Model_id Action ARO_name ARO_category Changes To Summary 344 UPDATE SHV-188 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 345 UPDATE bcrA efflux pump conferring antibiotic resistance; peptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 346 UPDATE QnrB23 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 347 UPDATE Sfh-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 340 UPDATE CMY-51 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 341 UPDATE IMP-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 342 UPDATE smeS efflux pump conferring antibiotic resistance; beta-lactam resistance gene; aminoglycoside resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 343 UPDATE OXA-31 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 348 UPDATE OXY-3-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 349 UPDATE vanL glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 298 UPDATE vanYG1 glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 299 UPDATE CepS beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 296 UPDATE VIM-23 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 297 UPDATE CMY-98 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 294 UPDATE CfxA4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 295 UPDATE OXA-145 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 292 UPDATE TEM-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 293 UPDATE SHV-180 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 290 UPDATE vatD antibiotic inactivation enzyme; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 291 UPDATE APH(3')-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 270 UPDATE LEN-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 271 UPDATE CMY-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 272 UPDATE QnrB36 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 273 UPDATE VEB-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 274 UPDATE OXA-174 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 275 UPDATE OKP-B-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 276 UPDATE tetR efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; tetracycline resistance gene; gene modulating antibiotic efflux; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 277 UPDATE TEM-91 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 278 UPDATE imiS antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 279 UPDATE CTX-M-107 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 642 UPDATE aadA25 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1781 UPDATE AAC(2')-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2189 UPDATE Ureaplasma urealyticum parC conferring resistance to fluoroquinolone model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 108 UPDATE PDC-8 antibiotic inactivation enzyme; beta-lactam resistance gene; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with PDC-8 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 109 UPDATE ErmE antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 102 UPDATE TLA-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 103 UPDATE SHV-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 100 UPDATE mycobacterium tuberculosis ethA mutant conferring resistance to ethionamide antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 101 UPDATE TEM-109 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 106 UPDATE catB9 chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 107 UPDATE TEM-43 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 104 UPDATE OXA-61 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 105 UPDATE CARB-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2046 UPDATE tet33 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2047 UPDATE OXA-322 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2044 UPDATE QnrB31 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2045 UPDATE OXY-2-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2042 UPDATE IND-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2043 UPDATE aadA8 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2040 UPDATE TEM-60 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2041 UPDATE OXA-424 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2048 UPDATE OXA-57 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2049 UPDATE QnrB72 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 99 UPDATE QnrB38 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 98 UPDATE CMY-48 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 91 UPDATE gadX efflux pump conferring antibiotic resistance; macrolide resistance gene; beta-lactam resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 90 UPDATE Staphylococcus aureus rpoB mutants conferring resistance to rifampicin rifampin resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 93 UPDATE SHV-105 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 92 UPDATE CTX-M-42 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 95 UPDATE CMY-56 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 94 UPDATE CMY-79 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 97 UPDATE vanXYC glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 96 UPDATE OXA-426 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1991 UPDATE otrC efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1990 UPDATE CMY-82 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1993 UPDATE QnrB74 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1620 UPDATE CTX-M-156 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1627 UPDATE CTX-M-95 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1994 UPDATE gimA glycosyltransferase antibiotic inactivation enzyme; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1625 UPDATE OXA-179 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1996 UPDATE vanXM glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1999 UPDATE TEM-215 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1998 UPDATE CTX-M-83 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1629 UPDATE TEM-197 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1628 UPDATE SHV-154 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 559 UPDATE vanXYE glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 558 UPDATE qacB efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 555 UPDATE OXA-133 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 554 UPDATE OXA-163 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 557 UPDATE SHV-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 556 UPDATE vanYB glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 551 UPDATE CTX-M-117 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 550 UPDATE CMY-71 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 553 UPDATE VIM-35 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 552 UPDATE QnrB28 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1199 UPDATE SHV-168 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1198 UPDATE mefB efflux pump conferring antibiotic resistance; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1191 UPDATE mdtM efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1190 UPDATE OXA-354 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1193 UPDATE ErmH antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1192 UPDATE VEB-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1195 UPDATE SHV-55 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1194 UPDATE OXA-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1197 UPDATE Mycobacterium tuberculosis rpsL mutations conferring resistance to Streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1196 UPDATE OXA-71 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1759 UPDATE vanF glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1758 UPDATE OXA-326 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1757 UPDATE emrA efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1756 UPDATE CMY-93 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1755 UPDATE CTX-M-23 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1754 UPDATE vanO glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1753 UPDATE SHV-148 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1752 UPDATE mdtK efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1751 UPDATE Erm(33) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1750 UPDATE OXA-254 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1177 UPDATE KPC-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1176 UPDATE Mycobacterium tuberculosis katG mutations conferring resistance to isoniazid antibiotic resistant gene variant or mutant; isoniazid resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1175 UPDATE Enterococcus faecium cls conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1174 UPDATE QnrB22 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1173 UPDATE TEM-54 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1172 UPDATE OXA-194 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1171 UPDATE tet44 antibiotic target protection protein; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1170 UPDATE CMY-46 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1179 UPDATE IMP-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1178 UPDATE CMY-81 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 511 UPDATE dfrA3 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 510 UPDATE CTX-M-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1005 UPDATE Escherichia coli soxR mutants chloramphenicol resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 644 UPDATE OXY-2-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1285 UPDATE sat-1 streptothricin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1284 UPDATE IND-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1287 UPDATE CTX-M-110 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1004 UPDATE vanRD glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1281 UPDATE OXA-110 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1280 UPDATE QnrB12 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1283 UPDATE KPC-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1282 UPDATE SIM-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1003 UPDATE OXA-18 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 879 UPDATE TEM-185 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1289 UPDATE OKP-B-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1288 UPDATE OXA-82 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 514 UPDATE LEN-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1579 UPDATE QnrB9 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1578 UPDATE SHV-123 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 689 UPDATE CTX-M-123 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 688 UPDATE MOX-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 685 UPDATE OXA-239 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 684 UPDATE SHV-37 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 687 UPDATE APH(3')-Vc antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 686 UPDATE OXA-162 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 681 UPDATE TEM-120 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 680 UPDATE CMY-54 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 683 UPDATE CMY-75 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 682 UPDATE QnrS4 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 623 UPDATE OXA-68 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1226 UPDATE adeG efflux pump conferring antibiotic resistance; tetracycline resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1240 UPDATE Bacillus intrinsic mph antibiotic inactivation enzyme; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 621 UPDATE ErmF antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1224 UPDATE Erm(30) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 627 UPDATE Escherichia coli rpoB mutants conferring resistance to rifampicin rifampin resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1222 UPDATE FosA fosfomycin resistance gene; antibiotic inactivation enzyme; ARO_description; model_type; model_sequences; model_param; model_description "UPDATED ARO_description with An enzyme that confers resistance to fosfomycin in Serratia marcescens by breaking the epoxide ring of the molecule. It depends on the cofactors Manganese (II) and Potassium and uses Glutathione (GSH) as the nucleophilic molecule. In Pseudomonas aeruginosa, FosA catalyzes the conjugation of glutathione to carbon-1 of fosfomycin, rendering it ineffective as an antibacterial drug. UPDATED model_type with protein homolog model UPDATED fmax with 1222098 UPDATED strand with + UPDATED accession with NC002516 UPDATED fmin with 1221690 UPDATED sequence with ATGCTTACCGGTCTCAATCACCTGACCCTGGCGGTCGCCGACCTGCCGGCCAGCATCGCCTTCTACCGCGATCTTCTCGGCTTTCGCCTGGAAGCGCGCTGGGACCAGGGCGCCTATCTCGAACTGGGTTCGCTGTGGCTGTGCCTGTCCCGGGAGCCGCAGTACGGCGGGCCGGCCGCGGACTACACGCACTACGCCTTCGGCATCGCCGCCGCGGATTTCGCCCGCTTCGCCGCGCAGCTGCGCGCGCATGGCGTGCGCGAATGGAAGCAGAACCGCAGCGAGGGCGATTCGTTCTACTTCCTCGACCCGGACGGCCATCGCCTGGAGGCCCACGTCGGCGACCTGCGCAGCCGGCTCGCGGCGTGCCGGCAAGCGCCCTATGCGGGAATGCGTTTCGCCGACTAG UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa PAO1 UPDATED NCBI_taxonomy_id with 208964 UPDATED NCBI_taxonomy_cvterm_id with 36804 UPDATED GI with NP_249820.1 UPDATED sequence with MLTGLNHLTLAVADLPASIAFYRDLLGFRLEARWDQGAYLELGSLWLCLSREPQYGGPAADYTHYAFGIAAADFARFAAQLRAHGVREWKQNRSEGDSFYFLDPDGHRLEAHVGDLRSRLAACRQAPYAGMRFAD UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 1221 UPDATE OXA-231 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1243 UPDATE mphA antibiotic inactivation enzyme; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1220 UPDATE OCH-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 407 UPDATE OXA-352 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1370 UPDATE AAC(6')-Ib10 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 405 UPDATE OXA-202 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 404 UPDATE OXA-217 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1375 UPDATE CMY-11 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1374 UPDATE blaI antibiotic resistance gene cluster, cassette, or operon; beta-lactam resistance gene; gene modulating beta-lactam resistance; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1377 UPDATE CTX-M-60 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 400 UPDATE PDC-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1379 UPDATE OXA-313 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1378 UPDATE AAC(3)-IIc antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 452 UPDATE QnrVC4 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 409 UPDATE vanRL glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 408 UPDATE OXA-380 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1343 UPDATE OXA-166 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1344 UPDATE mexH efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1345 UPDATE tetK efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 456 UPDATE adeR efflux pump conferring antibiotic resistance; tetracycline resistance gene; gene modulating antibiotic efflux; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 457 UPDATE OXA-93 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 379 UPDATE OXA-148 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 378 UPDATE TEM-214 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 647 UPDATE TEM-89 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 371 UPDATE SHV-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 370 UPDATE SHV-112 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 373 UPDATE MIR-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 372 UPDATE qacA efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 375 UPDATE mdtH efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 374 UPDATE SHV-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 377 UPDATE mepA efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 376 UPDATE lnuC lincosamide resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1244 UPDATE OXY-5-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 393 UPDATE QnrS5 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 392 UPDATE TUS-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 391 UPDATE VIM-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 390 UPDATE vanSG glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 397 UPDATE OXA-357 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 396 UPDATE sul3 antibiotic target replacement protein; sulfonamide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 395 UPDATE TLE beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 394 UPDATE OXA-130 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 399 UPDATE MIR-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 398 UPDATE TEM-71 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1246 UPDATE AAC(2')-Ic antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 245 UPDATE cmlA5 efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 244 UPDATE SHV-164 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 247 UPDATE TEM-158 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 246 UPDATE CTX-M-126 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 241 UPDATE ACT-30 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 240 UPDATE vanRF glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 243 UPDATE OXA-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 242 UPDATE SHV-152 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 249 UPDATE PmrB polymyxin resistance gene; gene altering cell wall charge conferring antibiotic resistance; model_type; model_description; model_sequences; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED fmax with 1434 UPDATED strand with + UPDATED accession with JQ340365 UPDATED fmin with 0 UPDATED sequence with ATGTCCCGTGCCGCCGTCCCCTCCGTCCGCCGGCGCCTGCTGGTCAACCTGCTGGTCGGCTTCGTGCTGTGCTGGCTGAGCGTGGCGGCGCTGACCTACCACCTCTCGCTGAAGCAGGTGAACCGCCTGTTCGACGACGACATGGTGGACTTCGGCGAAGCCGCCCTGCGCCTGCTCGACCTTGCCACCGAAGACCAGGCCGGCGAGGACGGCTCCATCACCGAGATCATCGAACGCAGCCGCGAAGCGATCCAGGGTCTGCCCCTGCTGCGCCGCGAAAGCGCCCTCGGCTACGCCCTGTGGCGCGACGGCCAGCCGCTGCTGTCGAGCCTCAACCTGCCGCCGGAGATCACGGCCCAGGGCCCCGGCTTCAGCACCGTGGAAGCCCAGGGCACCCACTGGCGGGTGCTCCAGCTGAACATCGACGGCTTCCAGATCTGGATCAGCGAAAACCTGATCTACCGCCAGCACACCATGAACCTGCTGCTGTTCTACTCGCTGTTCCCACTGCTGCTGGCGCTGCCGTTGCTCGGCGGCCTGGTCTGGTTCGGCGTTGCCCGCGGCCTGGCGCCGCTACGCGAAGTGCAGGCCGAGGTCCAGCAGCGCTCCGCGCGACACCTGCAGCCGATCGCGGTGGAAGCGGTGCCGCTGGAGATCCGCGGCCTCATCGACGAACTCAACCTCCTGCTGGAGCGTCTGCGCACCGCCCTCGAGGCCGAACGCCGACTGACCAGCGACGCCGCCCATGAAATCCGCACGCCACTGGCCAGCCTGCGCACCCATGCCCAGGTCGCGCTGCGTTCGGAAGACCCCAAGGCCCACGCCCGCGGCCTGCTGCAAGTCAGTCGCAGCGTCGAGCGGATCAGCACCTTGATGGAGCAGATCCTGCTCCTCGCCCGCCTCGACGGCGACGCCCTGCTGGAGCAATTCCACCCGGTCAACCTCGCCACCCTGGCCGAAGACGTACTCTCCGAACTGGCGCGCCAGGCCATCGACAAGGACATCGAGCTGTCGTTGCACCAGGAGACCGTGCACGTGATGGGCATCGACCTGTGGCTGAAGGCGATGGTCGGCAACCTGGTGGGCAACGCCCTGCGCTACACACCGGCCGGGGGCCAGGTCGAGATCCGCGTCGAGAATCGCGCCCAGCACGCCGTGCTGCGGGTGCGCGACAACGGCCCCGGGGTCGCCCTGGAAGAGCAGCAGGCGATCTTCACCCGCTTCTACCGCAGCCCCGCCACCAGCAGCGGCGAGGGCAGCGGCCTGGGCCTGCCGATCGTCAAGCGCATCGTCGAACTGCACTTCGGCAGTATCGGCCTGGGCAAGGGACTGGAGGGCAAAGGGCTGGAAGTGCAGGTGTTCCTGCCGAAGACCCAGCCGGACGCGACGCGGCCGCCGGCCAGAGGTCCGGACAGCGGGCGGTCACATATCTGA UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED GI with AEX49906.1 UPDATED sequence with MSRAAVPSVRRRLLVNLLVGFVLCWLSVAALTYHLSLKQVNRLFDDDMVDFGEAALRLLDLATEDQAGEDGSITEIIERSREAIQGLPLLRRESALGYALWRDGQPLLSSLNLPPEITAQGPGFSTVEAQGTHWRVLQLNIDGFQIWISENLIYRQHTMNLLLFYSLFPLLLALPLLGGLVWFGVARGLAPLREVQAEVQQRSARHLQPIAVEAVPLEIRGLIDELNLLLERLRTALEAERRLTSDAAHEIRTPLASLRTHAQVALRSEDPKAHARGLLQVSRSVERISTLMEQILLLARLDGDALLEQFHPVNLATLAEDVLSELARQAIDKDIELSLHQETVHVMGIDLWLKAMVGNLVGNALRYTPAGGQVEIRVENRAQHAVLRVRDNGPGVALEEQQAIFTRFYRSPATSSGEGSGLGLPIVKRIVELHFGSIGLGKGLEGKGLEVQVFLPKTQPDATRPPARGPDSGRSHI UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 248 UPDATE OKP-B-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 179 UPDATE QnrA5 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 178 UPDATE vanHA glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 177 UPDATE IMP-51 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 176 UPDATE CMY-25 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 175 UPDATE CTX-M-24 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 174 UPDATE CfxA2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 173 UPDATE arr-4 rifampin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 172 UPDATE oprN efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; trimethoprim resistance gene; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 171 UPDATE TEM-78 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 170 UPDATE IMP-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2051 UPDATE dfrA15 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2050 UPDATE OXA-331 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2053 UPDATE dfrA7 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2052 UPDATE APH(3'')-Ic antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2055 UPDATE LRA-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2054 UPDATE msrC efflux pump conferring antibiotic resistance; streptogramin resistance gene; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2057 UPDATE SHV-179 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2056 UPDATE mdtO efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2059 UPDATE OKP-A-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2058 UPDATE pp-flo efflux pump conferring antibiotic resistance; phenicol resistance gene; chloramphenicol resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 654 UPDATE dfrA26 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 655 UPDATE OXA-243 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 652 UPDATE tcr3 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 653 UPDATE AAC(3)-VIIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1367 UPDATE oleD antibiotic inactivation enzyme; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 650 UPDATE aadA antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 651 UPDATE mprF antibiotic target modifying enzyme; peptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1364 UPDATE CMY-101 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1977 UPDATE AAC(6')-Ik antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1976 UPDATE mefA efflux pump conferring antibiotic resistance; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1975 UPDATE blt efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1365 UPDATE AAC(6')-I30 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1974 UPDATE emrD efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1973 UPDATE TEM-111 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1972 UPDATE OXA-149 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1971 UPDATE dfrB2 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1970 UPDATE SHV-44 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1362 UPDATE IMP-31 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1968 UPDATE SHV-189 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1969 UPDATE tet35 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1618 UPDATE OXA-362 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1619 UPDATE L1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1616 UPDATE CTX-M-152 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1617 UPDATE vanE glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1614 UPDATE TEM-194 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1615 UPDATE APH(2'')-IIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1960 UPDATE smeB efflux pump conferring antibiotic resistance; beta-lactam resistance gene; aminoglycoside resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1613 UPDATE CMY-38 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1610 UPDATE OXA-74 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1611 UPDATE SME-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1363 UPDATE CARB-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1768 UPDATE CTX-M-144 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1769 UPDATE CTX-M-115 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1762 UPDATE aadA16 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1763 UPDATE NDM-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1760 UPDATE QnrB35 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1761 UPDATE OXA-351 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1766 UPDATE VIM-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1767 UPDATE OKP-A-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1764 UPDATE OXA-97 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1765 UPDATE OXA-56 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1142 UPDATE dfrA17 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1143 UPDATE OXA-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1140 UPDATE CMY-86 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1141 UPDATE OXA-169 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1146 UPDATE TEM-156 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1147 UPDATE CMY-63 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1144 UPDATE VgbB antibiotic inactivation enzyme; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1145 UPDATE CTX-M-124 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1148 UPDATE OXA-363 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1149 UPDATE AER-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 769 UPDATE KPC-11 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 692 UPDATE TEM-159 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 693 UPDATE OXA-22 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1544 UPDATE dfrE antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 691 UPDATE vanRE glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 696 UPDATE cfrA linezolid resistance gene; lincosamide resistance gene; macrolide resistance gene; antibiotic target modifying enzyme; phenicol resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 697 UPDATE Erm(42) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 694 UPDATE CTX-M-40 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 695 UPDATE CMY-66 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 698 UPDATE TEM-205 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 699 UPDATE QnrS9 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1548 UPDATE APH(3')-Vb antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1549 UPDATE ErmB antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 542 UPDATE adeH efflux pump conferring antibiotic resistance; tetracycline resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 543 UPDATE TEM-106 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 540 UPDATE emrY efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 541 UPDATE TEM-133 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 546 UPDATE TLA-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 547 UPDATE arr-5 rifampin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 544 UPDATE AAC(6')-Is antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 545 UPDATE GES-22 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 548 UPDATE QnrB3 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 549 UPDATE TEM-107 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 760 UPDATE TEM-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 761 UPDATE GES-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 766 UPDATE SHV-102 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 767 UPDATE OXA-207 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 764 UPDATE FOX-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 765 UPDATE QnrB7 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 414 UPDATE OXA-377 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 415 UPDATE TEM-33 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 416 UPDATE OXA-204 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 417 UPDATE QnrB6 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 410 UPDATE AAC(3)-IIIb antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 411 UPDATE QnrB11 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 412 UPDATE OXA-117 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 413 UPDATE OXA-144 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1384 UPDATE OXA-382 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1385 UPDATE mdsB efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1386 UPDATE ANT(9)-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1387 UPDATE OXA-99 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1380 UPDATE TEM-193 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 419 UPDATE SLB-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1382 UPDATE rmtG antibiotic target modifying enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1383 UPDATE IMI-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 368 UPDATE CARB-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 369 UPDATE SHV-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 366 UPDATE Mycobacterium tuberculosis iniA mutant conferring resistance to Ethambutol efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; ethambutol resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 367 UPDATE CTX-M-25 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 364 UPDATE CMY-83 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 365 UPDATE TEM-122 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 362 UPDATE CTX-M-151 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 363 UPDATE TEM-155 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 360 UPDATE AAC(6')-Iy antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 361 UPDATE OXA-278 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 380 UPDATE CTX-M-147 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 381 UPDATE QnrS1 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 382 UPDATE QnrB61 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 383 UPDATE phoQ efflux pump conferring antibiotic resistance; polymyxin resistance gene; macrolide resistance gene; gene modulating antibiotic efflux; gene altering cell wall charge conferring antibiotic resistance; model_type; model_description; model_sequences; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED fmax with 2029 UPDATED strand with + UPDATED accession with JN868716 UPDATED fmin with 682 UPDATED sequence with GTGATCCGTTCCCTGCGCATCCGTCTGATGCTCGGCGCCGCCGCCCTGGCGGTGCTGTTCATGCTGGCGCTGCTGCCGGCCCTGCAGCGGGCCTTCGGCATCGCCCTGGAGAACACCATCGAGCAGCGCCTGGCCGCCGACGTGGCGACCCTGGTCTCGGCGGCGCGGGTGGAGAAGGGCCGCCTGGTGATGCCCGAGCACCTGCCGGTGGAGGAGTTCAACCTGCCGGAGGCCAAGGTCCTCGGCTATATCTACGACCAGAATGGCGATCTGCTCTGGCGCTCCACCTCGGCGGCCGACGAGTCGATCAACTACACGCCGCGCTACGACGGCCGCGGCAACGAATTCCACACCACCCGCGATGCGAAGGGCGAGGAGTTCTTCGTGTTCGACGTCGAGATCGACCTGCTGCGCGGCAAGCAGGCGGCCTACAGCATCGTCACCATGCAATCGGTCAGCGAGTTCGAGAGCCTGCTCAAGGGGTTCCGCGAGCAGCTCTACCTGTGGCTCGGCGGCGCCCTGCTGGTCTTGCTCGGGCTGCTCTGGCTGGGTCTGACCTGGGGCTTCCGGGCGATGCGCGGGTTGAGTTCCGAGCTGGACCAGATCGAATCCGGCGAGCGCGAGAGCCTGAGCGAGGAGCATCCGCGCGAGCTGCTGCGCCTGACCCACTCGCTGAACCGCCTGTTGCGCAGCGAGCACAAGCAGCGCGAGCGCTACCGCCACTCCCTCGGCGACCTGGCGCACAGTCTGAAGACGCCGCTGGCGGTCTTGCAGGGGGTCGGCGACCAGCTCGCCGAGGAGCCCGGCAACCGCGAGCAGGTGCGGGTGCTACAGGGCCAGATCGAGCGCATGAGCCAGCAGATAGGCTATCAGTTGCAGCGCGCCAGCCTGCGCAAGAGCGGCCTGGTACGCCATCGCGAGCAACTGGCGCCGCTGGTGGAGACCCTGTGCGACGCGCTGGACAAGGTCTATCGCGACAAGCGGGTAAGCCTGCAGCGGGACTTCTCGCCGTCCTTCAGCGTGCCGGTGGAGCGCGGCGCGCTGCTGGAACTGCTCGGCAACCTGCTGGAGAACGCCTATCGCCTGTGCCTGGGCCGGGTCCGCGTGGGCGCCCGGCTGGGGCCGGGTTACTCGGAGCTGTGGGTCGAGGACGACGGTCCCGGAGTGCCTGCCGAACAGCGCGCACGAATCATCCGCCGCGGCGAGCGCGCCGATACCCAGCACCCGGGGCAGGGCATCGGCCTGGCCGTGGCGCTGGACATCATCGAGAGCTACGACGGCGAACTGAGCCTGGACGATTCCGAGCTGGGCGGCGCCTGCTTCCGCATACGTTTCGCTACAGTCTGA UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED GI with AEU17992.1 UPDATED sequence with MIRSLRIRLMLGAAALAVLFMLALLPALQRAFGIALENTIEQRLAADVATLVSAARVEKGRLVMPEHLPVEEFNLPEAKVLGYIYDQNGDLLWRSTSAADESINYTPRYDGRGNEFHTTRDAKGEEFFVFDVEIDLLRGKQAAYSIVTMQSVSEFESLLKGFREQLYLWLGGALLVLLGLLWLGLTWGFRAMRGLSSELDQIESGERESLSEEHPRELLRLTHSLNRLLRSEHKQRERYRHSLGDLAHSLKTPLAVLQGVGDQLAEEPGNREQVRVLQGQIERMSQQIGYQLQRASLRKSGLVRHREQLAPLVETLCDALDKVYRDKRVSLQRDFSPSFSVPVERGALLELLGNLLENAYRLCLGRVRVGARLGPGYSELWVEDDGPGVPAEQRARIIRRGERADTQHPGQGIGLAVALDIIESYDGELSLDDSELGGACFRIRFATV UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 384 UPDATE APH(2'')-IVa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 385 UPDATE OXA-46 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 386 UPDATE LEN-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 387 UPDATE mdtA efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 388 UPDATE QnrB71 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 389 UPDATE tetW antibiotic target protection protein; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1253 UPDATE GES-23 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1077 UPDATE OXA-420 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 258 UPDATE OXA-208 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 259 UPDATE PBP1b antibiotic target replacement protein; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 252 UPDATE APH(9)-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 253 UPDATE vanXYG glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 250 UPDATE cmr efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 251 UPDATE APH(3')-VIIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 256 UPDATE CMY-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 257 UPDATE ACT-37 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 254 UPDATE OXA-150 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 255 UPDATE bleomycin resistance protein (BRP) glycopeptide resistance gene; gene involved in antibiotic sequestration; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1849 UPDATE Mycobacterium tuberculosis tlyA mutations conferring resistance to aminoglycosides antibiotic target modifying enzyme; antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1848 UPDATE CTX-M-75 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 168 UPDATE VIM-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 169 UPDATE IMP-33 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 164 UPDATE vanN glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 165 UPDATE VIM-29 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 166 UPDATE TEM-77 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 167 UPDATE CMY-39 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 160 UPDATE OXA-236 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 161 UPDATE SHV-56 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 162 UPDATE KPC-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 163 UPDATE OXA-376 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 908 UPDATE CTX-M-139 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 909 UPDATE OXA-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1090 UPDATE TEM-169 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1091 UPDATE IMP-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1814 UPDATE AAC(6')-Ie-APH(2'')-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1815 UPDATE CTX-M-134 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1816 UPDATE TEM-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1817 UPDATE vgaB efflux pump conferring antibiotic resistance; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1810 UPDATE VIM-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1811 UPDATE CARB-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1812 UPDATE KHM-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1813 UPDATE MOX-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1818 UPDATE GES-26 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1819 UPDATE TEM-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1098 UPDATE vanB glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1099 UPDATE OXA-48 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1609 UPDATE QnrC antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1608 UPDATE mexT efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; trimethoprim resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1979 UPDATE FosA4 fosfomycin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1978 UPDATE OXA-200 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1601 UPDATE LRA-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1600 UPDATE phoP efflux pump conferring antibiotic resistance; polymyxin resistance gene; macrolide resistance gene; gene modulating antibiotic efflux; gene altering cell wall charge conferring antibiotic resistance; model_type; model_description; model_sequences; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED fmax with 686 UPDATED strand with + UPDATED accession with JN868721 UPDATED fmin with 8 UPDATED sequence with ATGAAACTGCTGGTAGTGGAAGACGAGGCGCTGTTGCGCCACCACCTCTATACCCGCCTGGGTGAACAGGGGCACGTGGTGGACGCGGTACCGGATGCCGAGGAAGCCCTCTACCGGGTCAGCGAATACCACCACGACCTGGCGGTGATCGACCTCGGCCTGCCGGGCATGAGCGGCCTGGACCTGATCCGCGAGCTGCGTTCGCAGGGCAAGTCCTTCCCGATCCTGATCCTCACCGCCCGCGGCAACTGGCAGGACAAGGTCGAAGGCCTGGCCGCCGGGGCCGACGACTACGTGGTCAAGCCGTTCCAGTTCGAGGAACTGGAAGCGCGCCTGAACGCGTTGCTGCGACGCTCCTCGGGGTTCGTCCAGTCGACCATCGAGGCCGGCCCCCTGGTCCTCGACCTGAACCGCAAGCAGGCGCTGGTCGAGGAGCAACCGGTGGCGCTGACCGCCTACGAATACCGCATCCTCGAATACCTCATGCGGCATCACCAGCAGGTGGTGGCCAAGGAACGCCTGATGGAACAGCTCTACCCCGACGACGAGGAGCGCGACGCCAACGTCATCGAGGTGCTGGTCGGCCGCCTGCGGCGCAAGCTGGAGGCCTGCGGCGGCTTCAAGCCGATCGATACGGTGCGCGGCCAGGGCTACCTGTTCACCGAGCGCTGCCGGTGA UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED GI with AEU18003.1 UPDATED sequence with MKLLVVEDEALLRHHLYTRLGEQGHVVDAVPDAEEALYRVSEYHHDLAVIDLGLPGMSGLDLIRELRSQGKSFPILILTARGNWQDKVEGLAAGADDYVVKPFQFEELEARLNALLRRSSGFVQSTIEAGPLVLDLNRKQALVEEQPVALTAYEYRILEYLMRHHQQVVAKERLMEQLYPDDEERDANVIEVLVGRLRRKLEACGGFKPIDTVRGQGYLFTERCR UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1603 UPDATE SHV-86 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1602 UPDATE AAC(6')-Iai antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1605 UPDATE cphA5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1604 UPDATE CTX-M-84 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1607 UPDATE PBP1a antibiotic target replacement protein; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1606 UPDATE CTX-M-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 809 UPDATE lnuB lincosamide resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 808 UPDATE TEM-171 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 803 UPDATE cphA4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 802 UPDATE QnrA3 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 801 UPDATE mfpA antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 800 UPDATE CTX-M-87 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 807 UPDATE OKP-B-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 806 UPDATE SHV-150 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 805 UPDATE mexC efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 804 UPDATE tetB(P) antibiotic target protection protein; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1775 UPDATE QnrS7 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1774 UPDATE CTX-M-106 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1777 UPDATE OXA-177 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1776 UPDATE SHV-159 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1771 UPDATE TEM-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1770 UPDATE TEM-127 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1773 UPDATE tet43 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1772 UPDATE aadA11 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1779 UPDATE CTX-M-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1778 UPDATE OKP-A-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 608 UPDATE OXA-361 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1159 UPDATE TEM-129 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1158 UPDATE SHV-22 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1155 UPDATE ACT-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1154 UPDATE TEM-146 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1157 UPDATE vanG glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1156 UPDATE Erm(31) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1151 UPDATE OXA-240 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1150 UPDATE QnrVC5 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1153 UPDATE KPC-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1152 UPDATE CTX-M-39 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1555 UPDATE SHV-140 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1554 UPDATE norA efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1551 UPDATE OXA-78 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1550 UPDATE smeR efflux pump conferring antibiotic resistance; beta-lactam resistance gene; aminoglycoside resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1553 UPDATE tetS antibiotic target protection protein; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1552 UPDATE MUS-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 59 UPDATE OXA-256 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 58 UPDATE QnrB47 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1557 UPDATE SHV-187 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1556 UPDATE VIM-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1559 UPDATE mtrA efflux pump conferring antibiotic resistance; gene modulating antibiotic efflux; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 54 UPDATE TEM-34 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 57 UPDATE SHV-24 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 56 UPDATE TEM-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 51 UPDATE AAC(3)-IIIc antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 50 UPDATE SME-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 53 UPDATE MOX-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 52 UPDATE OXY-2-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 537 UPDATE OXA-120 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 55 UPDATE OXA-69 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 535 UPDATE Morganella morganii gyrB conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 534 UPDATE vanV glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 533 UPDATE CARB-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 532 UPDATE CTX-M-47 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 531 UPDATE sat-3 streptothricin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 530 UPDATE VIM-11 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 539 UPDATE QnrB59 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 538 UPDATE robA chloramphenicol resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1558 UPDATE Bacillus subtilis mprF mutations conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 536 UPDATE TEM-95 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 429 UPDATE mdsA efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 428 UPDATE OXY-2-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1399 UPDATE OXA-315 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1398 UPDATE OXA-108 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 421 UPDATE TEM-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 420 UPDATE CTX-M-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1395 UPDATE Neisseria gonorrhoeae mutant porin PIB (por) with reduced permeability to antibiotic beta-lactam resistance gene; antibiotic resistant gene variant or mutant; tetracycline resistance gene; gene modulating permeability to antibiotic; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1394 UPDATE OXA-257 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1393 UPDATE THIN-B beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 424 UPDATE SHV-36 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1391 UPDATE CTX-M-92 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 426 UPDATE aadK antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1443 UPDATE CARB-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2183 UPDATE glycopeptide resistance gene cluster VanB antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 2182 UPDATE glycopeptide resistance gene cluster VanD antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 2181 UPDATE glycopeptide resistance gene cluster VanF antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 2180 UPDATE glycopeptide resistance gene cluster VanL antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 2187 UPDATE Staphylococcus aureus parE conferring resistance to aminocoumarin model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2186 UPDATE glycopeptide resistance gene cluster VanG antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 2185 UPDATE glycopeptide resistance gene cluster VanM antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 2184 UPDATE glycopeptide resistance gene cluster VanC antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 227 UPDATE OKP-B-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 226 UPDATE OXA-113 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 225 UPDATE CTX-M-88 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2188 UPDATE Mycoplasma hominis parC conferring resistance to fluoroquinolone model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 223 UPDATE GES-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 222 UPDATE JOHN-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 221 UPDATE CMY-100 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 220 UPDATE TEM-92 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 151 UPDATE OKP-A-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 150 UPDATE catB3 chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 153 UPDATE adeF efflux pump conferring antibiotic resistance; tetracycline resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 152 UPDATE cpxA efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; aminoglycoside resistance gene; gene modulating antibiotic efflux; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 155 UPDATE TEM-195 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 154 UPDATE mgrA efflux pump conferring antibiotic resistance; tetracycline resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 157 UPDATE dfrA21 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 156 UPDATE AAC(6')-Iaf antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 159 UPDATE vgaALC efflux pump conferring antibiotic resistance; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 158 UPDATE myrA antibiotic target modifying enzyme; gene involved in self resistance to antibiotic; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1293 UPDATE OXA-197 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1807 UPDATE OXA-70 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1806 UPDATE OXA-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1805 UPDATE TEM-131 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1804 UPDATE OXA-107 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1803 UPDATE QnrVC3 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1802 UPDATE OXA-168 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1801 UPDATE AAC(6')-Ib11 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1800 UPDATE SHV-120 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1809 UPDATE QnrB5 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1808 UPDATE tetA efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1256 UPDATE bmr efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1948 UPDATE TEM-167 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1949 UPDATE cphA6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1257 UPDATE QnrB68 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1942 UPDATE BJP-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1943 UPDATE Mycobacterium tuberculosis kasA mutant conferring resistance to isoniazid antibiotic resistant gene variant or mutant; isoniazid resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1940 UPDATE QnrB30 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1941 UPDATE SHV-98 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1946 UPDATE CTX-M-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1947 UPDATE CTX-M-160 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1944 UPDATE CTX-M-148 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1945 UPDATE SHV-50 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 818 UPDATE SHV-141 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 819 UPDATE CTX-M-68 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1255 UPDATE OXA-119 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 810 UPDATE mecC antibiotic resistance gene cluster, cassette, or operon; beta-lactam resistance gene; antibiotic target replacement protein; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 811 UPDATE TEM-26 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 812 UPDATE CMY-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 813 UPDATE OXA-216 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 814 UPDATE TEM-113 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 815 UPDATE GOB-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 816 UPDATE OXA-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 817 UPDATE CTX-M-158 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1623 UPDATE GIM-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1250 UPDATE CTX-M-96 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1622 UPDATE vanWG glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1251 UPDATE CTX-M-157 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1621 UPDATE SHV-45 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1490 UPDATE SHV-107 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1397 UPDATE dfrC antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1492 UPDATE MOX-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1493 UPDATE PER-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1494 UPDATE LAT-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1495 UPDATE ACT-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1496 UPDATE OXA-224 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1497 UPDATE dfrA10 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1498 UPDATE cphA8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1499 UPDATE VEB-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 423 UPDATE DHA-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1626 UPDATE vgaE efflux pump conferring antibiotic resistance; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1700 UPDATE ACT-28 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1701 UPDATE Erm(39) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1702 UPDATE MIR-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1703 UPDATE FosK antibiotic inactivation enzyme; fosfomycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1704 UPDATE CMY-57 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1705 UPDATE SHV-111 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1706 UPDATE OXA-142 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1707 UPDATE QnrB4 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1708 UPDATE tet36 antibiotic target protection protein; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1709 UPDATE TEM-115 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1624 UPDATE lmrD efflux pump conferring antibiotic resistance; lincosamide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1392 UPDATE aadA22 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 427 UPDATE OCH-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1390 UPDATE arlR efflux pump conferring antibiotic resistance; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1128 UPDATE OXA-23 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1129 UPDATE CMY-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1120 UPDATE IMI-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1121 UPDATE APH(3')-VIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1122 UPDATE OXA-180 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1123 UPDATE FOX-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1124 UPDATE TEM-186 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1125 UPDATE OKP-B-11 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1126 UPDATE OXA-184 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1127 UPDATE CTX-M-64 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 524 UPDATE dfrA25 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 525 UPDATE CMY-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 526 UPDATE ACT-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 527 UPDATE SHV-38 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1018 UPDATE APH(3')-IIc antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 521 UPDATE OXA-386 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 522 UPDATE floR efflux pump conferring antibiotic resistance; phenicol resistance gene; chloramphenicol resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 523 UPDATE OXA-75 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1014 UPDATE SHV-25 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1015 UPDATE evgA gene modulating antibiotic efflux; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1016 UPDATE OXA-255 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1017 UPDATE CTX-M-86 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 528 UPDATE OCH-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 529 UPDATE SHV-185 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1012 UPDATE KPC-5 antibiotic inactivation enzyme; beta-lactam resistance gene; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with KPC-5 is a beta-lactamase found in Klebsiella pneumoniae and Pseudomonas aeruginosa. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 1013 UPDATE APH(2'')-IIIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1234 UPDATE MIR-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1235 UPDATE AAC(6')-IId antibiotic inactivation enzyme; aminoglycoside resistance gene; ARO_accession; ARO_name; ARO_description; model_param; model_type; model_description; ARO_id "UPDATED ARO_accession with 3003676 UPDATED ARO_name with AAC(6')-Ib' UPDATED ARO_description with AAC(6')-Ib' is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in P. aeruginosa and P. fluorescens. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED ARO_id with 40308 " 1236 UPDATE CMY-53 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1237 UPDATE Mycobacterium tuberculosis rpoB mutants conferring resistance to rifampicin rifampin resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1230 UPDATE CTX-M-33 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1231 UPDATE mel efflux pump conferring antibiotic resistance; streptogramin resistance gene; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1232 UPDATE cmeR efflux pump conferring antibiotic resistance; macrolide resistance gene; beta-lactam resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1233 UPDATE tet32 antibiotic target protection protein; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1238 UPDATE OXA-397 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1239 UPDATE SHV-81 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 438 UPDATE VIM-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 439 UPDATE SHV-83 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 436 UPDATE OXY-4-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 437 UPDATE SHV-69 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 434 UPDATE LEN-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 435 UPDATE OKP-A-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 432 UPDATE sav1866 efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 433 UPDATE ACT-25 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 430 UPDATE OXA-87 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 431 UPDATE Escherichia coli marR mutant resulting in antibiotic resistance chloramphenicol resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1630 UPDATE IMP-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1961 UPDATE TEM-105 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 238 UPDATE SHV-137 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 239 UPDATE OXA-83 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 234 UPDATE QnrS8 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 235 UPDATE OXA-181 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 236 UPDATE ACT-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 237 UPDATE BlaB beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 230 UPDATE OXA-422 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 231 UPDATE OXA-178 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 232 UPDATE imiH antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 233 UPDATE LEN-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1 UPDATE PDC-4 antibiotic inactivation enzyme; beta-lactam resistance gene; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with PDC-4 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 146 UPDATE OXA-98 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 147 UPDATE OXA-27 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 144 UPDATE IMP-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 145 UPDATE OXA-229 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 142 UPDATE tetE efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 143 UPDATE cphA7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 140 UPDATE AAC(6')-IIb antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 141 UPDATE vanRB glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 148 UPDATE SHV-92 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 149 UPDATE aadA12 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2088 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2089 UPDATE TEM-31 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2082 UPDATE CMY-106 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2083 UPDATE Mycoplasma hominis parC conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2080 UPDATE Escherichia coli 16S rRNA mutation in the rrsH gene conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2081 UPDATE patA efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2086 UPDATE Escherichia coli 16S rRNA mutation in the rrnB gene conferring resistance to tetracycline antibiotic resistant gene variant or mutant; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2087 UPDATE aadA13 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2084 UPDATE Mycobacterium abscessus 16S rRNA mutation conferring resistance to amikacin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2085 UPDATE Escherichia coli 16S rRNA mutation in the rrnB gene conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1832 UPDATE QnrS2 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1833 UPDATE OXA-374 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1830 UPDATE APH(3'')-Ib antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_sequences; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 544 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1831 UPDATE AAC(6')-Iid antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1836 UPDATE OXA-201 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1837 UPDATE CTX-M-59 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1834 UPDATE TEM-94 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1835 UPDATE tet38 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1838 UPDATE ACT-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1839 UPDATE aadA14 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2154 UPDATE Borrelia burgdorferi 16S rRNA mutation conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2155 UPDATE Propionibacterium acnes 16S rRNA mutation conferring resistance to tetracycline antibiotic resistant gene variant or mutant; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 939 UPDATE CTX-M-113 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2157 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to gentamicin C antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2150 UPDATE efflux pump conferring antibiotic resistance model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2151 UPDATE resistance-nodulation-cell division (RND) antibiotic efflux pump efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2152 UPDATE Neisseria meningitidis 16S rRNA mutation conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2153 UPDATE acridine dye model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 933 UPDATE OKP-A-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 932 UPDATE GES-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 931 UPDATE OXA-316 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 930 UPDATE mdtD efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 937 UPDATE OXA-242 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 936 UPDATE OKP-A-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 935 UPDATE OXA-314 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 934 UPDATE IMP-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1955 UPDATE OXA-29 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1954 UPDATE TEM-154 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1957 UPDATE VIM-18 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1956 UPDATE IMI-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1951 UPDATE TEM-76 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1950 UPDATE arr-1 rifampin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1953 UPDATE SHV-155 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1952 UPDATE OXA-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1959 UPDATE ACT-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1958 UPDATE VIM-33 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 829 UPDATE DHA-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 828 UPDATE TEM-83 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 825 UPDATE SHV-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 824 UPDATE vanD glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 827 UPDATE QnrB55 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 826 UPDATE tolC chloramphenicol resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 821 UPDATE Mycobacterium tuberculosis embB mutants conferring resistance to rifampicin rifampin resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 820 UPDATE mdtB efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 823 UPDATE cat chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 822 UPDATE QnrD1 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1483 UPDATE AAC(3)-Xa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1482 UPDATE SME-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1481 UPDATE OXY-1-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1480 UPDATE EXO beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1487 UPDATE SHV-48 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1486 UPDATE CARB-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1485 UPDATE MOX-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1484 UPDATE ACT-27 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1489 UPDATE CMY-37 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1488 UPDATE TEM-75 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 797 UPDATE TEM-55 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 928 UPDATE carA efflux pump conferring antibiotic resistance; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 795 UPDATE OXA-324 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 794 UPDATE Staphylococcus aureus rpoC conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 793 UPDATE IMP-34 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 792 UPDATE OXY-1-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 791 UPDATE SHV-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2146 UPDATE Escherichia coli 16S rRNA mutation in the rrnB gene conferring resistance to streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1719 UPDATE ceoA efflux pump conferring antibiotic resistance; aminoglycoside resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1718 UPDATE DIM-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 799 UPDATE CTX-M-31 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 798 UPDATE cmeC efflux pump conferring antibiotic resistance; macrolide resistance gene; beta-lactam resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 612 UPDATE PDC-7 antibiotic inactivation enzyme; beta-lactam resistance gene; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with PDC-7 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 613 UPDATE VEB-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 610 UPDATE SHV-153 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1139 UPDATE dfrA12 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1138 UPDATE tetD efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1133 UPDATE SHV-109 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1132 UPDATE OXA-88 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1131 UPDATE AAC(3)-Ic antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1130 UPDATE PDC-9 antibiotic inactivation enzyme; beta-lactam resistance gene; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with PDC-9 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 1137 UPDATE TEM-90 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1136 UPDATE MIR-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1135 UPDATE Staphylococcus aureus parE conferring resistance to aminocoumarin aminocoumarin resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED category_aro_name with aminocoumarin resistance gene UPDATED category_aro_cvterm_id with 36616 UPDATED category_aro_accession with 3000477 UPDATED category_aro_description with Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1134 UPDATE linB lincosamide resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 614 UPDATE SFB-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1277 UPDATE GES-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 519 UPDATE VIM-26 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 518 UPDATE vanXYN glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 926 UPDATE KPC-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1009 UPDATE IND-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1008 UPDATE BEL-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1007 UPDATE OKP-A-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1006 UPDATE tetV efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 513 UPDATE CARB-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 512 UPDATE CTX-M-82 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 515 UPDATE mgt antibiotic inactivation enzyme; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1002 UPDATE AAC(6')-Ib4 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1001 UPDATE Staphylococcus aureus mprF mutations conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1000 UPDATE AAC(6')-Ib-Hangzhou antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1227 UPDATE aadA2 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 622 UPDATE DHA-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1225 UPDATE TEM-178 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 620 UPDATE OXA-320 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1223 UPDATE viomycin phosphotransferase peptide antibiotic resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 626 UPDATE vanHB glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 625 UPDATE QnrB46 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 624 UPDATE Mycobacterium leprae rpoB mutants conferring resistance to rifampicin rifampin resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 629 UPDATE VIM-28 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 628 UPDATE catB10 chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1229 UPDATE CTX-M-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1228 UPDATE CMY-30 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2 UPDATE CblA-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1286 UPDATE SHV-34 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1714 UPDATE ErmW antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 11 UPDATE Erm(34) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 10 UPDATE CARB-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 13 UPDATE LRA-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 12 UPDATE TEM-126 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 15 UPDATE TEM-59 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 14 UPDATE TEM-72 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 17 UPDATE tet45 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 16 UPDATE KPC-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 19 UPDATE IMP-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 18 UPDATE OXA-212 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 201 UPDATE OCH-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 200 UPDATE LEN-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 203 UPDATE OXY-2-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 202 UPDATE SHV-101 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 205 UPDATE APH(4)-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 204 UPDATE VIM-43 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 207 UPDATE GES-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 206 UPDATE FomA antibiotic inactivation enzyme; fosfomycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 209 UPDATE AAC(3)-Ib/AAC(6')-Ib'' antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 208 UPDATE CMY-105 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1573 UPDATE SHV-110 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1572 UPDATE OXA-205 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1571 UPDATE vanSE glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1570 UPDATE oprA efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1577 UPDATE AAC(6')-32 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1576 UPDATE OXA-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1575 UPDATE OXA-91 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1574 UPDATE Mycobacterium tuberculosis inhA mutations conferring resistance to isoniazid antibiotic resistant gene variant or mutant; isoniazid resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 229 UPDATE vanTmL glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 228 UPDATE sdiA chloramphenicol resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2095 UPDATE elongation factor Tu model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2094 UPDATE antibiotic sensitive embC model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2097 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to paromomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2096 UPDATE Escherichia coli 16S rRNA mutation in the rrsC gene conferring resistance to kasugamicin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2091 UPDATE Mycobacterium chelonae 16S rRNA mutation conferring resistance to gentamicin C antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2090 UPDATE Mycobacterium abscessus 16S rRNA mutation conferring resistance to kanamycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2093 UPDATE Chlamydophila psittaci 16S rRNA mutation conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2092 UPDATE Enterobacter aerogenes acrR mutation resulting in antibiotic resistance chloramphenicol resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2099 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to kanamycin A antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2098 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to viomycin peptide antibiotic resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 224 UPDATE MIR-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1829 UPDATE CMY-87 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1828 UPDATE GES-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1825 UPDATE CTX-M-27 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1824 UPDATE oleI antibiotic inactivation enzyme; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1827 UPDATE SHV-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1826 UPDATE ykkC efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; tetracycline resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1821 UPDATE AAC(6')-Ir antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1820 UPDATE bacA peptide antibiotic resistance gene; gene conferring antibiotic resistance via molecular bypass; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1823 UPDATE OXY-1-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1822 UPDATE Staphylococcus aureus gyrB conferring resistance to aminocoumarin aminocoumarin resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED category_aro_name with aminocoumarin resistance gene UPDATED category_aro_cvterm_id with 36616 UPDATED category_aro_accession with 3000477 UPDATED category_aro_description with Point mutations to DNA gyrase subunit B (gyrB) can result in resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. Aminocoumarin efflux pump exists that export the drug out of the cell to confer resistance UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2147 UPDATE Escherichia coli EF-Tu mutants conferring resistance to Enacyloxin IIa antibiotic resistant gene variant or mutant; elfamycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 929 UPDATE GES-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2145 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to tetracycline antibiotic resistant gene variant or mutant; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2144 UPDATE Mycobacterium bovis embB mutations conferring resistance to ethambutol ethambutol resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2143 UPDATE Borrelia burgdorferi 16S rRNA mutation conferring resistance to gentamicin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2142 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to viomycin peptide antibiotic resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2141 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to neomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2140 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 920 UPDATE TEM-152 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 921 UPDATE OKP-A-11 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 922 UPDATE AAC(6')-30/AAC(6')-Ib' fusion protein antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 923 UPDATE VIM-25 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 924 UPDATE AAC(6')-33 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 925 UPDATE AAC(3)-IIb antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2149 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to hygromycin B antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2148 UPDATE Ureaplasma urealyticum gyrB conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1920 UPDATE vanSF glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1921 UPDATE EreB antibiotic inactivation enzyme; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1922 UPDATE marA chloramphenicol resistance gene; gene modulating antibiotic efflux; gene modulating permeability to antibiotic; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1923 UPDATE APH(3'')-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1924 UPDATE vanM glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1925 UPDATE mexB chloramphenicol resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; tetracycline resistance gene; polymyxin resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1926 UPDATE CMY-34 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1927 UPDATE SHV-29 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1928 UPDATE OXA-50 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1929 UPDATE ACT-24 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 832 UPDATE SHV-161 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 833 UPDATE CfxA5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 830 UPDATE SHV-157 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 831 UPDATE OKP-B-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 836 UPDATE TEM-68 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 837 UPDATE vatH antibiotic inactivation enzyme; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 834 UPDATE FosA3 fosfomycin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 835 UPDATE APH(3')-Ib antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 838 UPDATE CTX-M-102 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 839 UPDATE CMY-44 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 3 UPDATE Escherichia coli ompF mutants antibiotic resistant gene variant or mutant; beta-lactam resistance gene; gene modulating permeability to antibiotic; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1267 UPDATE QnrB40 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 784 UPDATE AAC(6')-Iv antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 785 UPDATE OXY-2-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 786 UPDATE vanHO glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 787 UPDATE dfrA23 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 780 UPDATE CARB-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 781 UPDATE QnrB25 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 782 UPDATE OXA-63 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1729 UPDATE CTX-M-66 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1726 UPDATE FOX-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1727 UPDATE SHV-73 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1724 UPDATE vanHM glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1725 UPDATE TEM-101 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 788 UPDATE SHV-46 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 789 UPDATE IMP-43 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1720 UPDATE tap efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1721 UPDATE Mycobacterium leprae dapsone resistant folP mutants antibiotic resistant gene variant or mutant; sulfonamide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 60 UPDATE QnrS6 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 61 UPDATE OXA-330 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 62 UPDATE CMY-42 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 63 UPDATE AAC(6')-Ib antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_sequences; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED fmax with 2604 UPDATED strand with + UPDATED accession with AY954726 UPDATED fmin with 1965 UPDATED sequence with TTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAACCCTTCCATCGAGGGGGACGTCCAAGGGCTGGCGCCCTTGGCCGCCCCTCATGTCAAACG UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED GI with AAX54878.1 UPDATED sequence with MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 64 UPDATE CMY-70 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 65 UPDATE GES-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 66 UPDATE SHV-41 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 67 UPDATE OXA-391 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 68 UPDATE TEM-132 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 69 UPDATE aadA23 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1371 UPDATE CTX-M-26 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1588 UPDATE QnrB50 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1589 UPDATE PER-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 406 UPDATE ACC-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1582 UPDATE dfrA5 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1583 UPDATE QnrVC6 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1580 UPDATE catIII chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1581 UPDATE ACT-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1586 UPDATE CTX-M-32 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1373 UPDATE CMY-26 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1584 UPDATE tet41 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1585 UPDATE CMY-73 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1038 UPDATE cmlB1 efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1372 UPDATE ANT(2'')-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 508 UPDATE tetA(P) efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 509 UPDATE FOX-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1032 UPDATE OXA-365 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 507 UPDATE rosB polymyxin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 504 UPDATE TEM-52 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1031 UPDATE APH(6)-Id antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 502 UPDATE aadA17 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 503 UPDATE CTX-M-69 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1034 UPDATE QnrA7 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 402 UPDATE tetY efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1212 UPDATE OXA-141 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1213 UPDATE nalD chloramphenicol resistance gene; gene modulating antibiotic efflux; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; tetracycline resistance gene; polymyxin resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1210 UPDATE novA efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1211 UPDATE VIM-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1216 UPDATE SHV-119 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 401 UPDATE ACT-22 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 636 UPDATE CFE-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 637 UPDATE OXY-6-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 638 UPDATE ACT-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 639 UPDATE AAC(3)-IVa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1218 UPDATE TEM-219 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 927 UPDATE OXA-381 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1728 UPDATE OXA-42 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 783 UPDATE NDM-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1454 UPDATE CMY-112 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1455 UPDATE IND-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1456 UPDATE IMP-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1105 UPDATE AAC(3)-VIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1450 UPDATE Escherichia coli parC conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1103 UPDATE CMY-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1452 UPDATE TEM-216 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1453 UPDATE vanYD glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1458 UPDATE TEM-157 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1459 UPDATE CTX-M-78 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1108 UPDATE Enterococcus faecium liaS mutant conferring daptomycin resistance peptide antibiotic resistance gene; antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1109 UPDATE CAU-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1722 UPDATE TEM-184 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1723 UPDATE IMP-44 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 959 UPDATE OXA-64 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 958 UPDATE OXA-418 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 216 UPDATE LEN-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 217 UPDATE vanXA glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 214 UPDATE SHV-121 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 215 UPDATE bcrC peptide antibiotic resistance gene; gene conferring antibiotic resistance via molecular bypass; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 212 UPDATE Staphylococcus aureus parC conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 213 UPDATE OXA-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 210 UPDATE SHV-35 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 211 UPDATE TEM-206 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 218 UPDATE npmA antibiotic target modifying enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 219 UPDATE OKP-A-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 957 UPDATE tetG efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 956 UPDATE TEM-88 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 4 UPDATE SHV-52 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1858 UPDATE OXA-387 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1859 UPDATE QnrVC7 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1850 UPDATE FomB antibiotic inactivation enzyme; fosfomycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1851 UPDATE KPC-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1852 UPDATE rmtF antibiotic target modifying enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1853 UPDATE OXA-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1854 UPDATE rmtA antibiotic target modifying enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1855 UPDATE CTX-M-72 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1856 UPDATE QnrB20 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1857 UPDATE VIM-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2172 UPDATE antibiotic sensitive dihydropteroate synthase model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2173 UPDATE antibiotic sensitive dihydrofolate reductase model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2170 UPDATE rifamycin sensitive beta-subunit of RNA polymerase (rpoB) model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2171 UPDATE 1-deoxy-D-xylulose 5-phosphate reductoisomerase model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 919 UPDATE PER-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 918 UPDATE TEM-49 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2174 UPDATE antibiotic sensitive embA model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 915 UPDATE SHV-106 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 914 UPDATE ANT(6)-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 917 UPDATE SHV-186 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 916 UPDATE OXA-36 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 911 UPDATE CMY-50 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 910 UPDATE rifampin phosphotransferase rifampin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 913 UPDATE OXY-6-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 912 UPDATE LEN-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 516 UPDATE PmrC polymyxin resistance gene; gene altering cell wall charge conferring antibiotic resistance; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with PmrC mediates the modification of Lipid A by the addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) and phosphoethanolamine, resulting in a less negative cell membrane and decreased binding of polymyxin B. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 1423 UPDATE TEM-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1933 UPDATE SHV-160 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1932 UPDATE IMP-32 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1931 UPDATE TEM-150 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1930 UPDATE CTX-M-29 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1937 UPDATE OXA-118 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1936 UPDATE CTX-M-43 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1935 UPDATE Mycobacterium tuberculosis gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1934 UPDATE lnuD lincosamide resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1939 UPDATE AAC(6')-Ix antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1938 UPDATE mtrD efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 847 UPDATE CTX-M-108 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 846 UPDATE DHA-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 845 UPDATE TEM-163 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 844 UPDATE CMY-117 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 843 UPDATE QnrB14 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 842 UPDATE PmrE polymyxin resistance gene; gene altering cell wall charge conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 841 UPDATE CTX-M-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 840 UPDATE CMY-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 849 UPDATE OXA-138 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 848 UPDATE OKP-A-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 459 UPDATE CTX-M-94 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1587 UPDATE OXA-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1739 UPDATE SHV-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1738 UPDATE CTX-M-45 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1731 UPDATE mphB antibiotic inactivation enzyme; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1730 UPDATE OXA-235 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1733 UPDATE OXA-415 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1732 UPDATE SHV-151 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1735 UPDATE vatA antibiotic inactivation enzyme; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1734 UPDATE IND-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1737 UPDATE ANT(4')-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1736 UPDATE GES-24 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1039 UPDATE dfrB3 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 753 UPDATE SMB-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 752 UPDATE vanRM glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 751 UPDATE TEM-217 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 750 UPDATE SHV-172 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 757 UPDATE CMY-80 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 756 UPDATE Enterococcus faecium liaR mutant conferring daptomycin resistance peptide antibiotic resistance gene; antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 755 UPDATE KPC-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 754 UPDATE CTX-M-48 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 759 UPDATE OCH-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 758 UPDATE OXA-198 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1595 UPDATE mecB antibiotic resistance gene cluster, cassette, or operon; beta-lactam resistance gene; antibiotic target replacement protein; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 506 UPDATE IMP-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1597 UPDATE SHV-2A antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1596 UPDATE OXA-24 antibiotic inactivation enzyme; beta-lactam resistance gene; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with OXA-24 is a beta-lactamase found in A. baumannii and P. aeruginosa. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 1591 UPDATE CMY-64 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1590 UPDATE QnrB27 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1593 UPDATE CMY-99 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1592 UPDATE dfrA14 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1599 UPDATE SHV-23 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1030 UPDATE vanZA glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1025 UPDATE TEM-136 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1024 UPDATE AAC(6')-Ib-SK antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1027 UPDATE tetH efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1026 UPDATE SHV-74 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1021 UPDATE CTX-M-54 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1020 UPDATE OXA-241 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1023 UPDATE IMP-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1022 UPDATE TEM-28 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1036 UPDATE vanWB glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1029 UPDATE CMY-102 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1028 UPDATE SHV-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1037 UPDATE cmlA1 efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 500 UPDATE OXA-164 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 501 UPDATE AAC(3)-VIIIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 605 UPDATE OXA-96 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 604 UPDATE OXA-385 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 607 UPDATE TEM-201 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 606 UPDATE IMI-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 601 UPDATE dfrA20 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 600 UPDATE CMY-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 603 UPDATE mdtG efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 602 UPDATE VIM-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1205 UPDATE VIM-39 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1204 UPDATE tcmA efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1207 UPDATE DHA-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1206 UPDATE qepA efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 609 UPDATE emrK efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1200 UPDATE msrA efflux pump conferring antibiotic resistance; streptogramin resistance gene; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1203 UPDATE Mycobacterium tuberculosis ndh mutant conferring resistance to isoniazid antibiotic resistant gene variant or mutant; isoniazid resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1202 UPDATE CTX-M-28 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 633 UPDATE OXA-355 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 634 UPDATE smeF chloramphenicol resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; tetracycline resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1217 UPDATE OXA-139 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1214 UPDATE TEM-134 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1215 UPDATE FosC fosfomycin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1111 UPDATE AAC(6')-Ig antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1110 UPDATE LEN-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1113 UPDATE ANT(6)-Ib antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1112 UPDATE OXA-58 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1115 UPDATE OXA-435 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1114 UPDATE ACT-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1117 UPDATE ErmD antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1440 UPDATE CTX-M-103 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1119 UPDATE EBR-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1118 UPDATE OXA-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1351 UPDATE QnrVC1 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1449 UPDATE OXA-59 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1448 UPDATE SHV-26 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1219 UPDATE vanRN glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 461 UPDATE OXA-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1356 UPDATE dfrA22 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 463 UPDATE CTX-M-30 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 489 UPDATE Mycobacterium tuberculosis gidB mutation conferring resistance to streptomycin antibiotic target modifying enzyme; antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 488 UPDATE SHV-156 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 487 UPDATE macB efflux pump conferring antibiotic resistance; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 486 UPDATE cmlB efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 485 UPDATE TEM-191 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 484 UPDATE QnrB49 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 483 UPDATE GES-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 482 UPDATE LEN-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 481 UPDATE VIM-30 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 480 UPDATE GES-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 199 UPDATE SRT-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 198 UPDATE TEM-138 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 195 UPDATE CTX-M-58 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 194 UPDATE SHV-61 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 197 UPDATE CTX-M-56 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 196 UPDATE Mycobacterium tuberculosis embB mutations conferring resistance to ethambutol ethambutol resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 191 UPDATE OXA-199 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 190 UPDATE OXA-195 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 193 UPDATE TEM-121 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 192 UPDATE CTX-M-38 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1106 UPDATE NDM-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1107 UPDATE PDC-2 antibiotic inactivation enzyme; beta-lactam resistance gene; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with PDC-2 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 1104 UPDATE acrB chloramphenicol resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1457 UPDATE CTX-M-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1102 UPDATE QnrB29 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1451 UPDATE MIR-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1100 UPDATE OXA-245 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1101 UPDATE CTX-M-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 902 UPDATE OXA-92 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 903 UPDATE APH(2'')-Ig antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 900 UPDATE tetC efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 901 UPDATE LCR-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 906 UPDATE CARB-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 907 UPDATE fexA efflux pump conferring antibiotic resistance; phenicol resistance gene; chloramphenicol resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 904 UPDATE rmtB antibiotic target modifying enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 905 UPDATE CTX-M-93 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1843 UPDATE rmtD antibiotic target modifying enzyme; aminoglycoside resistance gene; model_type; model_description; model_sequences; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED fmax with 9632 UPDATED strand with - UPDATED accession with DQ914960 UPDATED fmin with 8888 UPDATED sequence with TCATTTTCGTTTCAGCACGTAAAACAGCTCGTTTTCGCCGGTCAGCCGCGCGGCAATCGCGCGATTTTCCGGCACGTGCGCCTCCATCCATTCGGAATAGTGCTTTTCCATGCCGACGTTGCGCCCGCCGAGCGAACGCGTCGGAAACGATGCGACGATCCATTCCGCATTCACGCGCATTAGCGCATCCATCGCCGCGCCCGCACGCTGGCGCTCCAAAAGCGGCAGCACCTTAAACAGCAGCGCCGCATTCGCCTCGTCTTCCGGGATTTCGCACAGCAAATCGCCCAAACGCGCTTCCGCGCCGCCAAACGCACGAATTACGTTTACGCACTGACCGCTGATATCCACGCCGGTAATCGCCGCATTTGGCAATCGATGCGCGAGGTAGACAGGATTCAGCCCGCACGCGAGATCGAGGATTCGCGCCGGCGTTCCGCTGGCTTCAAACAGCTGATCGAACACGCGATCCATCGATTCCACAGGCAGCCGTTCGCGCGTGGACGCGTGCATTCCAAGCAGCGCTTCCCAATCGCGTGCCGCCGCCATTTCCATTGCGCGTTTGTATTCGCGCTCGGTCATGAACGCGCCGGTCACGCCGTGAAGCGCTTCGCGCGCCGCCTTGTCCACGTCCTTTTCCTTTTTGAATTTCGCGCTGCATTCACGCCATATGCGCTCGATCGTGTCCGGGCAAACGTCGCGATATTTTTTCGAAGCGAGCAGTTTTTCCTTCAGTTCGCTCAT UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED GI with ABJ53409.1 UPDATED sequence with MSELKEKLLASKKYRDVCPDTIERIWRECSAKFKKEKDVDKAAREALHGVTGAFMTEREYKRAMEMAAARDWEALLGMHASTRERLPVESMDRVFDQLFEASGTPARILDLACGLNPVYLAHRLPNAAITGVDISGQCVNVIRAFGGAEARLGDLLCEIPEDEANAALLFKVLPLLERQRAGAAMDALMRVNAEWIVASFPTRSLGGRNVGMEKHYSEWMEAHVPENRAIAARLTGENELFYVLKRK UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1842 UPDATE IMI-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1841 UPDATE OXA-76 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1840 UPDATE CMY-59 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1847 UPDATE emrB efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1846 UPDATE CTX-M-91 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1845 UPDATE OXA-312 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1844 UPDATE OXA-128 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2169 UPDATE rho transcription terminator factor model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2168 UPDATE fluoroquinolone sensitive parC model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2165 UPDATE elongation factor G model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2164 UPDATE antibiotic sensitive arabinosyltransferase model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2167 UPDATE antibiotic sensitive DNA topoisomerase subunit gyrB model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2166 UPDATE fluoroquinolone sensitive gyrA model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2161 UPDATE cycloserine sensitive alanine racemase model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2160 UPDATE antibiotic sensitive signal peptidase I model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2163 UPDATE fosfomycin sensitive pyruvyl transferase (murA) model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2162 UPDATE cycloserine sensitive D-alanine synthetase model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1908 UPDATE OKP-A-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1909 UPDATE AAC(6')-Iak antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1906 UPDATE CTX-M-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1907 UPDATE vanSA glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1904 UPDATE ACT-32 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1905 UPDATE ACT-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1902 UPDATE OXA-246 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1903 UPDATE mdtE efflux pump conferring antibiotic resistance; macrolide resistance gene; beta-lactam resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1900 UPDATE ACT-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1901 UPDATE CTX-M-51 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 854 UPDATE CMY-58 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 855 UPDATE TEM-142 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 856 UPDATE mepR efflux pump conferring antibiotic resistance; tetracycline resistance gene; gene modulating antibiotic efflux; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 857 UPDATE nfxB efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; macrolide resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 850 UPDATE OXA-26 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 851 UPDATE Mycobacterium tuberculosis pncA mutations conferring resistance to pyrazinamide antibiotic resistant gene variant or mutant; pyrazinamide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 852 UPDATE QnrB62 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 853 UPDATE OXA-160 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 858 UPDATE IND-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 859 UPDATE AER-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 6 UPDATE acrA chloramphenicol resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 425 UPDATE TEM-182 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 740 UPDATE QnrB21 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 741 UPDATE CfxA antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 742 UPDATE AAC(3)-Id antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 743 UPDATE arr-3 rifampin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 744 UPDATE vanSL glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 745 UPDATE CMY-40 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 746 UPDATE AAC(2')-Ib antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 747 UPDATE QnrA4 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 748 UPDATE cmeB efflux pump conferring antibiotic resistance; macrolide resistance gene; beta-lactam resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 749 UPDATE SHV-97 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1050 UPDATE AAC(6')-Ii antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1051 UPDATE LEN-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1052 UPDATE OXA-206 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1053 UPDATE SHV-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1054 UPDATE emrE efflux pump conferring antibiotic resistance; ARO_description; model_type; model_sequences; model_param; model_description "UPDATED ARO_description with EmrE is a small multidrug transporter that functions as a homodimer and that couples the efflux of small polyaromatic cations from the cell with the import of protons down an electrochemical gradient. EmrE is found in E. coli and P. aeruginosa. UPDATED model_type with protein homolog model UPDATED fmax with 5606435 UPDATED strand with + UPDATED accession with NC_002516.2 UPDATED fmin with 5606102 UPDATED sequence with ATGACCAACTATCTCTACCTCGCCATCGCCATCGCCGCCGAAGTGGTCGCCACCACCTCGCTGAAAGCCGTCGCCGGATTCAGCAAGCCACTGCCGCTGCTGCTGGTGGTGGGCGGCTACGTGCTCGCCTTCAGCATGCTCGTGCTGGTCATGCGCACCCTGCCGGTCGGCGTGGTCTACGCCATCTGGTCCGGACTCGGCATCGTCCTGGTCAGCCTGGTGGCGATGTTCGTCTACGGCCAGCGCCTGGACCCCGCCGCCCTCCTCGGCATCGGCCTGATCATCGCCGGCGTGCTGGTGATCCAGTTGTTCTCCCGCGCTTCGGGGCACTGA UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa PAO1 UPDATED NCBI_taxonomy_id with 208964 UPDATED NCBI_taxonomy_cvterm_id with 36804 UPDATED GI with NP_253677.1 UPDATED sequence with MTNYLYLAIAIAAEVVATTSLKAVAGFSKPLPLLLVVGGYVLAFSMLVLVMRTLPVGVVYAIWSGLGIVLVSLVAMFVYGQRLDPAALLGIGLIIAGVLVIQLFSRASGH UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 1055 UPDATE Escherichia coli parE conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1056 UPDATE VIM-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1057 UPDATE CTX-M-114 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1058 UPDATE VIM-27 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1059 UPDATE APH(9)-Ib antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1696 UPDATE Salmonella serovars gyrB conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1697 UPDATE TEM-135 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1694 UPDATE OXA-353 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1695 UPDATE DHA-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1692 UPDATE tetM antibiotic target protection protein; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1693 UPDATE TEM-143 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1690 UPDATE OXA-317 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1691 UPDATE CMY-31 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 715 UPDATE PDC-3 antibiotic inactivation enzyme; beta-lactam resistance gene; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with PDC-3 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 1698 UPDATE OCH-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1699 UPDATE vanXO glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1278 UPDATE TEM-45 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1279 UPDATE TEM-104 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 618 UPDATE emeA efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 619 UPDATE SHV-30 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1270 UPDATE QnrS3 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1271 UPDATE AAC(6')-Iw antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1272 UPDATE CTX-M-67 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 611 UPDATE OXA-328 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 616 UPDATE NDM-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 617 UPDATE OXA-147 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1276 UPDATE OXA-210 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 615 UPDATE OXA-211 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 711 UPDATE SHV-62 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 710 UPDATE dfrB6 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1491 UPDATE lnuF lincosamide resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1472 UPDATE DHA-18 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1473 UPDATE CTX-M-44 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1470 UPDATE QnrB26 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1471 UPDATE adeI chloramphenicol resistance gene; beta-lactam resistance gene; aminocoumarin resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; lincosamide resistance gene; tetracycline resistance gene; rifampin resistance gene; trimethoprim resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1476 UPDATE TEM-199 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1477 UPDATE SHV-39 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1474 UPDATE mexR chloramphenicol resistance gene; gene modulating antibiotic efflux; aminocoumarin resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; tetracycline resistance gene; polymyxin resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1475 UPDATE SHV-99 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1478 UPDATE CARB-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1479 UPDATE IMP-40 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1304 UPDATE CTX-M-85 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1305 UPDATE oprM chloramphenicol resistance gene; macrolide resistance gene; aminoglycoside resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; tetracycline resistance gene; polymyxin resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1306 UPDATE IND-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1307 UPDATE OXY-1-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1300 UPDATE mexF efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; trimethoprim resistance gene; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1301 UPDATE Staphylococcus aureus cls conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1302 UPDATE tet34 gene conferring antibiotic resistance via molecular bypass; ARO_description; model_type; ARO_category; model_param; model_description "UPDATED ARO_description with tet34 causes the activation of Mg2+-dependent purine nucleotide synthesis, which protects the protein synthesis pathway. It is found in Gram-negative Vibrio UPDATED model_type with protein homolog model UPDATED category_aro_name with gene conferring antibiotic resistance via molecular bypass UPDATED category_aro_cvterm_id with 36021 UPDATED category_aro_accession with 3000012 UPDATED category_aro_description with Genes involved in restructuring of the cell wall UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 1303 UPDATE BEL-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1308 UPDATE vanTE glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1309 UPDATE ACT-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 498 UPDATE QnrB17 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 499 UPDATE vanSB glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 494 UPDATE KPC-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 495 UPDATE CMY-28 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 496 UPDATE KPC-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 497 UPDATE OXA-79 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 490 UPDATE TEM-188 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 491 UPDATE PER-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 492 UPDATE catB chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 493 UPDATE TEM-84 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 24 UPDATE fusB antibiotic inactivation enzyme; fusidic acid resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 25 UPDATE CTX-M-121 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 26 UPDATE VEB-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 27 UPDATE lnuA lincosamide resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 20 UPDATE CMY-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 21 UPDATE OXA-329 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 22 UPDATE ACT-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 23 UPDATE OXA-371 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 28 UPDATE OXA-45 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 29 UPDATE Escherichia coli sulfonamide resistant mutant folP antibiotic resistant gene variant or mutant; sulfonamide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1511 UPDATE OXA-423 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 7 UPDATE CTX-M-130 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 446 UPDATE catB8 chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 591 UPDATE CTX-M-122 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 590 UPDATE IND-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 593 UPDATE abeS efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1876 UPDATE LEN-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1877 UPDATE CMY-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1874 UPDATE OXA-196 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1875 UPDATE MIR-11 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1872 UPDATE vanXYL glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1873 UPDATE linG lincosamide resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1870 UPDATE OXA-66 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1871 UPDATE OXA-389 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 595 UPDATE SHV-75 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1878 UPDATE SRT-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1879 UPDATE AAC(3)-IIIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 977 UPDATE OXA-112 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 976 UPDATE CTX-M-61 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 975 UPDATE QnrB1 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 974 UPDATE lmrC efflux pump conferring antibiotic resistance; lincosamide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 973 UPDATE OXA-378 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 972 UPDATE CMY-23 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 971 UPDATE cmlA4 efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 970 UPDATE OKP-B-18 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 596 UPDATE ROB-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 979 UPDATE TEM-96 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 978 UPDATE OXA-134 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 182 UPDATE arlS efflux pump conferring antibiotic resistance; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 183 UPDATE adeS efflux pump conferring antibiotic resistance; tetracycline resistance gene; gene modulating antibiotic efflux; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 180 UPDATE DHA-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 181 UPDATE GES-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 186 UPDATE OXA-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 187 UPDATE OXA-348 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 184 UPDATE OCH-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 185 UPDATE OXA-232 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2110 UPDATE CARB-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2111 UPDATE Mycobacterium chelonae 16S rRNA mutation conferring resistance to tobramycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 188 UPDATE SHV-89 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2113 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to tobramycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2114 UPDATE APH(3')-IIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2115 UPDATE TEM-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2116 UPDATE Pasteurella multocida 16S rRNA mutation conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2117 UPDATE AAC(6')-Ib7 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1919 UPDATE SHV-27 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1918 UPDATE spd antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1464 UPDATE aadA7 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1911 UPDATE AAC(6')-Iad antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1910 UPDATE CTX-M-136 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1913 UPDATE dfrK antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1912 UPDATE LRA-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1915 UPDATE CMY-47 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1914 UPDATE BEL-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1917 UPDATE tet30 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1916 UPDATE TEM-208 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 869 UPDATE CRP efflux pump conferring antibiotic resistance; macrolide resistance gene; beta-lactam resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 868 UPDATE DHA-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 189 UPDATE CTX-M-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 861 UPDATE OXA-215 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 860 UPDATE TEM-42 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 863 UPDATE PER-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 862 UPDATE IMP-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 865 UPDATE OXA-244 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 864 UPDATE CMY-61 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 867 UPDATE OXA-175 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 866 UPDATE adeB efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2024 UPDATE ACC-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2025 UPDATE TEM-57 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2026 UPDATE OXA-84 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2027 UPDATE CMY-84 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2020 UPDATE tetO antibiotic target protection protein; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2021 UPDATE SHV-165 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2022 UPDATE CTX-M-104 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2023 UPDATE OXA-132 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2028 UPDATE QnrB43 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2029 UPDATE TEM-123 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 656 UPDATE OXA-219 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 883 UPDATE LRA-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 882 UPDATE NPS beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 881 UPDATE ErmC antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 880 UPDATE APH(6)-Ib antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 887 UPDATE SHV-33 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 886 UPDATE IND-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 885 UPDATE TEM-63 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 884 UPDATE CTX-M-99 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 889 UPDATE CMY-74 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 888 UPDATE Erm(36) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 657 UPDATE SHV-142 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 775 UPDATE CMY-113 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 774 UPDATE tet37 antibiotic inactivation enzyme; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 777 UPDATE mdtL efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 776 UPDATE tetX antibiotic inactivation enzyme; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 771 UPDATE CMY-24 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 770 UPDATE SHV-57 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 773 UPDATE OCH-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 772 UPDATE LEN-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 779 UPDATE OXA-350 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 778 UPDATE IMP-25 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 77 UPDATE TEM-47 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 76 UPDATE SHV-79 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 75 UPDATE fusH antibiotic inactivation enzyme; fusidic acid resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 74 UPDATE SHV-18 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 73 UPDATE OXA-35 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 72 UPDATE SHV-42 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 71 UPDATE QnrB66 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 70 UPDATE NDM-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 79 UPDATE VIM-37 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 78 UPDATE TEM-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1043 UPDATE SHV-76 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1042 UPDATE catB7 chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1041 UPDATE mexS efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; trimethoprim resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1040 UPDATE OXA-95 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1047 UPDATE catS chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1046 UPDATE vgaD efflux pump conferring antibiotic resistance; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1045 UPDATE ErmO antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1044 UPDATE CTX-M-22 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1049 UPDATE MOX-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1048 UPDATE QnrB33 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1681 UPDATE APH(4)-Ib antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1680 UPDATE macA efflux pump conferring antibiotic resistance; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1683 UPDATE QnrB67 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1682 UPDATE aadA24 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1685 UPDATE SHV-40 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1684 UPDATE LEN-18 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1687 UPDATE CEPH-A3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1686 UPDATE OXA-34 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1689 UPDATE vanRO glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1688 UPDATE CTX-M-90 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1269 UPDATE OXA-192 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1268 UPDATE CMY-115 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 669 UPDATE MIR-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 668 UPDATE CTX-M-65 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 667 UPDATE ACT-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1262 UPDATE SHV-149 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 665 UPDATE TEM-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 664 UPDATE CMY-43 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 663 UPDATE ACT-36 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 662 UPDATE TEM-162 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1265 UPDATE MIR-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1264 UPDATE smeC efflux pump conferring antibiotic resistance; beta-lactam resistance gene; aminoglycoside resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1469 UPDATE facT efflux pump conferring antibiotic resistance; elfamycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1468 UPDATE SHV-135 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1465 UPDATE SHV-181 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 520 UPDATE acrS chloramphenicol resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1467 UPDATE LEN-22 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1466 UPDATE SHV-13 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1461 UPDATE SHV-63 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1460 UPDATE FosB3 fosfomycin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1463 UPDATE GES-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1019 UPDATE IMP-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1317 UPDATE CTX-M-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1316 UPDATE catB6 chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1315 UPDATE mdtC efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1314 UPDATE OXA-214 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1313 UPDATE adeA efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1312 UPDATE OXA-111 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1311 UPDATE OXY-5-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1310 UPDATE IMP-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1319 UPDATE SHV-147 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1318 UPDATE evgS gene modulating antibiotic efflux; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1010 UPDATE TEM-209 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1011 UPDATE TEM-29 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 319 UPDATE OXA-366 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 318 UPDATE OXA-358 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 313 UPDATE OXA-143 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 312 UPDATE OXA-167 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 311 UPDATE IND-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 310 UPDATE SHV-78 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 317 UPDATE TEM-148 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 316 UPDATE CTX-M-36 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 315 UPDATE DHA-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 314 UPDATE TEM-176 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 443 UPDATE OKP-B-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 442 UPDATE opmD efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 441 UPDATE OXA-54 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 440 UPDATE mexA chloramphenicol resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; tetracycline resistance gene; polymyxin resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 447 UPDATE SHV-67 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1330 UPDATE emrR efflux pump conferring antibiotic resistance; gene modulating antibiotic efflux; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 445 UPDATE TEM-22 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 444 UPDATE AAC(6')-Ib-Suzhou antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 630 UPDATE adeJ chloramphenicol resistance gene; beta-lactam resistance gene; aminocoumarin resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; lincosamide resistance gene; tetracycline resistance gene; rifampin resistance gene; trimethoprim resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 631 UPDATE TEM-21 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 632 UPDATE PmrA polymyxin resistance gene; gene altering cell wall charge conferring antibiotic resistance; model_type; model_description; model_sequences; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED fmax with 685 UPDATED strand with + UPDATED accession with JQ340367 UPDATED fmin with 19 UPDATED sequence with ATGAGAATACTGCTGGCCGAGGACGACCTGCTGCTCGGCGACGGCATCCGCGCCGGGCTGCGCCTGGAAGGCGATACCGTGGAATGGGTGACCGACGGCGTGGCCGCGGAGAACGCGCTGGTCACCGACGAGTTCGACCTGCTGGTGCTCGACATCGGACTGCCGCGCCGCAGCGGCCTGGACATCCTGCGTAACCTGCGCCACCAGGGCCGGCTCACCCCGGTGCTGCTGCTCACCGCGCGGGACAAGGTGGCCGACCGGGTCGCCGGGCTCGACAGCGGTGCCGACGACTACCTGACCAAGCCCTTCGATCTCGACGAACTGCAGGCACGGGTGCGCGCCCTGACCCGCCGCACCACCGGTCGCGCCCTGCCGCAACTGGTGCACGGCGAGCTGCGCCTGGACCCGGCGACCCACCAAGTGACCCTGTCCGGGCAGGCGGTGGAACTGGCGCCGCGCGAATACGCACTGCTGCGCCTGCTGCTGGAGAACAGCGGCAAGGTGCTCTCGCGCAACCAACTGGAGCAGAGCCTCTACGGCTGGAGCGGCGACGTCGAGAGCAACGCCATCGAAGTCCACGTCCACCACCTGCGGCGCAAGCTCGGCAACCAGTTGATCCGCACCGTCCGCGGCATCGGCTACGGCATCGACCAGCCGGCGCCCTGA UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED GI with AEX49909.1 UPDATED sequence with MRILLAEDDLLLGDGIRAGLRLEGDTVEWVTDGVAAENALVTDEFDLLVLDIGLPRRSGLDILRNLRHQGRLTPVLLLTARDKVADRVAGLDSGADDYLTKPFDLDELQARVRALTRRTTGRALPQLVHGELRLDPATHQVTLSGQAVELAPREYALLRLLLENSGKVLSRNQLEQSLYGWSGDVESNAIEVHVHHLRRKLGNQLIRTVRGIGYGIDQPAP UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 403 UPDATE dfrA8 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1712 UPDATE IMP-41 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1861 UPDATE LEN-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1860 UPDATE OXA-165 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1863 UPDATE VIM-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1862 UPDATE OXA-109 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1865 UPDATE ACC-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1864 UPDATE CMY-67 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1867 UPDATE CTX-M-116 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1866 UPDATE KPC-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1869 UPDATE OXY-2-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1868 UPDATE TEM-82 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 964 UPDATE OXA-129 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 965 UPDATE OXA-333 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 966 UPDATE vanSC glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 967 UPDATE AAC(6')-Isa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 960 UPDATE TEM-137 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 961 UPDATE SHV-93 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 962 UPDATE OXA-356 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 963 UPDATE CMY-69 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 968 UPDATE MIR-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 969 UPDATE VEB-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2109 UPDATE Mycobacterium tuberculosis gyrB mutant conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2108 UPDATE Escherichia coli EF-Tu mutants conferring resistance to GE2270A antibiotic resistant gene variant or mutant; elfamycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2103 UPDATE SHV-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2102 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to hygromycin B antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2101 UPDATE ATP-binding cassette (ABC) antibiotic efflux pump efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2100 UPDATE Mycobacterium chelonae 16S rRNA mutation conferring resistance to amikacin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2107 UPDATE antibiotic sensitive embB model_type; model_description; model_param "UPDATED model_type with protein wild type model UPDATED model_description with A model to detect wild type proteins that are sensitive to antibiotic(s). These models are in development. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2106 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to kanamycin A antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2105 UPDATE Mycobacterium abscessus 16S rRNA mutation conferring resistance to neomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2104 UPDATE Ureaplasma urealyticum parC conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 635 UPDATE OXA-332 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 641 UPDATE CARB-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 878 UPDATE CTX-M-142 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 640 UPDATE tet31 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 876 UPDATE smeE chloramphenicol resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; tetracycline resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 877 UPDATE SHV-124 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 874 UPDATE AAC(1) antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 875 UPDATE dfrA19 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 872 UPDATE vatC antibiotic inactivation enzyme; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 873 UPDATE KPC-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 870 UPDATE otrB efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 871 UPDATE CGB-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2037 UPDATE tetT antibiotic target protection protein; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2036 UPDATE SHV-163 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2035 UPDATE CTX-M-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1242 UPDATE aadA6/aadA10 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2033 UPDATE mtrR efflux pump conferring antibiotic resistance; gene modulating antibiotic efflux; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2032 UPDATE CTX-M-62 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2031 UPDATE OXA-173 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2030 UPDATE AAC(3)-IXa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 9 UPDATE ACT-35 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 645 UPDATE mecR1 antibiotic resistance gene cluster, cassette, or operon; antibiotic target replacement protein; beta-lactam resistance gene; gene modulating beta-lactam resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2039 UPDATE CARB-18 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2038 UPDATE KPC-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 890 UPDATE SHV-53 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 891 UPDATE QnrB37 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 892 UPDATE APH(6)-Ic antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 893 UPDATE linA lincosamide resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 894 UPDATE CMY-90 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 895 UPDATE SHV-122 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 896 UPDATE CTX-M-131 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 897 UPDATE OXA-383 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 898 UPDATE VEB-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 899 UPDATE OXA-94 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 646 UPDATE OXA-349 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 649 UPDATE OXA-115 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1248 UPDATE H-NS gene modulating antibiotic efflux; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1537 UPDATE GES-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1964 UPDATE IMP-45 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 422 UPDATE FOX-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1965 UPDATE LEN-11 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1966 UPDATE lmrA lincosamide resistance gene; antibiotic resistant gene variant or mutant; gene modulating antibiotic efflux; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1788 UPDATE ACT-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1789 UPDATE QnrB44 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 768 UPDATE SHV-43 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1967 UPDATE OXA-116 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1780 UPDATE OXA-146 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1612 UPDATE ErmR antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1782 UPDATE TEM-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1783 UPDATE VIM-36 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1784 UPDATE OXA-334 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1785 UPDATE TEM-48 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1786 UPDATE mexY efflux pump conferring antibiotic resistance; macrolide resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1787 UPDATE VIM-42 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1962 UPDATE OXA-47 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1963 UPDATE TEM-190 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1078 UPDATE VIM-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1079 UPDATE OXA-161 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1076 UPDATE IMP-37 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 643 UPDATE OXY-2-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1074 UPDATE LEN-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1075 UPDATE TEM-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1072 UPDATE OXA-37 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1073 UPDATE OKP-B-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1070 UPDATE sul1 antibiotic target replacement protein; sulfonamide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1071 UPDATE DHA-22 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1678 UPDATE AAC(6')-Ib-cr antibiotic inactivation enzyme; aminoglycoside resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1679 UPDATE OXA-49 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1674 UPDATE AAC(6')-It antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1675 UPDATE CTX-M-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1676 UPDATE GES-18 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1677 UPDATE cepA beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1670 UPDATE nalC chloramphenicol resistance gene; gene modulating antibiotic efflux; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; tetracycline resistance gene; polymyxin resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1671 UPDATE Salmonella serovars soxS mutants chloramphenicol resistance gene; gene modulating antibiotic efflux; gene modulating permeability to antibiotic; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1672 UPDATE TEM-211 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1673 UPDATE QnrA6 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1094 UPDATE CARB-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1095 UPDATE SHV-59 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1096 UPDATE TEM-79 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1097 UPDATE Erm(38) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 678 UPDATE PDC-10 antibiotic inactivation enzyme; beta-lactam resistance gene; ARO_description; model_type; model_param; model_description "UPDATED ARO_description with PDC-10 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa. UPDATED model_type with protein homolog model UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. " 679 UPDATE SHV-108 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1092 UPDATE tet39 efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1093 UPDATE AAC(6')-31 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 674 UPDATE OXA-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 675 UPDATE OXA-25 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 676 UPDATE AAC(6')-Ih antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 677 UPDATE OXA-171 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 670 UPDATE IND-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 671 UPDATE CTX-M-137 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 672 UPDATE CMY-27 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 673 UPDATE IMP-48 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1533 UPDATE SHV-143 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1418 UPDATE DHA-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1419 UPDATE OXA-454 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1410 UPDATE OXA-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1411 UPDATE OXA-62 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1412 UPDATE SHV-167 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1413 UPDATE OXA-172 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1414 UPDATE QnrB15 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1415 UPDATE AAC(2')-Id antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1416 UPDATE OXA-89 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1417 UPDATE OXA-131 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1322 UPDATE SHV-65 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1323 UPDATE Salmonella serovars parE conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1320 UPDATE Klebsiella mutant PhoP conferring antibiotic resistance to colistin gene modulating antibiotic efflux; gene altering cell wall charge conferring antibiotic resistance; macrolide resistance gene; efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; polymyxin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1321 UPDATE mecA antibiotic resistance gene cluster, cassette, or operon; beta-lactam resistance gene; antibiotic target replacement protein; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1326 UPDATE OXA-170 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1327 UPDATE AAC(6')-Iq antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1324 UPDATE LRA-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1325 UPDATE OXA-65 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1328 UPDATE vanSM glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1329 UPDATE ANT(4')-IIb antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1531 UPDATE TEM-81 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1524 UPDATE cat-TC chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1525 UPDATE TEM-160 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1254 UPDATE CTX-M-46 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1527 UPDATE SHV-51 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1520 UPDATE SHV-85 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1521 UPDATE VIM-32 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1522 UPDATE IMP-38 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1523 UPDATE mexD efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1528 UPDATE TEM-168 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1529 UPDATE TEM-130 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1258 UPDATE OXA-55 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1259 UPDATE SHV-31 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 308 UPDATE CMY-118 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 309 UPDATE CMY-35 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 300 UPDATE AAC(6')-29a antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 301 UPDATE CMY-95 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 302 UPDATE TEM-207 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 303 UPDATE ErmQ antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 304 UPDATE IND-11 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 305 UPDATE chrB antibiotic target modifying enzyme; gene involved in self resistance to antibiotic; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 306 UPDATE SHV-32 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 307 UPDATE CTX-M-101 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " _timestamp N/A N/A N/A N/A NEW: 2015-12-14T16:04:28+00:00 , OLD: 2015-08-27T20:33:35+00:00 1898 UPDATE OXA-379 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1899 UPDATE vanYF glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1894 UPDATE Salmonella serovars ramR mutants chloramphenicol resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1895 UPDATE CfxA3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1896 UPDATE NDM-12 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1897 UPDATE tetL efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1890 UPDATE TEM-86 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1891 UPDATE AAC(6')-Iih antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1892 UPDATE OXA-114a antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1893 UPDATE SHV-127 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2136 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to kanamycin A antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2137 UPDATE Escherichia coli EF-Tu mutants conferring resistance to kirromycin antibiotic resistant gene variant or mutant; elfamycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2134 UPDATE CMY-36 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2135 UPDATE ACT-33 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2132 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to kanamycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2133 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to viomycin peptide antibiotic resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2130 UPDATE opcM efflux pump conferring antibiotic resistance; aminoglycoside resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2131 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 951 UPDATE ACT-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 950 UPDATE ErmX antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 953 UPDATE Enterococcus faecium liaF mutant conferring daptomycin resistance peptide antibiotic resistance gene; antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 952 UPDATE sul2 antibiotic target replacement protein; sulfonamide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 955 UPDATE SHV-96 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 954 UPDATE APH(3')-IIb antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2138 UPDATE NmcA beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2139 UPDATE vanSD glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2002 UPDATE cat86 chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2003 UPDATE pmrA efflux pump efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2000 UPDATE TEM-24 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2001 UPDATE OXA-250 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2006 UPDATE IMP-27 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2007 UPDATE OXA-335 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2004 UPDATE TEM-189 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2005 UPDATE CTX-M-89 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2008 UPDATE SHV-145 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2009 UPDATE aadA6 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1263 UPDATE QnrB56 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 666 UPDATE CTX-M-34 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2176 UPDATE glycopeptide resistance gene cluster VanN antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 1261 UPDATE rosA efflux pump conferring antibiotic resistance; polymyxin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2177 UPDATE glycopeptide resistance gene cluster VanA antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 1799 UPDATE TEM-147 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1798 UPDATE SHV-183 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 719 UPDATE CMY-33 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 718 UPDATE LRA-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 717 UPDATE CTX-M-100 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1792 UPDATE DHA-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1791 UPDATE TEM-164 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1790 UPDATE vanHF glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 713 UPDATE CTX-M-81 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 712 UPDATE catB2 chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1795 UPDATE VEB-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1794 UPDATE tmrB tunicamycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 661 UPDATE VIM-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 716 UPDATE QnrB32 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 505 UPDATE Mycobacterium tuberculosis iniC mutant conferring resistance to ethambutol efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; ethambutol resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 660 UPDATE Streptococcus pneumonia parC conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2178 UPDATE glycopeptide resistance gene cluster VanO antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 1069 UPDATE IMP-35 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1068 UPDATE AAC(6')-Ib3 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2179 UPDATE glycopeptide resistance gene cluster VanE antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with gene order model UPDATED model_description with A meta-model to detect a defined gene order based on gene detection by other models. UPDATED param_type with gene order UPDATED param_description with A parameter to describe the relative order of genes detected by multiple detection models. The parameter is defined by a series of model_id separated by commas. " 1061 UPDATE OXY-2-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1060 UPDATE SHV-103 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1063 UPDATE QnrB73 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1062 UPDATE SHV-71 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1065 UPDATE OXA-384 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1064 UPDATE CTX-M-141 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1067 UPDATE mexE efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; trimethoprim resistance gene; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1066 UPDATE TEM-118 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1669 UPDATE vanZF glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1668 UPDATE CMY-68 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1667 UPDATE TEM-80 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1666 UPDATE vanXB glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1665 UPDATE ramA chloramphenicol resistance gene; gene modulating antibiotic efflux; gene modulating permeability to antibiotic; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1664 UPDATE adeK chloramphenicol resistance gene; beta-lactam resistance gene; aminocoumarin resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; lincosamide resistance gene; tetracycline resistance gene; rifampin resistance gene; trimethoprim resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1663 UPDATE ACC-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1662 UPDATE OKP-B-17 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1661 UPDATE CARB-8 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1660 UPDATE OXA-375 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1087 UPDATE OXA-253 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1086 UPDATE CMY-41 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1085 UPDATE OKP-B-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 592 UPDATE lmrB efflux pump conferring antibiotic resistance; lincosamide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1083 UPDATE OXA-323 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 594 UPDATE QnrB41 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 597 UPDATE Klebsiella pneumoniae ramR mutants chloramphenicol resistance gene; gene modulating antibiotic efflux; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; tetracycline resistance gene; rifampin resistance gene; beta-lactam resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1080 UPDATE SHV-158 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 599 UPDATE OKP-A-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 598 UPDATE dfrA16 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1089 UPDATE CMY-14 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1088 UPDATE Staphylococcus aureus rpoB mutants conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 714 UPDATE dfrB1 antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1526 UPDATE AAC(6')-Iaa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1409 UPDATE CMY-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1408 UPDATE TEM-124 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1403 UPDATE OXA-388 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1402 UPDATE OXA-390 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1401 UPDATE mefE efflux pump conferring antibiotic resistance; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1400 UPDATE CTX-M-74 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1407 UPDATE CMY-62 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1406 UPDATE OXA-121 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1405 UPDATE armA antibiotic target modifying enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1404 UPDATE IMP-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1546 UPDATE Erm(43) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 449 UPDATE SHV-133 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 448 UPDATE dfrG antibiotic target replacement protein; trimethoprim resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1339 UPDATE Mycobacterium tuberculosis embR mutant conferring resistance to ethambutol ethambutol resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1338 UPDATE BLA1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1547 UPDATE vanRC glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1335 UPDATE QnrB8 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1334 UPDATE SHV-126 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1337 UPDATE baeR efflux pump conferring antibiotic resistance; aminocoumarin resistance gene; aminoglycoside resistance gene; gene modulating antibiotic efflux; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1336 UPDATE BcII antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1331 UPDATE CTX-M-52 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 690 UPDATE OXA-347 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1333 UPDATE vanHD glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1332 UPDATE APH(3')-IIIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1545 UPDATE Escherichia coli gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 1542 UPDATE amrA efflux pump conferring antibiotic resistance; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1631 UPDATE CTX-M-71 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1543 UPDATE CMY-22 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 39 UPDATE AAC(3)-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_sequences; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED fmax with 5520 UPDATED strand with + UPDATED accession with U12338 UPDATED fmin with 5055 UPDATED sequence with ATGGGCATCATTCGCACATGTAGGCTCGGCCCTGACCAAGTCAAATCCATGCGGGCTGCTCTTGATCTTTTCGGTCGTGAGTTCGGAGACGTAGCCACCTACTCCCAACATCAGCCGGACTCCGATTACCTCGGGAACTTGCTCCGTAGTAAGACATTCATCGCGCTTGCTGCCTTCGACCAAGAAGCGGTTGTTGGCGCTCTCGCGGCTTACGTTCTGCCCAGGTTTGAGCAGCCGCGTAGTGAGATCTATATCTATGATCTCGCAGTCTCCGGCGAGCACCGGAGGCAGGGCATTGCCACCGCGCTCATCAATCTCCTCAAGCATGAGGCCAACGCGCTTGGTGCTTATGTGATCTACGTGCAAGCAGATTACGGTGACGATCCCGCAGTGGCTCTCTATACAAAGTTGGGCATACGGGAAGAAGTGATGCACTTTGATATCGACCCAAGTACCGCCACCTAA UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED GI with AAG15269.1 UPDATED sequence with MGIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTAT UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 38 UPDATE APH(3')-Va antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1540 UPDATE rmtC antibiotic target modifying enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 33 UPDATE msrE efflux pump conferring antibiotic resistance; streptogramin resistance gene; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 32 UPDATE DHA-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 31 UPDATE CTX-M-155 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 30 UPDATE OXA-226 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 37 UPDATE mdfA efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 36 UPDATE Mycobaterium leprae gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 35 UPDATE FosA2 antibiotic inactivation enzyme; fosfomycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 34 UPDATE OXY-6-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1241 UPDATE TEM-144 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1536 UPDATE OXA-421 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1535 UPDATE CMY-16 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1534 UPDATE PER-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1245 UPDATE TEM-114 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1532 UPDATE OXA-249 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1247 UPDATE CMY-72 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1530 UPDATE OXA-67 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1249 UPDATE FOX-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 648 UPDATE GES-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1539 UPDATE aadA3 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1538 UPDATE SHV-104 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 339 UPDATE ANT(3'')-Ii-AAC(6')-IId fusion protein antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 338 UPDATE OXY-1-2 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 335 UPDATE Staphylococcus aureus parE conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 334 UPDATE mexX efflux pump conferring antibiotic resistance; macrolide resistance gene; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 337 UPDATE adeC efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 336 UPDATE tlrB antibiotic target modifying enzyme; gene involved in self resistance to antibiotic; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 331 UPDATE TEM-166 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 330 UPDATE IMP-26 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 333 UPDATE CARB-23 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 332 UPDATE r39 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2118 UPDATE OXA-193 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 8 UPDATE NDM-6 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2119 UPDATE LRA-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1353 UPDATE GES-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1636 UPDATE QnrB57 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1462 UPDATE LRA-19 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1352 UPDATE OXA-251 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1350 UPDATE TEM-93 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1889 UPDATE NDM-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1888 UPDATE MIR-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1887 UPDATE TEM-70 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1886 UPDATE LEN-24 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1885 UPDATE tetZ efflux pump conferring antibiotic resistance; tetracycline resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1884 UPDATE CTX-M-111 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1883 UPDATE DHA-10 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1882 UPDATE OXA-80 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1881 UPDATE OXA-72 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1880 UPDATE adeN chloramphenicol resistance gene; gene modulating antibiotic efflux; beta-lactam resistance gene; aminocoumarin resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; efflux pump conferring antibiotic resistance; lincosamide resistance gene; tetracycline resistance gene; rifampin resistance gene; trimethoprim resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2121 UPDATE LRA-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2120 UPDATE MacAB-TolC efflux pump conferring antibiotic resistance; macrolide resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2123 UPDATE vgaC efflux pump conferring antibiotic resistance; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2122 UPDATE Mycobacterium chelonae 16S rRNA mutation conferring resistance to neomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with rRNA mutation model UPDATED model_description with A model to detect mutations in ribosomal RNA genes (rRNA) that confer elevated resistance to antibiotic(s) relative to wild type. These models include a reference rRNA sequence and mapped resistance variants. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2125 UPDATE major facilitator superfamily (MFS) antibiotic efflux pump efflux pump conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2124 UPDATE Clostridium difficile EF-Tu mutants conferring resistance to elfamycin antibiotic resistant gene variant or mutant; elfamycin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 948 UPDATE mecI antibiotic resistance gene cluster, cassette, or operon; antibiotic target replacement protein; beta-lactam resistance gene; gene modulating beta-lactam resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 949 UPDATE CTX-M-77 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 946 UPDATE QnrB48 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 947 UPDATE OXA-100 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 944 UPDATE bcrB efflux pump conferring antibiotic resistance; peptide antibiotic resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1084 UPDATE LEN-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 942 UPDATE OXA-104 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 943 UPDATE vanU glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 940 UPDATE TEM-125 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 941 UPDATE GES-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 133 UPDATE arr-8 rifampin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 132 UPDATE TEM-198 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 131 UPDATE CTX-M-50 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 130 UPDATE CTX-M-112 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 137 UPDATE APH(2'')-Ie antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 136 UPDATE CMY-9 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 135 UPDATE SME-5 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 134 UPDATE rgt1438 rifampin resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 139 UPDATE QnrB10 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 138 UPDATE cml efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1354 UPDATE Mycobacterium tuberculosis embA mutant conferring resistance to ethambutol ethambutol resistance gene; antibiotic resistant gene variant or mutant; model_type; model_description; model_param "UPDATED model_type with protein variant model UPDATED model_description with A model to detect proteins that confer elevated resistance to antibiotic(s) relative to wild type. These models include reference sequences, a curated BLASTP cut-off, and mapped resistance variants. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. UPDATED param_type with resistance variant UPDATED param_description with A mutation or sequence variant that confers elevated resistance to antibiotic(s) relative to wild type. The most common encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. Single or multiple amino acid substitutions can be present in a single gene or across multiple genes to confer resistance to antibiotic(s). In addition, there are insertions and deletions within genome sequences that confer elevated resistance towards antibiotic(s). " 2019 UPDATE OXA-213 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2018 UPDATE CMY-76 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2015 UPDATE DHA-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2014 UPDATE PmrF polymyxin resistance gene; gene altering cell wall charge conferring antibiotic resistance; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2017 UPDATE CTX-M-37 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2016 UPDATE OXA-370 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2011 UPDATE QnrB60 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2010 UPDATE CTX-M-129 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2013 UPDATE Erm(41) antibiotic target modifying enzyme; lincosamide resistance gene; macrolide resistance gene; streptogramin resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2012 UPDATE SHV-178 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 2112 UPDATE patB efflux pump conferring antibiotic resistance; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 708 UPDATE CTX-M-49 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 709 UPDATE TEM-213 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 704 UPDATE oprJ efflux pump conferring antibiotic resistance; chloramphenicol resistance gene; macrolide resistance gene; fluoroquinolone resistance gene; model_type; model_description; ARO_category; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. DELETED 36191 UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 705 UPDATE CMY-116 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 706 UPDATE APH(7'')-Ia antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 707 UPDATE AIM-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 700 UPDATE ACT-31 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 701 UPDATE SHV-129 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 702 UPDATE CTX-M-98 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 703 UPDATE cmlv chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 88 UPDATE CMY-55 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 89 UPDATE vanYA glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 82 UPDATE PER-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 83 UPDATE IMP-47 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 80 UPDATE ACT-29 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 81 UPDATE FOX-3 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 86 UPDATE TEM-102 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 87 UPDATE TEM-116 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 84 UPDATE GIM-1 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 85 UPDATE IMP-42 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 762 UPDATE CTX-M-55 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1658 UPDATE OKP-B-4 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1659 UPDATE OXA-258 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1652 UPDATE IMP-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1653 UPDATE AAC(6')-Ip antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1650 UPDATE CMY-15 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1651 UPDATE AAC(6')-If antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1656 UPDATE CTX-M-79 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1657 UPDATE AAC(6')-IIa antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1654 UPDATE SHV-95 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1655 UPDATE TEM-117 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 586 UPDATE VIM-20 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 587 UPDATE TEM-73 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 584 UPDATE aadA21 antibiotic inactivation enzyme; aminoglycoside resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 585 UPDATE NDM-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 763 UPDATE catI chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 583 UPDATE SHV-100 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 580 UPDATE TEM-110 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 581 UPDATE QnrB19 antibiotic target protection protein; fluoroquinolone resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1632 UPDATE CTX-M-53 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 588 UPDATE OKP-A-7 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 589 UPDATE TEM-145 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1633 UPDATE catQ chloramphenicol resistance gene; antibiotic inactivation enzyme; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontology term based on a BLASTP hit to a CARD reference sequence. " 1634 UPDATE CMY-78 antibiotic inactivation enzyme; beta-lactam resistance gene; model_type; model_description; model_param "UPDATED model_type with protein homolog model UPDATED model_description with Models to detect proteins conferring antibiotic resistance, which include a reference protein sequence and a curated BLASTP cut-off. UPDATED param_description with A curated expectation value (e-value) for assignment of an Antibiotic Resistance Ontolog