1770	UPDATE	TEM-127	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1773	UPDATE	tet43	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1772	UPDATE	aadA11	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1779	UPDATE	CTX-M-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1778	UPDATE	OKP-A-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
608	UPDATE	OXA-361	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1159	UPDATE	TEM-129	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1158	UPDATE	SHV-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1155	UPDATE	ACT-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1154	UPDATE	TEM-146	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1157	UPDATE	vanG	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1156	UPDATE	Erm(31)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1151	UPDATE	OXA-240	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1150	UPDATE	QnrVC5	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1153	UPDATE	KPC-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1152	UPDATE	CTX-M-39	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1555	UPDATE	SHV-140	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1554	UPDATE	norA	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1551	UPDATE	OXA-78	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1550	UPDATE	smeR	 efflux pump conferring antibiotic resistance;  beta-lactam resistance gene;  aminoglycoside resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1553	UPDATE	tetS	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1552	UPDATE	MUS-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
59	UPDATE	OXA-256	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
58	UPDATE	QnrB47	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1557	UPDATE	SHV-187	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1556	UPDATE	VIM-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1559	UPDATE	mtrA	 efflux pump conferring antibiotic resistance;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
54	UPDATE	TEM-34	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
57	UPDATE	SHV-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
56	UPDATE	TEM-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
51	UPDATE	AAC(3)-IIIc	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
50	UPDATE	SME-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
53	UPDATE	MOX-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
52	UPDATE	OXY-2-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
537	UPDATE	OXA-120	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
55	UPDATE	OXA-69	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
535	UPDATE	Morganella morganii gyrB conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
534	UPDATE	vanV	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
533	UPDATE	CARB-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
532	UPDATE	CTX-M-47	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
531	UPDATE	sat-3	 streptothricin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
530	UPDATE	VIM-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
539	UPDATE	QnrB59	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
538	UPDATE	robA	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1558	UPDATE	Bacillus subtilis mprF mutations conferring resistance to daptomycin	 antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
536	UPDATE	TEM-95	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
429	UPDATE	mdsA	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
428	UPDATE	OXY-2-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1399	UPDATE	OXA-315	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1398	UPDATE	OXA-108	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
421	UPDATE	TEM-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
420	UPDATE	CTX-M-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1395	UPDATE	Neisseria gonorrhoeae mutant porin PIB (por) with reduced permeability to antibiotic	 beta-lactam resistance gene;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  gene modulating permeability to antibiotic; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1394	UPDATE	OXA-257	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1393	UPDATE	THIN-B beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
424	UPDATE	SHV-36	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1391	UPDATE	CTX-M-92	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
426	UPDATE	aadK	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1443	UPDATE	CARB-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2183	UPDATE	glycopeptide resistance gene cluster VanB	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
2182	UPDATE	glycopeptide resistance gene cluster VanD	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
2181	UPDATE	glycopeptide resistance gene cluster VanF	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
2180	UPDATE	glycopeptide resistance gene cluster VanL	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
2187	UPDATE	Staphylococcus aureus parE conferring resistance to aminocoumarin		model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2186	UPDATE	glycopeptide resistance gene cluster VanG	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
2185	UPDATE	glycopeptide resistance gene cluster VanM	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
2184	UPDATE	glycopeptide resistance gene cluster VanC	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
227	UPDATE	OKP-B-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
226	UPDATE	OXA-113	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
225	UPDATE	CTX-M-88	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2188	UPDATE	Mycoplasma hominis parC conferring resistance to fluoroquinolone		model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
223	UPDATE	GES-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
222	UPDATE	JOHN-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
221	UPDATE	CMY-100	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
220	UPDATE	TEM-92	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
151	UPDATE	OKP-A-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
150	UPDATE	catB3	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
153	UPDATE	adeF	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
152	UPDATE	cpxA	 efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  aminoglycoside resistance gene;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
155	UPDATE	TEM-195	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
154	UPDATE	mgrA	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
157	UPDATE	dfrA21	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
156	UPDATE	AAC(6')-Iaf	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
159	UPDATE	vgaALC	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
158	UPDATE	myrA	 antibiotic target modifying enzyme;  gene involved in self resistance to antibiotic;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1293	UPDATE	OXA-197	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1807	UPDATE	OXA-70	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1806	UPDATE	OXA-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1805	UPDATE	TEM-131	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1804	UPDATE	OXA-107	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1803	UPDATE	QnrVC3	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1802	UPDATE	OXA-168	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1801	UPDATE	AAC(6')-Ib11	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1800	UPDATE	SHV-120	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1809	UPDATE	QnrB5	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1808	UPDATE	tetA	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1256	UPDATE	bmr	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1948	UPDATE	TEM-167	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1949	UPDATE	cphA6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1257	UPDATE	QnrB68	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1942	UPDATE	BJP-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1943	UPDATE	Mycobacterium tuberculosis kasA mutant conferring resistance to isoniazid	 antibiotic resistant gene variant or mutant;  isoniazid resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1940	UPDATE	QnrB30	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1941	UPDATE	SHV-98	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1946	UPDATE	CTX-M-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1947	UPDATE	CTX-M-160	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1944	UPDATE	CTX-M-148	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1945	UPDATE	SHV-50	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
818	UPDATE	SHV-141	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
819	UPDATE	CTX-M-68	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1255	UPDATE	OXA-119	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
810	UPDATE	mecC	 antibiotic resistance gene cluster, cassette, or operon;  beta-lactam resistance gene;  antibiotic target replacement protein; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
811	UPDATE	TEM-26	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
812	UPDATE	CMY-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
813	UPDATE	OXA-216	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
814	UPDATE	TEM-113	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
815	UPDATE	GOB-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
816	UPDATE	OXA-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
817	UPDATE	CTX-M-158	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1623	UPDATE	GIM-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1250	UPDATE	CTX-M-96	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1622	UPDATE	vanWG	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1251	UPDATE	CTX-M-157	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1621	UPDATE	SHV-45	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1490	UPDATE	SHV-107	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1397	UPDATE	dfrC	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1492	UPDATE	MOX-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1493	UPDATE	PER-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1494	UPDATE	LAT-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1495	UPDATE	ACT-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1496	UPDATE	OXA-224	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1497	UPDATE	dfrA10	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1498	UPDATE	cphA8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1499	UPDATE	VEB-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
423	UPDATE	DHA-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1626	UPDATE	vgaE	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1700	UPDATE	ACT-28	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1701	UPDATE	Erm(39)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1702	UPDATE	MIR-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1703	UPDATE	FosK	 antibiotic inactivation enzyme;  fosfomycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1704	UPDATE	CMY-57	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1705	UPDATE	SHV-111	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1706	UPDATE	OXA-142	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1707	UPDATE	QnrB4	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1708	UPDATE	tet36	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1709	UPDATE	TEM-115	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1624	UPDATE	lmrD	 efflux pump conferring antibiotic resistance;  lincosamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1392	UPDATE	aadA22	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
427	UPDATE	OCH-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1390	UPDATE	arlR	 efflux pump conferring antibiotic resistance;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1128	UPDATE	OXA-23	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1129	UPDATE	CMY-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1120	UPDATE	IMI-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1121	UPDATE	APH(3')-VIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1122	UPDATE	OXA-180	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1123	UPDATE	FOX-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1124	UPDATE	TEM-186	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1125	UPDATE	OKP-B-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1126	UPDATE	OXA-184	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1127	UPDATE	CTX-M-64	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
524	UPDATE	dfrA25	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
525	UPDATE	CMY-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
526	UPDATE	ACT-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
527	UPDATE	SHV-38	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1018	UPDATE	APH(3')-IIc	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
521	UPDATE	OXA-386	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
522	UPDATE	floR	 efflux pump conferring antibiotic resistance;  phenicol resistance gene;  chloramphenicol resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
523	UPDATE	OXA-75	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1014	UPDATE	SHV-25	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1015	UPDATE	evgA	 gene modulating antibiotic efflux;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1016	UPDATE	OXA-255	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1017	UPDATE	CTX-M-86	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
528	UPDATE	OCH-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
529	UPDATE	SHV-185	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1012	UPDATE	KPC-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with KPC-5 is a beta-lactamase found in Klebsiella pneumoniae and Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1013	UPDATE	APH(2'')-IIIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1234	UPDATE	MIR-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1235	UPDATE	AAC(6')-IId	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	ARO_accession; ARO_name; ARO_description; model_param; model_type; model_description; ARO_id	"UPDATED ARO_accession with 3003676
UPDATED ARO_name with AAC(6')-Ib'
UPDATED ARO_description with AAC(6')-Ib' is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in P. aeruginosa and P. fluorescens.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED ARO_id with 40308
"
1236	UPDATE	CMY-53	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1237	UPDATE	Mycobacterium tuberculosis rpoB mutants conferring resistance to rifampicin	 rifampin resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1230	UPDATE	CTX-M-33	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1231	UPDATE	mel	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1232	UPDATE	cmeR	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  beta-lactam resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1233	UPDATE	tet32	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1238	UPDATE	OXA-397	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1239	UPDATE	SHV-81	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
438	UPDATE	VIM-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
439	UPDATE	SHV-83	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
436	UPDATE	OXY-4-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
437	UPDATE	SHV-69	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
434	UPDATE	LEN-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
435	UPDATE	OKP-A-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
432	UPDATE	sav1866	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
433	UPDATE	ACT-25	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
430	UPDATE	OXA-87	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
431	UPDATE	Escherichia coli marR mutant resulting in antibiotic resistance	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1630	UPDATE	IMP-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1961	UPDATE	TEM-105	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
238	UPDATE	SHV-137	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
239	UPDATE	OXA-83	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
234	UPDATE	QnrS8	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
235	UPDATE	OXA-181	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
236	UPDATE	ACT-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
237	UPDATE	BlaB beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
230	UPDATE	OXA-422	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
231	UPDATE	OXA-178	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
232	UPDATE	imiH	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
233	UPDATE	LEN-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1	UPDATE	PDC-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PDC-4 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
146	UPDATE	OXA-98	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
147	UPDATE	OXA-27	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
144	UPDATE	IMP-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
145	UPDATE	OXA-229	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
142	UPDATE	tetE	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
143	UPDATE	cphA7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
140	UPDATE	AAC(6')-IIb	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
141	UPDATE	vanRB	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
148	UPDATE	SHV-92	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
149	UPDATE	aadA12	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2088	UPDATE	Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to streptomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2089	UPDATE	TEM-31	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2082	UPDATE	CMY-106	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2083	UPDATE	Mycoplasma hominis parC conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2080	UPDATE	Escherichia coli 16S rRNA mutation in the rrsH gene conferring resistance to spectinomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2081	UPDATE	patA	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2086	UPDATE	Escherichia coli 16S rRNA mutation in the rrnB gene conferring resistance to tetracycline	 antibiotic resistant gene variant or mutant;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2087	UPDATE	aadA13	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2084	UPDATE	Mycobacterium abscessus 16S rRNA mutation conferring resistance to amikacin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2085	UPDATE	Escherichia coli 16S rRNA mutation in the rrnB gene conferring resistance to spectinomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1832	UPDATE	QnrS2	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1833	UPDATE	OXA-374	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1830	UPDATE	APH(3'')-Ib	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_sequences; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 544
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1831	UPDATE	AAC(6')-Iid	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1836	UPDATE	OXA-201	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1837	UPDATE	CTX-M-59	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1834	UPDATE	TEM-94	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1835	UPDATE	tet38	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1838	UPDATE	ACT-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1839	UPDATE	aadA14	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2154	UPDATE	Borrelia burgdorferi 16S rRNA mutation conferring resistance to spectinomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2155	UPDATE	Propionibacterium acnes 16S rRNA mutation conferring resistance to tetracycline	 antibiotic resistant gene variant or mutant;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
939	UPDATE	CTX-M-113	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2157	UPDATE	Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to gentamicin C	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2150	UPDATE	efflux pump conferring antibiotic resistance		model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2151	UPDATE	resistance-nodulation-cell division (RND) antibiotic efflux pump	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2152	UPDATE	Neisseria meningitidis 16S rRNA mutation conferring resistance to spectinomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2153	UPDATE	acridine dye		model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
933	UPDATE	OKP-A-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
932	UPDATE	GES-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
931	UPDATE	OXA-316	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
930	UPDATE	mdtD	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
937	UPDATE	OXA-242	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
936	UPDATE	OKP-A-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
935	UPDATE	OXA-314	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
934	UPDATE	IMP-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1955	UPDATE	OXA-29	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1954	UPDATE	TEM-154	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1957	UPDATE	VIM-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1956	UPDATE	IMI-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1951	UPDATE	TEM-76	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1950	UPDATE	arr-1	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1953	UPDATE	SHV-155	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1952	UPDATE	OXA-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1959	UPDATE	ACT-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1958	UPDATE	VIM-33	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
829	UPDATE	DHA-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
828	UPDATE	TEM-83	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
825	UPDATE	SHV-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
824	UPDATE	vanD	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
827	UPDATE	QnrB55	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
826	UPDATE	tolC	 chloramphenicol resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
821	UPDATE	Mycobacterium tuberculosis embB mutants conferring resistance to rifampicin	 rifampin resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
820	UPDATE	mdtB	 efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
823	UPDATE	cat	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
822	UPDATE	QnrD1	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1483	UPDATE	AAC(3)-Xa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1482	UPDATE	SME-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1481	UPDATE	OXY-1-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1480	UPDATE	EXO beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1487	UPDATE	SHV-48	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1486	UPDATE	CARB-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1485	UPDATE	MOX-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1484	UPDATE	ACT-27	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1489	UPDATE	CMY-37	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1488	UPDATE	TEM-75	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
797	UPDATE	TEM-55	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
928	UPDATE	carA	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
795	UPDATE	OXA-324	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
794	UPDATE	Staphylococcus aureus rpoC conferring resistance to daptomycin	 antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
793	UPDATE	IMP-34	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
792	UPDATE	OXY-1-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
791	UPDATE	SHV-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2146	UPDATE	Escherichia coli 16S rRNA mutation in the rrnB gene conferring resistance to streptomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1719	UPDATE	ceoA	 efflux pump conferring antibiotic resistance;  aminoglycoside resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1718	UPDATE	DIM-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
799	UPDATE	CTX-M-31	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
798	UPDATE	cmeC	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  beta-lactam resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
612	UPDATE	PDC-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PDC-7 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
613	UPDATE	VEB-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
610	UPDATE	SHV-153	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1139	UPDATE	dfrA12	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1138	UPDATE	tetD	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1133	UPDATE	SHV-109	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1132	UPDATE	OXA-88	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1131	UPDATE	AAC(3)-Ic	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1130	UPDATE	PDC-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PDC-9 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1137	UPDATE	TEM-90	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1136	UPDATE	MIR-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1135	UPDATE	Staphylococcus aureus parE conferring resistance to aminocoumarin	 aminocoumarin resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED category_aro_name with aminocoumarin resistance gene
UPDATED category_aro_cvterm_id with 36616
UPDATED category_aro_accession with 3000477
UPDATED category_aro_description with Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1134	UPDATE	linB	 lincosamide resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
614	UPDATE	SFB-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1277	UPDATE	GES-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
519	UPDATE	VIM-26	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
518	UPDATE	vanXYN	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
926	UPDATE	KPC-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1009	UPDATE	IND-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1008	UPDATE	BEL-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1007	UPDATE	OKP-A-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1006	UPDATE	tetV	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
513	UPDATE	CARB-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
512	UPDATE	CTX-M-82	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
515	UPDATE	mgt	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1002	UPDATE	AAC(6')-Ib4	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1001	UPDATE	Staphylococcus aureus mprF mutations conferring resistance to daptomycin	 antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1000	UPDATE	AAC(6')-Ib-Hangzhou	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1227	UPDATE	aadA2	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
622	UPDATE	DHA-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1225	UPDATE	TEM-178	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
620	UPDATE	OXA-320	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1223	UPDATE	viomycin phosphotransferase	 peptide antibiotic resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
626	UPDATE	vanHB	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
625	UPDATE	QnrB46	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
624	UPDATE	Mycobacterium leprae rpoB mutants conferring resistance to rifampicin	 rifampin resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
629	UPDATE	VIM-28	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
628	UPDATE	catB10	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1229	UPDATE	CTX-M-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1228	UPDATE	CMY-30	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2	UPDATE	CblA-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1286	UPDATE	SHV-34	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1714	UPDATE	ErmW	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
11	UPDATE	Erm(34)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
10	UPDATE	CARB-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
13	UPDATE	LRA-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
12	UPDATE	TEM-126	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
15	UPDATE	TEM-59	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
14	UPDATE	TEM-72	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
17	UPDATE	tet45	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
16	UPDATE	KPC-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
19	UPDATE	IMP-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
18	UPDATE	OXA-212	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
201	UPDATE	OCH-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
200	UPDATE	LEN-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
203	UPDATE	OXY-2-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
202	UPDATE	SHV-101	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
205	UPDATE	APH(4)-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
204	UPDATE	VIM-43	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
207	UPDATE	GES-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
206	UPDATE	FomA	 antibiotic inactivation enzyme;  fosfomycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
209	UPDATE	AAC(3)-Ib/AAC(6')-Ib''	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
208	UPDATE	CMY-105	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1573	UPDATE	SHV-110	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1572	UPDATE	OXA-205	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1571	UPDATE	vanSE	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1570	UPDATE	oprA	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1577	UPDATE	AAC(6')-32	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1576	UPDATE	OXA-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1575	UPDATE	OXA-91	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1574	UPDATE	Mycobacterium tuberculosis inhA mutations conferring resistance to isoniazid	 antibiotic resistant gene variant or mutant;  isoniazid resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
229	UPDATE	vanTmL	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
228	UPDATE	sdiA	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2095	UPDATE	elongation factor Tu		model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2094	UPDATE	antibiotic sensitive embC		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2097	UPDATE	Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to paromomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2096	UPDATE	Escherichia coli 16S rRNA mutation in the rrsC gene conferring resistance to kasugamicin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2091	UPDATE	Mycobacterium chelonae 16S rRNA mutation conferring resistance to gentamicin C	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2090	UPDATE	Mycobacterium abscessus 16S rRNA mutation conferring resistance to kanamycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2093	UPDATE	Chlamydophila psittaci 16S rRNA mutation conferring resistance to spectinomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2092	UPDATE	Enterobacter aerogenes acrR mutation resulting in antibiotic resistance	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2099	UPDATE	Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to kanamycin A	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2098	UPDATE	Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to viomycin	 peptide antibiotic resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
224	UPDATE	MIR-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1829	UPDATE	CMY-87	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1828	UPDATE	GES-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1825	UPDATE	CTX-M-27	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1824	UPDATE	oleI	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1827	UPDATE	SHV-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1826	UPDATE	ykkC	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  tetracycline resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1821	UPDATE	AAC(6')-Ir	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1820	UPDATE	bacA	 peptide antibiotic resistance gene;  gene conferring antibiotic resistance via molecular bypass; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1823	UPDATE	OXY-1-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1822	UPDATE	Staphylococcus aureus gyrB conferring resistance to aminocoumarin	 aminocoumarin resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED category_aro_name with aminocoumarin resistance gene
UPDATED category_aro_cvterm_id with 36616
UPDATED category_aro_accession with 3000477
UPDATED category_aro_description with Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2147	UPDATE	Escherichia coli EF-Tu mutants conferring resistance to Enacyloxin IIa	 antibiotic resistant gene variant or mutant;  elfamycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
929	UPDATE	GES-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2145	UPDATE	Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to tetracycline	 antibiotic resistant gene variant or mutant;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2144	UPDATE	Mycobacterium bovis embB mutations conferring resistance to ethambutol	 ethambutol resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2143	UPDATE	Borrelia burgdorferi 16S rRNA mutation conferring resistance to gentamicin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2142	UPDATE	Mycobacterium smegmatis 16S rRNA mutation  in the rrsA gene conferring resistance to viomycin	 peptide antibiotic resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2141	UPDATE	Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to neomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2140	UPDATE	Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to streptomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
920	UPDATE	TEM-152	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
921	UPDATE	OKP-A-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
922	UPDATE	AAC(6')-30/AAC(6')-Ib' fusion protein	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
923	UPDATE	VIM-25	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
924	UPDATE	AAC(6')-33	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
925	UPDATE	AAC(3)-IIb	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2149	UPDATE	Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to hygromycin B	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2148	UPDATE	Ureaplasma urealyticum  gyrB conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1920	UPDATE	vanSF	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1921	UPDATE	EreB	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1922	UPDATE	marA	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  gene modulating permeability to antibiotic;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1923	UPDATE	APH(3'')-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1924	UPDATE	vanM	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1925	UPDATE	mexB	 chloramphenicol resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  tetracycline resistance gene;  polymyxin resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1926	UPDATE	CMY-34	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1927	UPDATE	SHV-29	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1928	UPDATE	OXA-50	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1929	UPDATE	ACT-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
832	UPDATE	SHV-161	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
833	UPDATE	CfxA5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
830	UPDATE	SHV-157	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
831	UPDATE	OKP-B-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
836	UPDATE	TEM-68	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
837	UPDATE	vatH	 antibiotic inactivation enzyme;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
834	UPDATE	FosA3	 fosfomycin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
835	UPDATE	APH(3')-Ib	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
838	UPDATE	CTX-M-102	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
839	UPDATE	CMY-44	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
3	UPDATE	Escherichia coli ompF mutants	 antibiotic resistant gene variant or mutant;  beta-lactam resistance gene;  gene modulating permeability to antibiotic; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1267	UPDATE	QnrB40	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
784	UPDATE	AAC(6')-Iv	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
785	UPDATE	OXY-2-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
786	UPDATE	vanHO	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
787	UPDATE	dfrA23	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
780	UPDATE	CARB-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
781	UPDATE	QnrB25	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
782	UPDATE	OXA-63	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1729	UPDATE	CTX-M-66	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1726	UPDATE	FOX-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1727	UPDATE	SHV-73	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1724	UPDATE	vanHM	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1725	UPDATE	TEM-101	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
788	UPDATE	SHV-46	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
789	UPDATE	IMP-43	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1720	UPDATE	tap	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1721	UPDATE	Mycobacterium leprae dapsone resistant folP mutants	 antibiotic resistant gene variant or mutant;  sulfonamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
60	UPDATE	QnrS6	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
61	UPDATE	OXA-330	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
62	UPDATE	CMY-42	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
63	UPDATE	AAC(6')-Ib	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_sequences; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED fmax with 2604
UPDATED strand with +
UPDATED accession with AY954726
UPDATED fmin with 1965
UPDATED sequence with TTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAACCCTTCCATCGAGGGGGACGTCCAAGGGCTGGCGCCCTTGGCCGCCCCTCATGTCAAACG
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa
UPDATED NCBI_taxonomy_id with 287
UPDATED NCBI_taxonomy_cvterm_id with 36752
UPDATED GI with AAX54878.1
UPDATED sequence with MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
64	UPDATE	CMY-70	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
65	UPDATE	GES-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
66	UPDATE	SHV-41	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
67	UPDATE	OXA-391	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
68	UPDATE	TEM-132	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
69	UPDATE	aadA23	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1371	UPDATE	CTX-M-26	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1588	UPDATE	QnrB50	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1589	UPDATE	PER-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
406	UPDATE	ACC-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1582	UPDATE	dfrA5	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1583	UPDATE	QnrVC6	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1580	UPDATE	catIII	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1581	UPDATE	ACT-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1586	UPDATE	CTX-M-32	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1373	UPDATE	CMY-26	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1584	UPDATE	tet41	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1585	UPDATE	CMY-73	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1038	UPDATE	cmlB1	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1372	UPDATE	ANT(2'')-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
508	UPDATE	tetA(P)	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
509	UPDATE	FOX-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1032	UPDATE	OXA-365	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
507	UPDATE	rosB	 polymyxin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
504	UPDATE	TEM-52	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1031	UPDATE	APH(6)-Id	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
502	UPDATE	aadA17	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
503	UPDATE	CTX-M-69	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1034	UPDATE	QnrA7	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
402	UPDATE	tetY	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1212	UPDATE	OXA-141	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1213	UPDATE	nalD	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  tetracycline resistance gene;  polymyxin resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1210	UPDATE	novA	 efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1211	UPDATE	VIM-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1216	UPDATE	SHV-119	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
401	UPDATE	ACT-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
636	UPDATE	CFE-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
637	UPDATE	OXY-6-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
638	UPDATE	ACT-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
639	UPDATE	AAC(3)-IVa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1218	UPDATE	TEM-219	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
927	UPDATE	OXA-381	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1728	UPDATE	OXA-42	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
783	UPDATE	NDM-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1454	UPDATE	CMY-112	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1455	UPDATE	IND-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1456	UPDATE	IMP-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1105	UPDATE	AAC(3)-VIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1450	UPDATE	Escherichia coli parC conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1103	UPDATE	CMY-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1452	UPDATE	TEM-216	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1453	UPDATE	vanYD	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1458	UPDATE	TEM-157	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1459	UPDATE	CTX-M-78	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1108	UPDATE	Enterococcus faecium liaS mutant conferring daptomycin resistance	 peptide antibiotic resistance gene;  antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1109	UPDATE	CAU-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1722	UPDATE	TEM-184	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1723	UPDATE	IMP-44	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
959	UPDATE	OXA-64	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
958	UPDATE	OXA-418	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
216	UPDATE	LEN-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
217	UPDATE	vanXA	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
214	UPDATE	SHV-121	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
215	UPDATE	bcrC	 peptide antibiotic resistance gene;  gene conferring antibiotic resistance via molecular bypass; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
212	UPDATE	Staphylococcus aureus parC conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
213	UPDATE	OXA-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
210	UPDATE	SHV-35	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
211	UPDATE	TEM-206	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
218	UPDATE	npmA	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
219	UPDATE	OKP-A-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
957	UPDATE	tetG	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
956	UPDATE	TEM-88	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
4	UPDATE	SHV-52	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1858	UPDATE	OXA-387	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1859	UPDATE	QnrVC7	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1850	UPDATE	FomB	 antibiotic inactivation enzyme;  fosfomycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1851	UPDATE	KPC-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1852	UPDATE	rmtF	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1853	UPDATE	OXA-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1854	UPDATE	rmtA	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1855	UPDATE	CTX-M-72	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1856	UPDATE	QnrB20	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1857	UPDATE	VIM-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2172	UPDATE	antibiotic sensitive dihydropteroate synthase		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2173	UPDATE	antibiotic sensitive dihydrofolate reductase		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2170	UPDATE	rifamycin sensitive beta-subunit of RNA polymerase (rpoB)		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2171	UPDATE	1-deoxy-D-xylulose 5-phosphate reductoisomerase		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
919	UPDATE	PER-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
918	UPDATE	TEM-49	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2174	UPDATE	antibiotic sensitive embA		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
915	UPDATE	SHV-106	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
914	UPDATE	ANT(6)-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
917	UPDATE	SHV-186	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
916	UPDATE	OXA-36	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
911	UPDATE	CMY-50	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
910	UPDATE	rifampin phosphotransferase	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
913	UPDATE	OXY-6-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
912	UPDATE	LEN-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
516	UPDATE	PmrC	 polymyxin resistance gene;  gene altering cell wall charge conferring antibiotic resistance; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PmrC mediates the modification of Lipid A by the addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) and phosphoethanolamine, resulting in a less negative cell membrane and decreased binding of polymyxin B.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1423	UPDATE	TEM-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1933	UPDATE	SHV-160	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1932	UPDATE	IMP-32	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1931	UPDATE	TEM-150	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1930	UPDATE	CTX-M-29	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1937	UPDATE	OXA-118	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1936	UPDATE	CTX-M-43	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1935	UPDATE	Mycobacterium tuberculosis gyrA conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1934	UPDATE	lnuD	 lincosamide resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1939	UPDATE	AAC(6')-Ix	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1938	UPDATE	mtrD	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
847	UPDATE	CTX-M-108	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
846	UPDATE	DHA-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
845	UPDATE	TEM-163	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
844	UPDATE	CMY-117	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
843	UPDATE	QnrB14	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
842	UPDATE	PmrE	 polymyxin resistance gene;  gene altering cell wall charge conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
841	UPDATE	CTX-M-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
840	UPDATE	CMY-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
849	UPDATE	OXA-138	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
848	UPDATE	OKP-A-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
459	UPDATE	CTX-M-94	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1587	UPDATE	OXA-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1739	UPDATE	SHV-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1738	UPDATE	CTX-M-45	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1731	UPDATE	mphB	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1730	UPDATE	OXA-235	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1733	UPDATE	OXA-415	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1732	UPDATE	SHV-151	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1735	UPDATE	vatA	 antibiotic inactivation enzyme;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1734	UPDATE	IND-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1737	UPDATE	ANT(4')-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1736	UPDATE	GES-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1039	UPDATE	dfrB3	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
753	UPDATE	SMB-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
752	UPDATE	vanRM	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
751	UPDATE	TEM-217	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
750	UPDATE	SHV-172	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
757	UPDATE	CMY-80	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
756	UPDATE	Enterococcus faecium liaR mutant conferring daptomycin resistance	 peptide antibiotic resistance gene;  antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
755	UPDATE	KPC-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
754	UPDATE	CTX-M-48	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
759	UPDATE	OCH-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
758	UPDATE	OXA-198	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1595	UPDATE	mecB	 antibiotic resistance gene cluster, cassette, or operon;  beta-lactam resistance gene;  antibiotic target replacement protein; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
506	UPDATE	IMP-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1597	UPDATE	SHV-2A	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1596	UPDATE	OXA-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with OXA-24 is a beta-lactamase found in A. baumannii and P. aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1591	UPDATE	CMY-64	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1590	UPDATE	QnrB27	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1593	UPDATE	CMY-99	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1592	UPDATE	dfrA14	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1599	UPDATE	SHV-23	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1030	UPDATE	vanZA	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1025	UPDATE	TEM-136	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1024	UPDATE	AAC(6')-Ib-SK	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1027	UPDATE	tetH	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1026	UPDATE	SHV-74	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1021	UPDATE	CTX-M-54	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1020	UPDATE	OXA-241	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1023	UPDATE	IMP-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1022	UPDATE	TEM-28	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1036	UPDATE	vanWB	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1029	UPDATE	CMY-102	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1028	UPDATE	SHV-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1037	UPDATE	cmlA1	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
500	UPDATE	OXA-164	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
501	UPDATE	AAC(3)-VIIIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
605	UPDATE	OXA-96	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
604	UPDATE	OXA-385	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
607	UPDATE	TEM-201	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
606	UPDATE	IMI-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
601	UPDATE	dfrA20	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
600	UPDATE	CMY-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
603	UPDATE	mdtG	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
602	UPDATE	VIM-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1205	UPDATE	VIM-39	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1204	UPDATE	tcmA	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1207	UPDATE	DHA-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1206	UPDATE	qepA	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
609	UPDATE	emrK	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1200	UPDATE	msrA	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1203	UPDATE	Mycobacterium tuberculosis ndh mutant conferring resistance to isoniazid	 antibiotic resistant gene variant or mutant;  isoniazid resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1202	UPDATE	CTX-M-28	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
633	UPDATE	OXA-355	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
634	UPDATE	smeF	 chloramphenicol resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  tetracycline resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1217	UPDATE	OXA-139	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1214	UPDATE	TEM-134	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1215	UPDATE	FosC	 fosfomycin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1111	UPDATE	AAC(6')-Ig	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1110	UPDATE	LEN-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1113	UPDATE	ANT(6)-Ib	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1112	UPDATE	OXA-58	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1115	UPDATE	OXA-435	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1114	UPDATE	ACT-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1117	UPDATE	ErmD	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1440	UPDATE	CTX-M-103	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1119	UPDATE	EBR-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1118	UPDATE	OXA-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1351	UPDATE	QnrVC1	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1449	UPDATE	OXA-59	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1448	UPDATE	SHV-26	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1219	UPDATE	vanRN	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
461	UPDATE	OXA-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1356	UPDATE	dfrA22	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
463	UPDATE	CTX-M-30	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
489	UPDATE	Mycobacterium tuberculosis gidB mutation conferring resistance to streptomycin	 antibiotic target modifying enzyme;  antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
488	UPDATE	SHV-156	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
487	UPDATE	macB	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
486	UPDATE	cmlB	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
485	UPDATE	TEM-191	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
484	UPDATE	QnrB49	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
483	UPDATE	GES-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
482	UPDATE	LEN-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
481	UPDATE	VIM-30	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
480	UPDATE	GES-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
199	UPDATE	SRT-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
198	UPDATE	TEM-138	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
195	UPDATE	CTX-M-58	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
194	UPDATE	SHV-61	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
197	UPDATE	CTX-M-56	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
196	UPDATE	Mycobacterium tuberculosis embB mutations conferring resistance to ethambutol	 ethambutol resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
191	UPDATE	OXA-199	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
190	UPDATE	OXA-195	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
193	UPDATE	TEM-121	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
192	UPDATE	CTX-M-38	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1106	UPDATE	NDM-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1107	UPDATE	PDC-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PDC-2 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1104	UPDATE	acrB	 chloramphenicol resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1457	UPDATE	CTX-M-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1102	UPDATE	QnrB29	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1451	UPDATE	MIR-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1100	UPDATE	OXA-245	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1101	UPDATE	CTX-M-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
902	UPDATE	OXA-92	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
903	UPDATE	APH(2'')-Ig	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
900	UPDATE	tetC	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
901	UPDATE	LCR-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
906	UPDATE	CARB-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
907	UPDATE	fexA	 efflux pump conferring antibiotic resistance;  phenicol resistance gene;  chloramphenicol resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
904	UPDATE	rmtB	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
905	UPDATE	CTX-M-93	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1843	UPDATE	rmtD	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_sequences; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED fmax with 9632
UPDATED strand with -
UPDATED accession with DQ914960
UPDATED fmin with 8888
UPDATED sequence with TCATTTTCGTTTCAGCACGTAAAACAGCTCGTTTTCGCCGGTCAGCCGCGCGGCAATCGCGCGATTTTCCGGCACGTGCGCCTCCATCCATTCGGAATAGTGCTTTTCCATGCCGACGTTGCGCCCGCCGAGCGAACGCGTCGGAAACGATGCGACGATCCATTCCGCATTCACGCGCATTAGCGCATCCATCGCCGCGCCCGCACGCTGGCGCTCCAAAAGCGGCAGCACCTTAAACAGCAGCGCCGCATTCGCCTCGTCTTCCGGGATTTCGCACAGCAAATCGCCCAAACGCGCTTCCGCGCCGCCAAACGCACGAATTACGTTTACGCACTGACCGCTGATATCCACGCCGGTAATCGCCGCATTTGGCAATCGATGCGCGAGGTAGACAGGATTCAGCCCGCACGCGAGATCGAGGATTCGCGCCGGCGTTCCGCTGGCTTCAAACAGCTGATCGAACACGCGATCCATCGATTCCACAGGCAGCCGTTCGCGCGTGGACGCGTGCATTCCAAGCAGCGCTTCCCAATCGCGTGCCGCCGCCATTTCCATTGCGCGTTTGTATTCGCGCTCGGTCATGAACGCGCCGGTCACGCCGTGAAGCGCTTCGCGCGCCGCCTTGTCCACGTCCTTTTCCTTTTTGAATTTCGCGCTGCATTCACGCCATATGCGCTCGATCGTGTCCGGGCAAACGTCGCGATATTTTTTCGAAGCGAGCAGTTTTTCCTTCAGTTCGCTCAT
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa
UPDATED NCBI_taxonomy_id with 287
UPDATED NCBI_taxonomy_cvterm_id with 36752
UPDATED GI with ABJ53409.1
UPDATED sequence with MSELKEKLLASKKYRDVCPDTIERIWRECSAKFKKEKDVDKAAREALHGVTGAFMTEREYKRAMEMAAARDWEALLGMHASTRERLPVESMDRVFDQLFEASGTPARILDLACGLNPVYLAHRLPNAAITGVDISGQCVNVIRAFGGAEARLGDLLCEIPEDEANAALLFKVLPLLERQRAGAAMDALMRVNAEWIVASFPTRSLGGRNVGMEKHYSEWMEAHVPENRAIAARLTGENELFYVLKRK
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1842	UPDATE	IMI-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1841	UPDATE	OXA-76	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1840	UPDATE	CMY-59	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1847	UPDATE	emrB	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1846	UPDATE	CTX-M-91	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1845	UPDATE	OXA-312	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1844	UPDATE	OXA-128	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2169	UPDATE	rho transcription terminator factor		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2168	UPDATE	fluoroquinolone sensitive parC		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2165	UPDATE	elongation factor G		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2164	UPDATE	antibiotic sensitive arabinosyltransferase		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2167	UPDATE	antibiotic sensitive DNA topoisomerase subunit gyrB		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2166	UPDATE	fluoroquinolone sensitive gyrA		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2161	UPDATE	cycloserine sensitive alanine racemase		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2160	UPDATE	antibiotic sensitive signal peptidase I		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2163	UPDATE	fosfomycin sensitive pyruvyl transferase (murA)		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2162	UPDATE	cycloserine sensitive D-alanine synthetase		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1908	UPDATE	OKP-A-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1909	UPDATE	AAC(6')-Iak	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1906	UPDATE	CTX-M-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1907	UPDATE	vanSA	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1904	UPDATE	ACT-32	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1905	UPDATE	ACT-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1902	UPDATE	OXA-246	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1903	UPDATE	mdtE	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  beta-lactam resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1900	UPDATE	ACT-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1901	UPDATE	CTX-M-51	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
854	UPDATE	CMY-58	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
855	UPDATE	TEM-142	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
856	UPDATE	mepR	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
857	UPDATE	nfxB	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  macrolide resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
850	UPDATE	OXA-26	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
851	UPDATE	Mycobacterium tuberculosis pncA mutations conferring resistance to pyrazinamide	 antibiotic resistant gene variant or mutant;  pyrazinamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
852	UPDATE	QnrB62	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
853	UPDATE	OXA-160	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
858	UPDATE	IND-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
859	UPDATE	AER-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
6	UPDATE	acrA	 chloramphenicol resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
425	UPDATE	TEM-182	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
740	UPDATE	QnrB21	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
741	UPDATE	CfxA	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
742	UPDATE	AAC(3)-Id	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
743	UPDATE	arr-3	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
744	UPDATE	vanSL	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
745	UPDATE	CMY-40	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
746	UPDATE	AAC(2')-Ib	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
747	UPDATE	QnrA4	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
748	UPDATE	cmeB	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  beta-lactam resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
749	UPDATE	SHV-97	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1050	UPDATE	AAC(6')-Ii	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1051	UPDATE	LEN-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1052	UPDATE	OXA-206	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1053	UPDATE	SHV-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1054	UPDATE	emrE	 efflux pump conferring antibiotic resistance; 	ARO_description; model_type; model_sequences; model_param; model_description	"UPDATED ARO_description with EmrE is a small multidrug transporter that functions as a homodimer and that couples the efflux of small polyaromatic cations from the cell with the import of protons down an electrochemical gradient. EmrE is found in E. coli and P. aeruginosa.
UPDATED model_type with protein homolog model
UPDATED fmax with 5606435
UPDATED strand with +
UPDATED accession with NC_002516.2
UPDATED fmin with 5606102
UPDATED sequence with ATGACCAACTATCTCTACCTCGCCATCGCCATCGCCGCCGAAGTGGTCGCCACCACCTCGCTGAAAGCCGTCGCCGGATTCAGCAAGCCACTGCCGCTGCTGCTGGTGGTGGGCGGCTACGTGCTCGCCTTCAGCATGCTCGTGCTGGTCATGCGCACCCTGCCGGTCGGCGTGGTCTACGCCATCTGGTCCGGACTCGGCATCGTCCTGGTCAGCCTGGTGGCGATGTTCGTCTACGGCCAGCGCCTGGACCCCGCCGCCCTCCTCGGCATCGGCCTGATCATCGCCGGCGTGCTGGTGATCCAGTTGTTCTCCCGCGCTTCGGGGCACTGA
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa PAO1
UPDATED NCBI_taxonomy_id with 208964
UPDATED NCBI_taxonomy_cvterm_id with 36804
UPDATED GI with NP_253677.1
UPDATED sequence with MTNYLYLAIAIAAEVVATTSLKAVAGFSKPLPLLLVVGGYVLAFSMLVLVMRTLPVGVVYAIWSGLGIVLVSLVAMFVYGQRLDPAALLGIGLIIAGVLVIQLFSRASGH
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1055	UPDATE	Escherichia coli parE conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1056	UPDATE	VIM-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1057	UPDATE	CTX-M-114	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1058	UPDATE	VIM-27	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1059	UPDATE	APH(9)-Ib	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1696	UPDATE	Salmonella serovars gyrB conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1697	UPDATE	TEM-135	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1694	UPDATE	OXA-353	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1695	UPDATE	DHA-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1692	UPDATE	tetM	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1693	UPDATE	TEM-143	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1690	UPDATE	OXA-317	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1691	UPDATE	CMY-31	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
715	UPDATE	PDC-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PDC-3 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1698	UPDATE	OCH-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1699	UPDATE	vanXO	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1278	UPDATE	TEM-45	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1279	UPDATE	TEM-104	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
618	UPDATE	emeA	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
619	UPDATE	SHV-30	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1270	UPDATE	QnrS3	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1271	UPDATE	AAC(6')-Iw	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1272	UPDATE	CTX-M-67	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
611	UPDATE	OXA-328	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
616	UPDATE	NDM-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
617	UPDATE	OXA-147	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1276	UPDATE	OXA-210	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
615	UPDATE	OXA-211	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
711	UPDATE	SHV-62	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
710	UPDATE	dfrB6	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1491	UPDATE	lnuF	 lincosamide resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1472	UPDATE	DHA-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1473	UPDATE	CTX-M-44	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1470	UPDATE	QnrB26	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1471	UPDATE	adeI	 chloramphenicol resistance gene;  beta-lactam resistance gene;  aminocoumarin resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  lincosamide resistance gene;  tetracycline resistance gene;  rifampin resistance gene;  trimethoprim resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1476	UPDATE	TEM-199	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1477	UPDATE	SHV-39	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1474	UPDATE	mexR	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  aminocoumarin resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  polymyxin resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1475	UPDATE	SHV-99	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1478	UPDATE	CARB-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1479	UPDATE	IMP-40	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1304	UPDATE	CTX-M-85	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1305	UPDATE	oprM	 chloramphenicol resistance gene;  macrolide resistance gene;  aminoglycoside resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  tetracycline resistance gene;  polymyxin resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1306	UPDATE	IND-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1307	UPDATE	OXY-1-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1300	UPDATE	mexF	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  trimethoprim resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1301	UPDATE	Staphylococcus aureus cls conferring resistance to daptomycin	 antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1302	UPDATE	tet34	 gene conferring antibiotic resistance via molecular bypass; 	ARO_description; model_type; ARO_category; model_param; model_description	"UPDATED ARO_description with tet34 causes the activation of Mg2+-dependent purine nucleotide synthesis, which protects the protein synthesis pathway. It is found in Gram-negative Vibrio
UPDATED model_type with protein homolog model
UPDATED category_aro_name with gene conferring antibiotic resistance via molecular bypass
UPDATED category_aro_cvterm_id with 36021
UPDATED category_aro_accession with 3000012
UPDATED category_aro_description with Genes involved in restructuring of the cell wall
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1303	UPDATE	BEL-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1308	UPDATE	vanTE	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1309	UPDATE	ACT-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
498	UPDATE	QnrB17	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
499	UPDATE	vanSB	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
494	UPDATE	KPC-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
495	UPDATE	CMY-28	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
496	UPDATE	KPC-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
497	UPDATE	OXA-79	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
490	UPDATE	TEM-188	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
491	UPDATE	PER-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
492	UPDATE	catB	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
493	UPDATE	TEM-84	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
24	UPDATE	fusB	 antibiotic inactivation enzyme;  fusidic acid resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
25	UPDATE	CTX-M-121	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
26	UPDATE	VEB-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
27	UPDATE	lnuA	 lincosamide resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
20	UPDATE	CMY-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
21	UPDATE	OXA-329	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
22	UPDATE	ACT-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
23	UPDATE	OXA-371	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
28	UPDATE	OXA-45	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
29	UPDATE	Escherichia coli sulfonamide resistant mutant folP	 antibiotic resistant gene variant or mutant;  sulfonamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1511	UPDATE	OXA-423	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
7	UPDATE	CTX-M-130	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
446	UPDATE	catB8	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
591	UPDATE	CTX-M-122	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
590	UPDATE	IND-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
593	UPDATE	abeS	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1876	UPDATE	LEN-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1877	UPDATE	CMY-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1874	UPDATE	OXA-196	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1875	UPDATE	MIR-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1872	UPDATE	vanXYL	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1873	UPDATE	linG	 lincosamide resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1870	UPDATE	OXA-66	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1871	UPDATE	OXA-389	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
595	UPDATE	SHV-75	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1878	UPDATE	SRT-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1879	UPDATE	AAC(3)-IIIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
977	UPDATE	OXA-112	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
976	UPDATE	CTX-M-61	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
975	UPDATE	QnrB1	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
974	UPDATE	lmrC	 efflux pump conferring antibiotic resistance;  lincosamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
973	UPDATE	OXA-378	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
972	UPDATE	CMY-23	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
971	UPDATE	cmlA4	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
970	UPDATE	OKP-B-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
596	UPDATE	ROB-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
979	UPDATE	TEM-96	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
978	UPDATE	OXA-134	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
182	UPDATE	arlS	 efflux pump conferring antibiotic resistance;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
183	UPDATE	adeS	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
180	UPDATE	DHA-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
181	UPDATE	GES-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
186	UPDATE	OXA-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
187	UPDATE	OXA-348	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
184	UPDATE	OCH-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
185	UPDATE	OXA-232	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2110	UPDATE	CARB-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2111	UPDATE	Mycobacterium chelonae 16S rRNA mutation conferring resistance to tobramycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
188	UPDATE	SHV-89	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2113	UPDATE	Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to tobramycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2114	UPDATE	APH(3')-IIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2115	UPDATE	TEM-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2116	UPDATE	Pasteurella multocida 16S rRNA mutation conferring resistance to spectinomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2117	UPDATE	AAC(6')-Ib7	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1919	UPDATE	SHV-27	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1918	UPDATE	spd	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1464	UPDATE	aadA7	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1911	UPDATE	AAC(6')-Iad	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1910	UPDATE	CTX-M-136	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1913	UPDATE	dfrK	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1912	UPDATE	LRA-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1915	UPDATE	CMY-47	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1914	UPDATE	BEL-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1917	UPDATE	tet30	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1916	UPDATE	TEM-208	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
869	UPDATE	CRP	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  beta-lactam resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
868	UPDATE	DHA-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
189	UPDATE	CTX-M-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
861	UPDATE	OXA-215	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
860	UPDATE	TEM-42	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
863	UPDATE	PER-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
862	UPDATE	IMP-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
865	UPDATE	OXA-244	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
864	UPDATE	CMY-61	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
867	UPDATE	OXA-175	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
866	UPDATE	adeB	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2024	UPDATE	ACC-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2025	UPDATE	TEM-57	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2026	UPDATE	OXA-84	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2027	UPDATE	CMY-84	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2020	UPDATE	tetO	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2021	UPDATE	SHV-165	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2022	UPDATE	CTX-M-104	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2023	UPDATE	OXA-132	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2028	UPDATE	QnrB43	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2029	UPDATE	TEM-123	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
656	UPDATE	OXA-219	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
883	UPDATE	LRA-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
882	UPDATE	NPS beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
881	UPDATE	ErmC	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
880	UPDATE	APH(6)-Ib	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
887	UPDATE	SHV-33	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
886	UPDATE	IND-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
885	UPDATE	TEM-63	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
884	UPDATE	CTX-M-99	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
889	UPDATE	CMY-74	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
888	UPDATE	Erm(36)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
657	UPDATE	SHV-142	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
775	UPDATE	CMY-113	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
774	UPDATE	tet37	 antibiotic inactivation enzyme;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
777	UPDATE	mdtL	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
776	UPDATE	tetX	 antibiotic inactivation enzyme;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
771	UPDATE	CMY-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
770	UPDATE	SHV-57	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
773	UPDATE	OCH-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
772	UPDATE	LEN-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
779	UPDATE	OXA-350	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
778	UPDATE	IMP-25	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
77	UPDATE	TEM-47	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
76	UPDATE	SHV-79	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
75	UPDATE	fusH	 antibiotic inactivation enzyme;  fusidic acid resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
74	UPDATE	SHV-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
73	UPDATE	OXA-35	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
72	UPDATE	SHV-42	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
71	UPDATE	QnrB66	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
70	UPDATE	NDM-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
79	UPDATE	VIM-37	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
78	UPDATE	TEM-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1043	UPDATE	SHV-76	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1042	UPDATE	catB7	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1041	UPDATE	mexS	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  trimethoprim resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1040	UPDATE	OXA-95	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1047	UPDATE	catS	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1046	UPDATE	vgaD	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1045	UPDATE	ErmO	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1044	UPDATE	CTX-M-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1049	UPDATE	MOX-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1048	UPDATE	QnrB33	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1681	UPDATE	APH(4)-Ib	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1680	UPDATE	macA	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1683	UPDATE	QnrB67	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1682	UPDATE	aadA24	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1685	UPDATE	SHV-40	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1684	UPDATE	LEN-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1687	UPDATE	CEPH-A3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1686	UPDATE	OXA-34	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1689	UPDATE	vanRO	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1688	UPDATE	CTX-M-90	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1269	UPDATE	OXA-192	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1268	UPDATE	CMY-115	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
669	UPDATE	MIR-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
668	UPDATE	CTX-M-65	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
667	UPDATE	ACT-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1262	UPDATE	SHV-149	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
665	UPDATE	TEM-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
664	UPDATE	CMY-43	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
663	UPDATE	ACT-36	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
662	UPDATE	TEM-162	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1265	UPDATE	MIR-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1264	UPDATE	smeC	 efflux pump conferring antibiotic resistance;  beta-lactam resistance gene;  aminoglycoside resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1469	UPDATE	facT	 efflux pump conferring antibiotic resistance;  elfamycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1468	UPDATE	SHV-135	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1465	UPDATE	SHV-181	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
520	UPDATE	acrS	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1467	UPDATE	LEN-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1466	UPDATE	SHV-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1461	UPDATE	SHV-63	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1460	UPDATE	FosB3	 fosfomycin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1463	UPDATE	GES-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1019	UPDATE	IMP-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1317	UPDATE	CTX-M-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1316	UPDATE	catB6	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1315	UPDATE	mdtC	 efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1314	UPDATE	OXA-214	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1313	UPDATE	adeA	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1312	UPDATE	OXA-111	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1311	UPDATE	OXY-5-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1310	UPDATE	IMP-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1319	UPDATE	SHV-147	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1318	UPDATE	evgS	 gene modulating antibiotic efflux;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1010	UPDATE	TEM-209	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1011	UPDATE	TEM-29	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
319	UPDATE	OXA-366	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
318	UPDATE	OXA-358	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
313	UPDATE	OXA-143	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
312	UPDATE	OXA-167	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
311	UPDATE	IND-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
310	UPDATE	SHV-78	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
317	UPDATE	TEM-148	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
316	UPDATE	CTX-M-36	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
315	UPDATE	DHA-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
314	UPDATE	TEM-176	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
443	UPDATE	OKP-B-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
442	UPDATE	opmD	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
441	UPDATE	OXA-54	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
440	UPDATE	mexA	 chloramphenicol resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  tetracycline resistance gene;  polymyxin resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
447	UPDATE	SHV-67	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1330	UPDATE	emrR	 efflux pump conferring antibiotic resistance;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
445	UPDATE	TEM-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
444	UPDATE	AAC(6')-Ib-Suzhou	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
630	UPDATE	adeJ	 chloramphenicol resistance gene;  beta-lactam resistance gene;  aminocoumarin resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  lincosamide resistance gene;  tetracycline resistance gene;  rifampin resistance gene;  trimethoprim resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
631	UPDATE	TEM-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
632	UPDATE	PmrA	 polymyxin resistance gene;  gene altering cell wall charge conferring antibiotic resistance; 	model_type; model_description; model_sequences; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED fmax with 685
UPDATED strand with +
UPDATED accession with JQ340367
UPDATED fmin with 19
UPDATED sequence with ATGAGAATACTGCTGGCCGAGGACGACCTGCTGCTCGGCGACGGCATCCGCGCCGGGCTGCGCCTGGAAGGCGATACCGTGGAATGGGTGACCGACGGCGTGGCCGCGGAGAACGCGCTGGTCACCGACGAGTTCGACCTGCTGGTGCTCGACATCGGACTGCCGCGCCGCAGCGGCCTGGACATCCTGCGTAACCTGCGCCACCAGGGCCGGCTCACCCCGGTGCTGCTGCTCACCGCGCGGGACAAGGTGGCCGACCGGGTCGCCGGGCTCGACAGCGGTGCCGACGACTACCTGACCAAGCCCTTCGATCTCGACGAACTGCAGGCACGGGTGCGCGCCCTGACCCGCCGCACCACCGGTCGCGCCCTGCCGCAACTGGTGCACGGCGAGCTGCGCCTGGACCCGGCGACCCACCAAGTGACCCTGTCCGGGCAGGCGGTGGAACTGGCGCCGCGCGAATACGCACTGCTGCGCCTGCTGCTGGAGAACAGCGGCAAGGTGCTCTCGCGCAACCAACTGGAGCAGAGCCTCTACGGCTGGAGCGGCGACGTCGAGAGCAACGCCATCGAAGTCCACGTCCACCACCTGCGGCGCAAGCTCGGCAACCAGTTGATCCGCACCGTCCGCGGCATCGGCTACGGCATCGACCAGCCGGCGCCCTGA
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa
UPDATED NCBI_taxonomy_id with 287
UPDATED NCBI_taxonomy_cvterm_id with 36752
UPDATED GI with AEX49909.1
UPDATED sequence with MRILLAEDDLLLGDGIRAGLRLEGDTVEWVTDGVAAENALVTDEFDLLVLDIGLPRRSGLDILRNLRHQGRLTPVLLLTARDKVADRVAGLDSGADDYLTKPFDLDELQARVRALTRRTTGRALPQLVHGELRLDPATHQVTLSGQAVELAPREYALLRLLLENSGKVLSRNQLEQSLYGWSGDVESNAIEVHVHHLRRKLGNQLIRTVRGIGYGIDQPAP
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
403	UPDATE	dfrA8	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1712	UPDATE	IMP-41	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1861	UPDATE	LEN-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1860	UPDATE	OXA-165	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1863	UPDATE	VIM-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1862	UPDATE	OXA-109	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1865	UPDATE	ACC-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1864	UPDATE	CMY-67	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1867	UPDATE	CTX-M-116	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1866	UPDATE	KPC-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1869	UPDATE	OXY-2-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1868	UPDATE	TEM-82	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
964	UPDATE	OXA-129	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
965	UPDATE	OXA-333	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
966	UPDATE	vanSC	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
967	UPDATE	AAC(6')-Isa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
960	UPDATE	TEM-137	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
961	UPDATE	SHV-93	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
962	UPDATE	OXA-356	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
963	UPDATE	CMY-69	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
968	UPDATE	MIR-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
969	UPDATE	VEB-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2109	UPDATE	Mycobacterium tuberculosis gyrB mutant conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2108	UPDATE	Escherichia coli EF-Tu mutants conferring resistance to GE2270A	 antibiotic resistant gene variant or mutant;  elfamycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2103	UPDATE	SHV-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2102	UPDATE	Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to hygromycin B	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2101	UPDATE	ATP-binding cassette (ABC) antibiotic efflux pump	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2100	UPDATE	Mycobacterium chelonae 16S rRNA mutation conferring resistance to amikacin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2107	UPDATE	antibiotic sensitive embB		model_type; model_description; model_param	"UPDATED model_type with protein wild type model
UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2106	UPDATE	Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to kanamycin A	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2105	UPDATE	Mycobacterium abscessus 16S rRNA mutation conferring resistance to neomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2104	UPDATE	Ureaplasma urealyticum parC conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
635	UPDATE	OXA-332	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
641	UPDATE	CARB-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
878	UPDATE	CTX-M-142	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
640	UPDATE	tet31	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
876	UPDATE	smeE	 chloramphenicol resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  tetracycline resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
877	UPDATE	SHV-124	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
874	UPDATE	AAC(1)	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
875	UPDATE	dfrA19	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
872	UPDATE	vatC	 antibiotic inactivation enzyme;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
873	UPDATE	KPC-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
870	UPDATE	otrB	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
871	UPDATE	CGB-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2037	UPDATE	tetT	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2036	UPDATE	SHV-163	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2035	UPDATE	CTX-M-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1242	UPDATE	aadA6/aadA10	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2033	UPDATE	mtrR	 efflux pump conferring antibiotic resistance;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2032	UPDATE	CTX-M-62	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2031	UPDATE	OXA-173	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2030	UPDATE	AAC(3)-IXa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
9	UPDATE	ACT-35	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
645	UPDATE	mecR1	 antibiotic resistance gene cluster, cassette, or operon;  antibiotic target replacement protein;  beta-lactam resistance gene;  gene modulating beta-lactam resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2039	UPDATE	CARB-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2038	UPDATE	KPC-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
890	UPDATE	SHV-53	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
891	UPDATE	QnrB37	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
892	UPDATE	APH(6)-Ic	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
893	UPDATE	linA	 lincosamide resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
894	UPDATE	CMY-90	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
895	UPDATE	SHV-122	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
896	UPDATE	CTX-M-131	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
897	UPDATE	OXA-383	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
898	UPDATE	VEB-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
899	UPDATE	OXA-94	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
646	UPDATE	OXA-349	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
649	UPDATE	OXA-115	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1248	UPDATE	H-NS	 gene modulating antibiotic efflux;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1537	UPDATE	GES-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1964	UPDATE	IMP-45	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
422	UPDATE	FOX-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1965	UPDATE	LEN-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1966	UPDATE	lmrA	 lincosamide resistance gene;  antibiotic resistant gene variant or mutant;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1788	UPDATE	ACT-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1789	UPDATE	QnrB44	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
768	UPDATE	SHV-43	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1967	UPDATE	OXA-116	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1780	UPDATE	OXA-146	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1612	UPDATE	ErmR	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1782	UPDATE	TEM-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1783	UPDATE	VIM-36	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1784	UPDATE	OXA-334	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1785	UPDATE	TEM-48	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1786	UPDATE	mexY	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1787	UPDATE	VIM-42	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1962	UPDATE	OXA-47	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1963	UPDATE	TEM-190	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1078	UPDATE	VIM-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1079	UPDATE	OXA-161	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1076	UPDATE	IMP-37	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
643	UPDATE	OXY-2-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1074	UPDATE	LEN-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1075	UPDATE	TEM-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1072	UPDATE	OXA-37	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1073	UPDATE	OKP-B-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1070	UPDATE	sul1	 antibiotic target replacement protein;  sulfonamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1071	UPDATE	DHA-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1678	UPDATE	AAC(6')-Ib-cr	 antibiotic inactivation enzyme;  aminoglycoside resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1679	UPDATE	OXA-49	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1674	UPDATE	AAC(6')-It	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1675	UPDATE	CTX-M-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1676	UPDATE	GES-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1677	UPDATE	cepA beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1670	UPDATE	nalC	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  tetracycline resistance gene;  polymyxin resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1671	UPDATE	Salmonella serovars soxS mutants	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  gene modulating permeability to antibiotic;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1672	UPDATE	TEM-211	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1673	UPDATE	QnrA6	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1094	UPDATE	CARB-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1095	UPDATE	SHV-59	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1096	UPDATE	TEM-79	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1097	UPDATE	Erm(38)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
678	UPDATE	PDC-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PDC-10 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
679	UPDATE	SHV-108	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1092	UPDATE	tet39	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1093	UPDATE	AAC(6')-31	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
674	UPDATE	OXA-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
675	UPDATE	OXA-25	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
676	UPDATE	AAC(6')-Ih	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
677	UPDATE	OXA-171	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
670	UPDATE	IND-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
671	UPDATE	CTX-M-137	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
672	UPDATE	CMY-27	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
673	UPDATE	IMP-48	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1533	UPDATE	SHV-143	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1418	UPDATE	DHA-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1419	UPDATE	OXA-454	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1410	UPDATE	OXA-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1411	UPDATE	OXA-62	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1412	UPDATE	SHV-167	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1413	UPDATE	OXA-172	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1414	UPDATE	QnrB15	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1415	UPDATE	AAC(2')-Id	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1416	UPDATE	OXA-89	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1417	UPDATE	OXA-131	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1322	UPDATE	SHV-65	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1323	UPDATE	Salmonella serovars parE conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1320	UPDATE	Klebsiella mutant PhoP conferring antibiotic resistance to colistin	 gene modulating antibiotic efflux;  gene altering cell wall charge conferring antibiotic resistance;  macrolide resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  polymyxin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1321	UPDATE	mecA	 antibiotic resistance gene cluster, cassette, or operon;  beta-lactam resistance gene;  antibiotic target replacement protein; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1326	UPDATE	OXA-170	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1327	UPDATE	AAC(6')-Iq	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1324	UPDATE	LRA-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1325	UPDATE	OXA-65	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1328	UPDATE	vanSM	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1329	UPDATE	ANT(4')-IIb	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1531	UPDATE	TEM-81	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1524	UPDATE	cat-TC	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1525	UPDATE	TEM-160	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1254	UPDATE	CTX-M-46	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1527	UPDATE	SHV-51	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1520	UPDATE	SHV-85	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1521	UPDATE	VIM-32	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1522	UPDATE	IMP-38	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1523	UPDATE	mexD	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1528	UPDATE	TEM-168	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1529	UPDATE	TEM-130	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1258	UPDATE	OXA-55	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1259	UPDATE	SHV-31	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
308	UPDATE	CMY-118	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
309	UPDATE	CMY-35	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
300	UPDATE	AAC(6')-29a	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
301	UPDATE	CMY-95	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
302	UPDATE	TEM-207	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
303	UPDATE	ErmQ	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
304	UPDATE	IND-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
305	UPDATE	chrB	 antibiotic target modifying enzyme;  gene involved in self resistance to antibiotic;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
306	UPDATE	SHV-32	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
307	UPDATE	CTX-M-101	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
_timestamp	N/A	N/A	N/A	N/A	NEW: 2015-12-14T16:04:28+00:00 , OLD: 2015-08-27T20:33:35+00:00
1898	UPDATE	OXA-379	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1899	UPDATE	vanYF	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1894	UPDATE	Salmonella serovars ramR mutants	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1895	UPDATE	CfxA3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1896	UPDATE	NDM-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1897	UPDATE	tetL	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1890	UPDATE	TEM-86	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1891	UPDATE	AAC(6')-Iih	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1892	UPDATE	OXA-114a	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1893	UPDATE	SHV-127	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2136	UPDATE	Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to kanamycin A	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2137	UPDATE	Escherichia coli EF-Tu mutants conferring resistance to kirromycin	 antibiotic resistant gene variant or mutant;  elfamycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2134	UPDATE	CMY-36	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2135	UPDATE	ACT-33	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2132	UPDATE	Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to kanamycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2133	UPDATE	Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to viomycin	 peptide antibiotic resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2130	UPDATE	opcM	 efflux pump conferring antibiotic resistance;  aminoglycoside resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2131	UPDATE	Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to streptomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
951	UPDATE	ACT-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
950	UPDATE	ErmX	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
953	UPDATE	Enterococcus faecium liaF mutant conferring daptomycin resistance	 peptide antibiotic resistance gene;  antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
952	UPDATE	sul2	 antibiotic target replacement protein;  sulfonamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
955	UPDATE	SHV-96	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
954	UPDATE	APH(3')-IIb	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2138	UPDATE	NmcA beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2139	UPDATE	vanSD	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2002	UPDATE	cat86	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2003	UPDATE	pmrA efflux pump	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2000	UPDATE	TEM-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2001	UPDATE	OXA-250	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2006	UPDATE	IMP-27	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2007	UPDATE	OXA-335	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2004	UPDATE	TEM-189	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2005	UPDATE	CTX-M-89	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2008	UPDATE	SHV-145	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2009	UPDATE	aadA6	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1263	UPDATE	QnrB56	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
666	UPDATE	CTX-M-34	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2176	UPDATE	glycopeptide resistance gene cluster VanN	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
1261	UPDATE	rosA	 efflux pump conferring antibiotic resistance;  polymyxin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2177	UPDATE	glycopeptide resistance gene cluster VanA	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
1799	UPDATE	TEM-147	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1798	UPDATE	SHV-183	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
719	UPDATE	CMY-33	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
718	UPDATE	LRA-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
717	UPDATE	CTX-M-100	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1792	UPDATE	DHA-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1791	UPDATE	TEM-164	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1790	UPDATE	vanHF	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
713	UPDATE	CTX-M-81	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
712	UPDATE	catB2	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1795	UPDATE	VEB-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1794	UPDATE	tmrB	 tunicamycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
661	UPDATE	VIM-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
716	UPDATE	QnrB32	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
505	UPDATE	Mycobacterium tuberculosis iniC mutant conferring resistance to ethambutol	 efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  ethambutol resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
660	UPDATE	Streptococcus pneumonia parC conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2178	UPDATE	glycopeptide resistance gene cluster VanO	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
1069	UPDATE	IMP-35	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1068	UPDATE	AAC(6')-Ib3	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2179	UPDATE	glycopeptide resistance gene cluster VanE	 antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with gene order model
UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models.
UPDATED param_type with gene order
UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas.
"
1061	UPDATE	OXY-2-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1060	UPDATE	SHV-103	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1063	UPDATE	QnrB73	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1062	UPDATE	SHV-71	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1065	UPDATE	OXA-384	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1064	UPDATE	CTX-M-141	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1067	UPDATE	mexE	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  trimethoprim resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1066	UPDATE	TEM-118	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1669	UPDATE	vanZF	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1668	UPDATE	CMY-68	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1667	UPDATE	TEM-80	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1666	UPDATE	vanXB	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1665	UPDATE	ramA	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  gene modulating permeability to antibiotic;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1664	UPDATE	adeK	 chloramphenicol resistance gene;  beta-lactam resistance gene;  aminocoumarin resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  lincosamide resistance gene;  tetracycline resistance gene;  rifampin resistance gene;  trimethoprim resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1663	UPDATE	ACC-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1662	UPDATE	OKP-B-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1661	UPDATE	CARB-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1660	UPDATE	OXA-375	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1087	UPDATE	OXA-253	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1086	UPDATE	CMY-41	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1085	UPDATE	OKP-B-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
592	UPDATE	lmrB	 efflux pump conferring antibiotic resistance;  lincosamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1083	UPDATE	OXA-323	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
594	UPDATE	QnrB41	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
597	UPDATE	Klebsiella pneumoniae ramR mutants	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1080	UPDATE	SHV-158	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
599	UPDATE	OKP-A-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
598	UPDATE	dfrA16	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1089	UPDATE	CMY-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1088	UPDATE	Staphylococcus aureus rpoB mutants conferring resistance to daptomycin	 antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
714	UPDATE	dfrB1	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1526	UPDATE	AAC(6')-Iaa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1409	UPDATE	CMY-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1408	UPDATE	TEM-124	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1403	UPDATE	OXA-388	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1402	UPDATE	OXA-390	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1401	UPDATE	mefE	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1400	UPDATE	CTX-M-74	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1407	UPDATE	CMY-62	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1406	UPDATE	OXA-121	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1405	UPDATE	armA	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1404	UPDATE	IMP-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1546	UPDATE	Erm(43)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
449	UPDATE	SHV-133	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
448	UPDATE	dfrG	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1339	UPDATE	Mycobacterium tuberculosis embR mutant conferring resistance to ethambutol	 ethambutol resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1338	UPDATE	BLA1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1547	UPDATE	vanRC	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1335	UPDATE	QnrB8	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1334	UPDATE	SHV-126	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1337	UPDATE	baeR	 efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  aminoglycoside resistance gene;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1336	UPDATE	BcII	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1331	UPDATE	CTX-M-52	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
690	UPDATE	OXA-347	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1333	UPDATE	vanHD	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1332	UPDATE	APH(3')-IIIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1545	UPDATE	Escherichia coli gyrA conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1542	UPDATE	amrA	 efflux pump conferring antibiotic resistance;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1631	UPDATE	CTX-M-71	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1543	UPDATE	CMY-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
39	UPDATE	AAC(3)-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_sequences; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED fmax with 5520
UPDATED strand with +
UPDATED accession with U12338
UPDATED fmin with 5055
UPDATED sequence with ATGGGCATCATTCGCACATGTAGGCTCGGCCCTGACCAAGTCAAATCCATGCGGGCTGCTCTTGATCTTTTCGGTCGTGAGTTCGGAGACGTAGCCACCTACTCCCAACATCAGCCGGACTCCGATTACCTCGGGAACTTGCTCCGTAGTAAGACATTCATCGCGCTTGCTGCCTTCGACCAAGAAGCGGTTGTTGGCGCTCTCGCGGCTTACGTTCTGCCCAGGTTTGAGCAGCCGCGTAGTGAGATCTATATCTATGATCTCGCAGTCTCCGGCGAGCACCGGAGGCAGGGCATTGCCACCGCGCTCATCAATCTCCTCAAGCATGAGGCCAACGCGCTTGGTGCTTATGTGATCTACGTGCAAGCAGATTACGGTGACGATCCCGCAGTGGCTCTCTATACAAAGTTGGGCATACGGGAAGAAGTGATGCACTTTGATATCGACCCAAGTACCGCCACCTAA
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa
UPDATED NCBI_taxonomy_id with 287
UPDATED NCBI_taxonomy_cvterm_id with 36752
UPDATED GI with AAG15269.1
UPDATED sequence with MGIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTAT
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
38	UPDATE	APH(3')-Va	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1540	UPDATE	rmtC	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
33	UPDATE	msrE	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
32	UPDATE	DHA-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
31	UPDATE	CTX-M-155	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
30	UPDATE	OXA-226	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
37	UPDATE	mdfA	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
36	UPDATE	Mycobaterium leprae gyrA conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
35	UPDATE	FosA2	 antibiotic inactivation enzyme;  fosfomycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
34	UPDATE	OXY-6-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1241	UPDATE	TEM-144	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1536	UPDATE	OXA-421	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1535	UPDATE	CMY-16	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1534	UPDATE	PER-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1245	UPDATE	TEM-114	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1532	UPDATE	OXA-249	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1247	UPDATE	CMY-72	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1530	UPDATE	OXA-67	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1249	UPDATE	FOX-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
648	UPDATE	GES-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1539	UPDATE	aadA3	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1538	UPDATE	SHV-104	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
339	UPDATE	ANT(3'')-Ii-AAC(6')-IId fusion protein	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
338	UPDATE	OXY-1-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
335	UPDATE	Staphylococcus aureus parE conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
334	UPDATE	mexX	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
337	UPDATE	adeC	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
336	UPDATE	tlrB	 antibiotic target modifying enzyme;  gene involved in self resistance to antibiotic;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
331	UPDATE	TEM-166	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
330	UPDATE	IMP-26	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
333	UPDATE	CARB-23	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
332	UPDATE	r39 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2118	UPDATE	OXA-193	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
8	UPDATE	NDM-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2119	UPDATE	LRA-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1353	UPDATE	GES-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1636	UPDATE	QnrB57	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1462	UPDATE	LRA-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1352	UPDATE	OXA-251	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1350	UPDATE	TEM-93	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1889	UPDATE	NDM-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1888	UPDATE	MIR-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1887	UPDATE	TEM-70	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1886	UPDATE	LEN-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1885	UPDATE	tetZ	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1884	UPDATE	CTX-M-111	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1883	UPDATE	DHA-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1882	UPDATE	OXA-80	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1881	UPDATE	OXA-72	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1880	UPDATE	adeN	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  beta-lactam resistance gene;  aminocoumarin resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  lincosamide resistance gene;  tetracycline resistance gene;  rifampin resistance gene;  trimethoprim resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2121	UPDATE	LRA-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2120	UPDATE	MacAB-TolC	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2123	UPDATE	vgaC	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2122	UPDATE	Mycobacterium chelonae 16S rRNA mutation conferring resistance to neomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2125	UPDATE	major facilitator superfamily (MFS) antibiotic efflux pump	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2124	UPDATE	Clostridium difficile EF-Tu mutants conferring resistance to elfamycin	 antibiotic resistant gene variant or mutant;  elfamycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
948	UPDATE	mecI	 antibiotic resistance gene cluster, cassette, or operon;  antibiotic target replacement protein;  beta-lactam resistance gene;  gene modulating beta-lactam resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
949	UPDATE	CTX-M-77	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
946	UPDATE	QnrB48	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
947	UPDATE	OXA-100	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
944	UPDATE	bcrB	 efflux pump conferring antibiotic resistance;  peptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1084	UPDATE	LEN-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
942	UPDATE	OXA-104	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
943	UPDATE	vanU	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
940	UPDATE	TEM-125	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
941	UPDATE	GES-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
133	UPDATE	arr-8	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
132	UPDATE	TEM-198	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
131	UPDATE	CTX-M-50	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
130	UPDATE	CTX-M-112	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
137	UPDATE	APH(2'')-Ie	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
136	UPDATE	CMY-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
135	UPDATE	SME-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
134	UPDATE	rgt1438	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
139	UPDATE	QnrB10	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
138	UPDATE	cml	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1354	UPDATE	Mycobacterium tuberculosis embA mutant conferring resistance to ethambutol	 ethambutol resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2019	UPDATE	OXA-213	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2018	UPDATE	CMY-76	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2015	UPDATE	DHA-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2014	UPDATE	PmrF	 polymyxin resistance gene;  gene altering cell wall charge conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2017	UPDATE	CTX-M-37	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2016	UPDATE	OXA-370	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2011	UPDATE	QnrB60	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2010	UPDATE	CTX-M-129	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2013	UPDATE	Erm(41)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2012	UPDATE	SHV-178	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2112	UPDATE	patB	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
708	UPDATE	CTX-M-49	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
709	UPDATE	TEM-213	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
704	UPDATE	oprJ	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
705	UPDATE	CMY-116	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
706	UPDATE	APH(7'')-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
707	UPDATE	AIM-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
700	UPDATE	ACT-31	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
701	UPDATE	SHV-129	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
702	UPDATE	CTX-M-98	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
703	UPDATE	cmlv	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
88	UPDATE	CMY-55	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
89	UPDATE	vanYA	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
82	UPDATE	PER-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
83	UPDATE	IMP-47	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
80	UPDATE	ACT-29	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
81	UPDATE	FOX-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
86	UPDATE	TEM-102	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
87	UPDATE	TEM-116	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
84	UPDATE	GIM-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
85	UPDATE	IMP-42	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
762	UPDATE	CTX-M-55	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1658	UPDATE	OKP-B-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1659	UPDATE	OXA-258	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1652	UPDATE	IMP-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1653	UPDATE	AAC(6')-Ip	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1650	UPDATE	CMY-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1651	UPDATE	AAC(6')-If	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1656	UPDATE	CTX-M-79	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1657	UPDATE	AAC(6')-IIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1654	UPDATE	SHV-95	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1655	UPDATE	TEM-117	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
586	UPDATE	VIM-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
587	UPDATE	TEM-73	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
584	UPDATE	aadA21	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
585	UPDATE	NDM-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
763	UPDATE	catI	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
583	UPDATE	SHV-100	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
580	UPDATE	TEM-110	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
581	UPDATE	QnrB19	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1632	UPDATE	CTX-M-53	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
588	UPDATE	OKP-A-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
589	UPDATE	TEM-145	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1633	UPDATE	catQ	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1634	UPDATE	CMY-78	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1348	UPDATE	cphA1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1635	UPDATE	vanRG	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1436	UPDATE	TEM-40	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1437	UPDATE	acrF	 efflux pump conferring antibiotic resistance;  beta-lactam resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1434	UPDATE	Erm(35)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1435	UPDATE	cmlA6	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1432	UPDATE	Mycobacterium tuberculosis mutant embC conferring resistance to ethambutol	 ethambutol resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1433	UPDATE	CMY-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1430	UPDATE	SHV-125	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1431	UPDATE	GES-15	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
418	UPDATE	OXA-325	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1637	UPDATE	MOX-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1438	UPDATE	SHV-19	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1439	UPDATE	SHV-80	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1260	UPDATE	APH(3')-IVa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1541	UPDATE	ACT-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
458	UPDATE	tetB	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1349	UPDATE	IND-2a	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
450	UPDATE	OXA-51	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
451	UPDATE	LRA-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1342	UPDATE	plasmid encoded cat (pp-cat)	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
453	UPDATE	mtrE	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
454	UPDATE	KPC-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
455	UPDATE	vanC	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1346	UPDATE	SHV-94	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1347	UPDATE	OXA-425	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1082	UPDATE	CTX-M-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
517	UPDATE	QnrD2	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1266	UPDATE	ANT(4')-IIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1502	UPDATE	OXA-209	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1503	UPDATE	LEN-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1500	UPDATE	APH(6)-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1501	UPDATE	CMY-49	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1506	UPDATE	ACT-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1507	UPDATE	smeA	 efflux pump conferring antibiotic resistance;  beta-lactam resistance gene;  aminoglycoside resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1504	UPDATE	CMY-108	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1505	UPDATE	sat-4	 streptothricin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1508	UPDATE	QnrA2	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1509	UPDATE	vanXF	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
658	UPDATE	CMY-104	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
659	UPDATE	AAC(6')-29b	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1992	UPDATE	dfrA1	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2127	UPDATE	Borrelia burgdorferi 16S rRNA mutation conferring resistance to kanamycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2126	UPDATE	Mycobacterium abscessus 16S rRNA mutation conferring resistance to tobramycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2129	UPDATE	Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to spectinomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2128	UPDATE	Mycobacterium abscessus 16S rRNA mutation conferring resistance to gentamicin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
945	UPDATE	tet40	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1292	UPDATE	CTX-M-109	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1376	UPDATE	MOX-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1081	UPDATE	IMP-30	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
322	UPDATE	FEZ-1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
323	UPDATE	aadA9	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
320	UPDATE	PBP2x	 antibiotic target replacement protein;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
321	UPDATE	CTX-M-35	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
326	UPDATE	OXA-225	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
327	UPDATE	GES-17	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
324	UPDATE	QnrB54	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
325	UPDATE	LEN-23	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
328	UPDATE	cmlA	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
329	UPDATE	CTX-M-159	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1340	UPDATE	mtrC	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1594	UPDATE	VgbA	 antibiotic inactivation enzyme;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1341	UPDATE	OXA-53	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1995	UPDATE	AAC(6')-Iz	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1598	UPDATE	OXA-101	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
995	UPDATE	mexG	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
994	UPDATE	SHV-77	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
997	UPDATE	VIM-31	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
996	UPDATE	CMY-77	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
991	UPDATE	EreA	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
990	UPDATE	FOX-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
993	UPDATE	AAC(6')-Ib9	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
992	UPDATE	SHV-66	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
999	UPDATE	LEN-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
998	UPDATE	SHV-134	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
120	UPDATE	aadA4	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
121	UPDATE	mdtF	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  beta-lactam resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
122	UPDATE	VIM-34	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
123	UPDATE	SHV-64	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
124	UPDATE	IND-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
125	UPDATE	SHV-182	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
126	UPDATE	TEM-183	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
127	UPDATE	clbB	 linezolid resistance gene;  lincosamide resistance gene;  macrolide resistance gene;  antibiotic target modifying enzyme;  phenicol resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
128	UPDATE	srmB	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
129	UPDATE	FosX	 fosfomycin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2068	UPDATE	Escherichia coli 16S rRNA mutation conferring resistance to edeine	 peptide antibiotic resistance gene;  antibiotic resistant gene variant or mutant;  polyamine resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2069	UPDATE	Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to neomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2060	UPDATE	FosC2	 fosfomycin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2061	UPDATE	VIM-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2062	UPDATE	mphC	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2063	UPDATE	blaR1	 antibiotic resistance gene cluster, cassette, or operon;  beta-lactam resistance gene;  gene modulating beta-lactam resistance;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2064	UPDATE	TEM-196	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2065	UPDATE	CMY-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2066	UPDATE	Escherichia coli soxS mutant	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  gene modulating permeability to antibiotic;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2067	UPDATE	CMY-131	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
722	UPDATE	vanRA	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
723	UPDATE	SHV-72	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1645	UPDATE	ACT-23	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1644	UPDATE	SHV-70	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1647	UPDATE	mexI	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1646	UPDATE	TEM-139	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1641	UPDATE	OXA-203	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1640	UPDATE	MIR-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1643	UPDATE	arnA	 polymyxin resistance gene;  gene altering cell wall charge conferring antibiotic resistance; 	ARO_description; model_type; model_sequences; model_param; model_description	"UPDATED ARO_description with arnA modifies lipid A with 4-amino-4-deoxy-L-arabinose (Ara4N) which allows gram-negative bacteria to resist the antimicrobial activity of cationic antimicrobial peptides and antibiotics such as polymyxin. arnA is found in E. coli and P. aeruginosa.
UPDATED model_type with protein homolog model
UPDATED fmax with 3984009
UPDATED strand with +
UPDATED accession with NC_002516.2
UPDATED fmin with 3982020
UPDATED sequence with ATGACCTCGAAAGCCGTCGTCTTCGCCTACCACGACATCGGTTGCACCGGTATCGAAGCCCTGCTCAATGCCGGCTACGAGATCGCCGCCGTCTTCACCCATGCCGACGACCCACGGGAAAACACCTTCTACGCCTCGGTCGCACGCCTCTGCGCCGAGCGCGGCATTCCGCTGCACGCGCCCGAGGACGTGAACCATCCGCTGTGGCTGGAGCGTATCCGCCAACTGCGCCCGGACTTCCTGTTCTCCTTCTACTACCGCCGCCTGCTCGGCGCCGAGCTGCTCGCCTGCGCCGCACGCGGCGCCTACAACCTGCACGGTTCGCTGCTGCCGCGCTACCGCGGACGCGCCCCGGCGAACTGGGTGCTGGTCAACGGCGAAACGCAGACCGGGGTGACCCTGCATCGCATGATCGAGCGCGCCGACGCCGGGCCGATCCTCGCCCAGCAGGCCGTCGCCATCGACCCCGAGGACACCGCCCTGAGCCTGCACGGCAAGCTGCGCAAGGCCGCCGGCGCCCTGCTGCGCGACAGCCTGCCGCTGCTCGCCCTCGGCGTGCTGCCGGAAGTCGAGCAGGACGAGAGCCAGGCCAGCCACTTCGGCCGGCGCACCCCGGCGGACGGCCTGCTCGACTGGCACAGGCCGGCACGGCAGTTGTACGACCTGGTGCGCGCGGTGACCCAGCCCTACCCTGGCGCCTTCTGCCAGGTCGGCGAACAGAAGCTGATCGTCTGGAGCGCCGAGGTGGTCGCCGGCAACCACGGCCGCGAGCCGGGCAGCGTACTGTCCTGCGACCCGCTGCGGATCGCCTGCGGCGAGGACTCGCTGGTGCTGCGCTTCGGCCAGCGCGGCGAGCGCGGCCTGTACCTGGCCGGCACGCAACTGGCCACCGAGCTGGGCCTGGTCGAGGGCGCGCGCCTGCGTGGCGCGGCATGCAGTCCGCAGCGCCGCACGCGGGTGCTGATCCTCGGGGTCAACGGCTTCATCGGCAACCACCTGTCCGAACGCCTGCTGCGCGACGGTCGCTACGAGGTCCACGGCATGGACATCGGCTCCGACGCCATCGAACGGCTCAAGGCCGACCCGCATTTCCACTTCGTCGAAGGCGACATCGGCATCCATTCGGAGTGGCTCGAATACCATGTGAAGAAATGCGACGTGATCCTGCCGCTGGTGGCCATCGCCACGCCCATCGAGTACACGCGCAACCCGCTGCGGGTGTTCGAACTGGACTTCGAGGAAAACCTGCGGATCGTCCGCTACTGCGTGAAATACGGCAAACGCGTGGTGTTCCCTTCCACCTCCGAGGTCTACGGCATGTGCCAGGACCCGGACTTCGACGAAGACCGCTCGAACCTGGTGGTCGGGCCGATCAACAAGCAGCGCTGGATCTACTCGGTGTCCAAGCAGTTGCTCGACCGGGTGATCTGGGCCTACGGCCAGCAGGGCCTGCGCTTCACCCTGTTCCGTCCGTTCAACTGGATGGGCCCGCGCCTGGACCGCCTGGATTCGGCGCGGATCGGCAGCTCGCGGGCGATCACCCAGCTCATCCTGCACCTGGTCGAAGGCACGCCGATCCGCCTGGTCGACGGCGGCGCGCAGAAGCGCTGCTTCACCGACGTCGACGACGGCATCGAGGCCCTCGCGCGGATCATCGACAACCGCGACGGCCGCTGCGACGGGCAGATCGTCAACATCGGCAACCCGGACAACGAGGCGAGCATCCGCCAGCTCGGCGAGGAACTGCTGCGCCAGTTCGAGGCCCACCCGCTGCGCGCGCAGTTCCCGCCCTTCGCCGGCTTCCGCGAGGTGGAGAGCCGCAGCTTCTACGGCGACGGCTACCAGGACGTGGCCCACCGCAAGCCGAGCATCGACAACGCCCGGCGCCTGCTCGACTGGCAGCCCACCATCGAACTGCGCGAGACCATCGGCAAGACCCTCGACTTCTTCCTCCACGAAGCGCTCCGCGAGCGCGAGGCACAGGCGTGA
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa PAO1
UPDATED NCBI_taxonomy_id with 208964
UPDATED NCBI_taxonomy_cvterm_id with 36804
UPDATED GI with NP_252244
UPDATED sequence with MTSKAVVFAYHDIGCTGIEALLNAGYEIAAVFTHADDPRENTFYASVARLCAERGIPLHAPEDVNHPLWLERIRQLRPDFLFSFYYRRLLGAELLACAARGAYNLHGSLLPRYRGRAPANWVLVNGETQTGVTLHRMIERADAGPILAQQAVAIDPEDTALSLHGKLRKAAGALLRDSLPLLALGVLPEVEQDESQASHFGRRTPADGLLDWHRPARQLYDLVRAVTQPYPGAFCQVGEQKLIVWSAEVVAGNHGREPGSVLSCDPLRIACGEDSLVLRFGQRGERGLYLAGTQLATELGLVEGARLRGAACSPQRRTRVLILGVNGFIGNHLSERLLRDGRYEVHGMDIGSDAIERLKADPHFHFVEGDIGIHSEWLEYHVKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLRIVRYCVKYGKRVVFPSTSEVYGMCQDPDFDEDRSNLVVGPINKQRWIYSVSKQLLDRVIWAYGQQGLRFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILHLVEGTPIRLVDGGAQKRCFTDVDDGIEALARIIDNRDGRCDGQIVNIGNPDNEASIRQLGEELLRQFEAHPLRAQFPPFAGFREVESRSFYGDGYQDVAHRKPSIDNARRLLDWQPTIELRETIGKTLDFFLHEALREREAQA
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1642	UPDATE	clbC	 linezolid resistance gene;  lincosamide resistance gene;  macrolide resistance gene;  antibiotic target modifying enzyme;  phenicol resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1396	UPDATE	OXA-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1649	UPDATE	DHA-21	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1648	UPDATE	CTX-M-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
728	UPDATE	TEM-192	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
729	UPDATE	CTX-M-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1252	UPDATE	ceoB	 efflux pump conferring antibiotic resistance;  aminoglycoside resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
579	UPDATE	vgaA	 efflux pump conferring antibiotic resistance;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
578	UPDATE	SHV-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
573	UPDATE	OXA-136	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
572	UPDATE	OXA-137	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
571	UPDATE	clbA	 linezolid resistance gene;  lincosamide resistance gene;  macrolide resistance gene;  antibiotic target modifying enzyme;  phenicol resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
570	UPDATE	Streptococcus pyogenes sulfonamide resistant folP mutants	 antibiotic resistant gene variant or mutant;  sulfonamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
577	UPDATE	QnrB65	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
576	UPDATE	MIR-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
575	UPDATE	AAC(3)-Ib	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
574	UPDATE	AAC(6')-Ia	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with AAC(6')-Ia is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in Citrobacter diversus, E. coli, K. pneumoniae, Shigella sonnei, and P. aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1209	UPDATE	QnrB45	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1208	UPDATE	SHV-173	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1421	UPDATE	TEM-85	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1420	UPDATE	aadA5	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1997	UPDATE	tlrC	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1422	UPDATE	ACC-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1425	UPDATE	RbpA	 rifampin resistance gene;  antibiotic target protection protein; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1424	UPDATE	OXY-2-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1427	UPDATE	acrD	 efflux pump conferring antibiotic resistance;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1426	UPDATE	IMP-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1429	UPDATE	SHV-60	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1428	UPDATE	cphA2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_sequences; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 1332
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2156	UPDATE	NDM-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
731	UPDATE	IMP-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
730	UPDATE	AAC(6')-IIc	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
733	UPDATE	cpxR	 efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  aminoglycoside resistance gene;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
938	UPDATE	QnrB70	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
735	UPDATE	TEM-30	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
734	UPDATE	vanTC	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
737	UPDATE	MIR-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
736	UPDATE	arr-7	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
739	UPDATE	LRA-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
738	UPDATE	AAC(6')-Iae	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1359	UPDATE	OXA-233	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1358	UPDATE	VIM-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
469	UPDATE	SHV-49	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
468	UPDATE	Erm(37)	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
465	UPDATE	vanSO	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
464	UPDATE	NDM-13	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
467	UPDATE	CARB-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
466	UPDATE	CTX-M-76	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1357	UPDATE	CTX-M-132	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
460	UPDATE	CMY-29	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1355	UPDATE	TEM-149	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
462	UPDATE	Staphylococcus aureus pgsA mutations conferring resistance to daptomycin	 antibiotic resistant gene variant or mutant;  lipopeptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1273	UPDATE	otrA	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2158	UPDATE	Escherichia coli EF-Tu mutants conferring resistance to Pulvomycin	 antibiotic resistant gene variant or mutant;  elfamycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2159	UPDATE	23S rRNA with mutation conferring antibiotic resistance	 antibiotic resistant gene variant or mutant; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1519	UPDATE	vatE	 antibiotic inactivation enzyme;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1518	UPDATE	EreA2	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1515	UPDATE	NDM-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1514	UPDATE	IMP-28	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1517	UPDATE	OXA-33	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1516	UPDATE	CMY-45	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1274	UPDATE	VIM-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1510	UPDATE	vanTrL	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1513	UPDATE	QnrB64	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1512	UPDATE	SME-3	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
281	UPDATE	CMY-110	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1275	UPDATE	ErmT	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
280	UPDATE	CTX-M-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
582	UPDATE	FOX-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
357	UPDATE	VIM-38	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
356	UPDATE	ErmU	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
355	UPDATE	TEM-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
354	UPDATE	QnrB24	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
353	UPDATE	QnrB2	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
352	UPDATE	PDC-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PDC-5 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
351	UPDATE	SHV-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
350	UPDATE	ykkD	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  tetracycline resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
359	UPDATE	TEM-112	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
358	UPDATE	QnrB42	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
43	UPDATE	tet42	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1033	UPDATE	vanSN	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1447	UPDATE	OKP-A-10	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1446	UPDATE	PDC-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with PDC-6 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1445	UPDATE	acrE	 efflux pump conferring antibiotic resistance;  beta-lactam resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
289	UPDATE	OXA-85	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
288	UPDATE	CMY-60	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1444	UPDATE	IND-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1793	UPDATE	DHA-14	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
5	UPDATE	dfrF	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
283	UPDATE	CMY-85	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
282	UPDATE	CTX-M-125	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
285	UPDATE	TEM-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
284	UPDATE	smeD	 chloramphenicol resistance gene;  macrolide resistance gene;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  tetracycline resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
287	UPDATE	TEM-67	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1442	UPDATE	mdtN	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1441	UPDATE	Enterobacter aerogenes omp36 mutants	 antibiotic resistant gene variant or mutant;  beta-lactam resistance gene;  gene modulating permeability to antibiotic; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1116	UPDATE	arr-2	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
263	UPDATE	dfrA24	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
262	UPDATE	VIM-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
261	UPDATE	CMY-65	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
260	UPDATE	ErmN	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
267	UPDATE	OXA-43	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
266	UPDATE	QnrB13	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
265	UPDATE	SHV-128	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
264	UPDATE	lsaE	 lincosamide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
286	UPDATE	SHV-162	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
269	UPDATE	CMY-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
268	UPDATE	CfxA6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1290	UPDATE	TEM-141	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1291	UPDATE	TEM-177	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1296	UPDATE	OKP-B-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1297	UPDATE	CTX-M-80	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1294	UPDATE	Sed1 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1295	UPDATE	catII	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
988	UPDATE	tetJ	 efflux pump conferring antibiotic resistance;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
989	UPDATE	ErmG	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
982	UPDATE	TEM-153	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
983	UPDATE	GES-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
980	UPDATE	y56 beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
981	UPDATE	OXA-86	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
986	UPDATE	baeS	 efflux pump conferring antibiotic resistance;  aminocoumarin resistance gene;  aminoglycoside resistance gene;  gene modulating antibiotic efflux; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
987	UPDATE	CTX-M-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
984	UPDATE	Bartonella bacilliformis gyrA conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
985	UPDATE	ErmA	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
115	UPDATE	TEM-87	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
114	UPDATE	dfrA13	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
117	UPDATE	elfamycin resistant EF-Tu	 antibiotic resistant gene variant or mutant;  elfamycin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
116	UPDATE	QnrB18	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
111	UPDATE	Escherichia coli gyrB conferring resistance to aminocoumarin	 aminocoumarin resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED category_aro_name with aminocoumarin resistance gene
UPDATED category_aro_cvterm_id with 36616
UPDATED category_aro_accession with 3000477
UPDATED category_aro_description with Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
110	UPDATE	AAC(6')-Iu	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
113	UPDATE	VEB-5	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
112	UPDATE	FosA5	 fosfomycin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
119	UPDATE	VIM-12	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
118	UPDATE	LRA-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1797	UPDATE	ErmY	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2079	UPDATE	sgm	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2078	UPDATE	Mycobacterium chelonae 16S rRNA mutation conferring resistance to kanamycin A	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2073	UPDATE	Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to G418	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2072	UPDATE	NmcR	 antibiotic inactivation enzyme;  beta-lactam resistance gene;  gene modulating beta-lactam resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2071	UPDATE	AAC(6')-Ib8	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2070	UPDATE	Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to amikacin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2077	UPDATE	Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to neomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2076	UPDATE	Neisseria gonorrhoeae 16S rRNA mutation conferring resistance to spectinomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
2075	UPDATE	Salmonella serovars soxR mutants	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2074	UPDATE	Salmonella enterica serovar Typhimurium 16S rRNA mutation in the rrsD gene conferring resistance to spectinomycin	 antibiotic resistant gene variant or mutant;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with rRNA mutation model
UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1388	UPDATE	oleB	 efflux pump conferring antibiotic resistance;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1796	UPDATE	CMY-119	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1035	UPDATE	PBP2b	 antibiotic target replacement protein;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1389	UPDATE	KPC-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1986	UPDATE	OXA-309	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1987	UPDATE	QnrA1	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1984	UPDATE	SHV-144	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1985	UPDATE	SHV-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1982	UPDATE	IMP-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1983	UPDATE	vanTN	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1980	UPDATE	OXA-247	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1981	UPDATE	vanA	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1638	UPDATE	CMY-111	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1639	UPDATE	SHV-84	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1988	UPDATE	CMY-7	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1989	UPDATE	Klebsiella pneumoniae acrR mutant resulting in high level antibiotic resistance	 chloramphenicol resistance gene;  gene modulating antibiotic efflux;  fluoroquinolone resistance gene;  efflux pump conferring antibiotic resistance;  antibiotic resistant gene variant or mutant;  tetracycline resistance gene;  rifampin resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
568	UPDATE	CTX-M-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
569	UPDATE	OXA-228	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
560	UPDATE	OXA-77	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
561	UPDATE	OKP-B-8	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
562	UPDATE	TEM-187	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
563	UPDATE	OKP-B-6	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
564	UPDATE	IMP-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
565	UPDATE	SHV-82	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
566	UPDATE	OXA-32	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
567	UPDATE	CTX-M-41	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1188	UPDATE	ErmV	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1189	UPDATE	vatB	 antibiotic inactivation enzyme;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1186	UPDATE	OXA-327	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1187	UPDATE	OXA-248	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1184	UPDATE	OXA-182	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1185	UPDATE	OXA-176	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1182	UPDATE	CTX-M-105	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1183	UPDATE	tetQ	 antibiotic target protection protein;  tetracycline resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1180	UPDATE	mdsC	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  beta-lactam resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1181	UPDATE	cmeA	 efflux pump conferring antibiotic resistance;  macrolide resistance gene;  beta-lactam resistance gene;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
726	UPDATE	PC1 beta-lactamase (blaZ)	 antibiotic resistance gene cluster, cassette, or operon;  beta-lactam resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
727	UPDATE	ErmS	 antibiotic target modifying enzyme;  lincosamide resistance gene;  macrolide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
724	UPDATE	AAC(6')-Ij	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
725	UPDATE	GES-11	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1748	UPDATE	lsaC	 efflux pump conferring antibiotic resistance;  lincosamide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1749	UPDATE	IMP-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
720	UPDATE	BcI	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
721	UPDATE	OXA-28	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1744	UPDATE	cmrA	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1745	UPDATE	KPC-2	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	ARO_description; model_type; model_sequences; model_param; model_description	"UPDATED ARO_description with KPC-2 is a beta-lactamase found in Klebsiella pneumoniae and Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
UPDATED fmax with 18021
UPDATED strand with +
UPDATED accession with NC_022346.1
UPDATED fmin with 17139
UPDATED sequence with ATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCTGGCTTTTCTGCCACCGCGCTGACCAACCTCGTCGCGGAACCATTCGCTAAACTCGAACAGGACTTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGTTACCGCGCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCTGTGCTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTGGACACACCCATCCGTTACGGCAAAAATGCGCTGGTTCCGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTGGCGGAGCTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTGAAGGAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTCATGCGCTCTATCGGCGATACCACGTTCCGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGATACCTCATCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTGGCTGCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTAAAGGGAAACACGACCGGCAACCACCGCATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGAGTGTATGGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTGTTGGCCGTCTACACCCGGGCGCCTAACAAGGATGACAAGCACAGCGAGGCCGTCATCGCCGCTGCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGGCAGTAA
UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa
UPDATED NCBI_taxonomy_id with 287
UPDATED NCBI_taxonomy_cvterm_id with 36752
UPDATED GI with YP_008532725.1
UPDATED sequence with MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
1746	UPDATE	IMP-24	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1747	UPDATE	CMY-103	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1740	UPDATE	TEM-53	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1741	UPDATE	OXA-359	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1742	UPDATE	SHV-28	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1743	UPDATE	OXA-338	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1164	UPDATE	MIR-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1165	UPDATE	OKP-A-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1166	UPDATE	Staphylococcus aureus gyrA conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1167	UPDATE	norB	 efflux pump conferring antibiotic resistance;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1160	UPDATE	QnrB34	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1161	UPDATE	lsaB	 efflux pump conferring antibiotic resistance;  lincosamide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1162	UPDATE	aadA15	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1163	UPDATE	CMY-94	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1168	UPDATE	NDM-9	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1169	UPDATE	OXA-360	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1366	UPDATE	cmx	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene; 	ARO_description; model_type; ARO_category; model_param; model_description	"UPDATED ARO_description with cmx is a plasmid or transposon-encoded chloramphenicol exporter that is found in Corynebacterium striatum and Pseudomonas aeruginosa.
UPDATED model_type with protein homolog model
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
48	UPDATE	OXA-90	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
49	UPDATE	tsnr	 antibiotic target modifying enzyme;  peptide antibiotic resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
46	UPDATE	CMY-114	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
47	UPDATE	OXA-60	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
44	UPDATE	golS	 efflux pump conferring antibiotic resistance;  chloramphenicol resistance gene;  beta-lactam resistance gene;  gene modulating antibiotic efflux; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
DELETED 36191
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
45	UPDATE	mdtP	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
42	UPDATE	OXY-6-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2034	UPDATE	TEM-108	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
40	UPDATE	QnrB58	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
41	UPDATE	rmtH	 antibiotic target modifying enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1568	UPDATE	OXA-183	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1569	UPDATE	catD	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1298	UPDATE	lsaA	 efflux pump conferring antibiotic resistance;  lincosamide resistance gene;  streptogramin resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1299	UPDATE	AAC(6')-Ic	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1560	UPDATE	OKP-B-20	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1561	UPDATE	vanTG	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1562	UPDATE	aad(6)	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1563	UPDATE	CTX-M-63	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1564	UPDATE	QnrB16	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1565	UPDATE	ACT-18	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1566	UPDATE	vanXD	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1567	UPDATE	FosB	 fosfomycin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1713	UPDATE	vanYM	 glycopeptide resistance gene;  gene conferring antibiotic resistance via molecular bypass;  antibiotic resistance gene cluster, cassette, or operon; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
474	UPDATE	dfrD	 antibiotic target replacement protein;  trimethoprim resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
796	UPDATE	iri	 rifampin resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1361	UPDATE	OXA-223	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1711	UPDATE	AQU-1	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1381	UPDATE	CcrA beta-lactamase	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1710	UPDATE	Mycobacterium leprae gyrB conferring resistance to fluoroquinolone	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
1717	UPDATE	OXA-230	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1716	UPDATE	OXA-398	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1715	UPDATE	OXA-73	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
732	UPDATE	OXA-237	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1201	UPDATE	CARB-22	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
790	UPDATE	CMY-32	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
472	UPDATE	TEM-128	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
473	UPDATE	mphE	 antibiotic inactivation enzyme;  macrolide resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
470	UPDATE	OXA-4	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
471	UPDATE	TEM-151	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
476	UPDATE	amrB	 efflux pump conferring antibiotic resistance;  aminoglycoside resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
477	UPDATE	catP	 chloramphenicol resistance gene;  antibiotic inactivation enzyme; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1360	UPDATE	Bartonella bacilliformis gyrB conferring resistance to aminocoumarin	 aminocoumarin resistance gene;  antibiotic resistant gene variant or mutant; 	model_type; model_description; ARO_category; model_param	"UPDATED model_type with protein variant model
UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants.
UPDATED category_aro_name with aminocoumarin resistance gene
UPDATED category_aro_cvterm_id with 36616
UPDATED category_aro_accession with 3000477
UPDATED category_aro_description with Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED param_type with resistance variant
UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s).  In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s).
"
475	UPDATE	OXA-106	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
478	UPDATE	AAC(3)-IIa	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	ARO_description; model_type; model_param; model_description	"UPDATED ARO_description with AAC(3)-IIa is a plasmid-encoded aminoglycoside acetyltransferase in K. pneumoniae, E. cloacae, Actinobacillus pleuropneumoniae, S. typhimurium, Citrobacter freundii, and P. aeruginosa.
UPDATED model_type with protein homolog model
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
"
479	UPDATE	IMP-29	 antibiotic inactivation enzyme;  beta-lactam resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1368	UPDATE	abeM	 efflux pump conferring antibiotic resistance; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
1369	UPDATE	QnrB69	 antibiotic target protection protein;  fluoroquinolone resistance gene; 	model_type; model_description; model_param	"UPDATED model_type with protein homolog model
UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off.
UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence.
"
2200	ADD	APH(3')-VI	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	N/A	N/A
2201	ADD	PvrR		N/A	N/A
2202	ADD	AAC(3)-Ib/AAC(6')-Ib''	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	N/A	N/A
2203	ADD	MCR-1	 polymyxin resistance gene;  gene altering cell wall charge conferring antibiotic resistance; 	N/A	N/A
2191	ADD	AAC(6')-Iaj	 antibiotic inactivation enzyme;  aminoglycoside resistance gene; 	N/A	N/A
2192	ADD	TriA	 efflux pump conferring antibiotic resistance; 	N/A	N/A
2193	ADD	TriB	 efflux pump conferring antibiotic resistance; 	N/A	N/A
2194	ADD	TriC	 efflux pump conferring antibiotic resistance; 	N/A	N/A
2195	ADD	OpmH	 efflux pump conferring antibiotic resistance; 	N/A	N/A
2196	ADD	Pseudomonas aeruginosa gyrA conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	N/A	N/A
2198	ADD	Pseudomonas aeruginosa parE conferring resistance to fluoroquinolones	 antibiotic resistant gene variant or mutant;  fluoroquinolone resistance gene; 	N/A	N/A
2199	ADD	oprD		N/A	N/A