Model_id Action ARO_name ARO_category Changes To Summary 643 UPDATE OXY-2-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 344 UPDATE SHV-188 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 346 UPDATE QnrB23 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 347 UPDATE Sfh-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 340 UPDATE CMY-51 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 341 UPDATE IMP-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 343 UPDATE OXA-31 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 348 UPDATE OXY-3-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 349 UPDATE vanL glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2319 UPDATE aminocoumarin resistant alaS aminocoumarin resistance protein; ARO_category "UPDATED category_aro_name with aminocoumarin resistance protein UPDATED category_aro_description with Point mutations to DNA topoisomerase enzymes clinically shown to confer resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. " 2317 UPDATE mgrB efflux pump conferring antibiotic resistance; polymyxin resistance protein; gene conferring resistance via absence; gene modulating antibiotic efflux; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 2310 UPDATE Streptomyces cinnamoneus EF-Tu mutants conferring resistance to elfamycin gene involved in self-resistance to antibiotic; antibiotic resistant gene variant or mutant; elfamycin resistance protein; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with elfamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to elfamycin antibiotics. " 298 UPDATE vanYG1 glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 299 UPDATE CepS beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 296 UPDATE VIM-23 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 297 UPDATE CMY-98 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 294 UPDATE CfxA4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 295 UPDATE OXA-145 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 292 UPDATE TEM-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 293 UPDATE SHV-180 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 290 UPDATE vatD streptogramin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 291 UPDATE APH(3')-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 270 UPDATE LEN-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 271 UPDATE CMY-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 272 UPDATE QnrB36 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 273 UPDATE VEB-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 274 UPDATE OXA-174 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 275 UPDATE OKP-B-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 277 UPDATE TEM-91 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 278 UPDATE imiS antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 279 UPDATE CTX-M-107 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1132 UPDATE OXA-88 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2260 UPDATE vatF antibiotic inactivation enzyme; streptogramin resistance protein; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 2261 UPDATE lnuE lincosamide resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. " 2267 UPDATE Escherichia coli nfsA mutations conferring resistance to nitrofurantoin nitrofuratoin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with nitrofuratoin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to the antibiotic drug, nitrofurantoin " 2445 UPDATE erm(44) antibiotic target modifying enzyme; lincosamide resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 108 UPDATE PDC-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 109 UPDATE ErmE antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 102 UPDATE TLA-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 103 UPDATE SHV-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 100 UPDATE mycobacterium tuberculosis ethA mutant conferring resistance to ethionamide antibiotic resistant gene variant or mutant; model_param "UPDATED 4152 with nt703-1:T UPDATED 4153 with nt110-1:A UPDATED 4156 with nt1290-1:C UPDATED 4148 with nt811+1 UPDATED 4154 with nt768-1:G UPDATED 4155 with nt338+1:A UPDATED 4142 with nt65-1 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. " 101 UPDATE TEM-109 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 106 UPDATE catB9 phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 107 UPDATE TEM-43 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 104 UPDATE OXA-61 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 105 UPDATE CARB-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2047 UPDATE OXA-322 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2044 UPDATE QnrB31 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2045 UPDATE OXY-2-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2042 UPDATE IND-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2043 UPDATE aadA8 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2040 UPDATE TEM-60 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2041 UPDATE OXA-424 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2048 UPDATE OXA-57 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2049 UPDATE QnrB72 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 99 UPDATE QnrB38 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 98 UPDATE CMY-48 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 90 UPDATE Staphylococcus aureus rpoB mutants conferring resistance to rifampicin rifamycin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 93 UPDATE SHV-105 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 92 UPDATE CTX-M-42 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 95 UPDATE CMY-56 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 94 UPDATE CMY-79 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 97 UPDATE vanXYC glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 96 UPDATE OXA-426 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1623 UPDATE GIM-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1622 UPDATE vanWG glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1993 UPDATE QnrB74 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1992 UPDATE dfrA1 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1995 UPDATE AAC(6')-Iz antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1994 UPDATE gimA glycosyltransferase antibiotic inactivation enzyme; macrolide resistance protein; ARO_description; ARO_category; ARO_name "UPDATED ARO_description with A macrolide glycosyltransferase encoded by the gimA gene in Streptomyces ambofaciens, a natural producer of the macrolide antibiotic spiramycin. Chalcomycin, methymycin, tylosin, pikromycin, rosaramicin, oleandomycin, josamycin, and carbomycin are preferred substrates of gimA glycosyltransferase, while erythromycin and spiramycin have notably low binding affinities. GimA may be able to inactivate spiramycin precursors. Described by Gourmelen et al. 1998. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED ARO_name with gimA " 1625 UPDATE OXA-179 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1996 UPDATE vanXM glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1999 UPDATE TEM-215 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1998 UPDATE CTX-M-83 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1629 UPDATE TEM-197 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1628 UPDATE SHV-154 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 559 UPDATE vanXYE glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 555 UPDATE OXA-133 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 554 UPDATE OXA-163 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 557 UPDATE SHV-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 556 UPDATE vanYB glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 551 UPDATE CTX-M-117 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 550 UPDATE CMY-71 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 553 UPDATE VIM-35 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 552 UPDATE QnrB28 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1199 UPDATE SHV-168 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1190 UPDATE OXA-354 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1193 UPDATE ErmH antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1192 UPDATE VEB-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1195 UPDATE SHV-55 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1194 UPDATE OXA-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1197 UPDATE Mycobacterium tuberculosis rpsL mutations conferring resistance to Streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1196 UPDATE OXA-71 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1759 UPDATE vanF glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1758 UPDATE OXA-326 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1756 UPDATE CMY-93 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1755 UPDATE CTX-M-23 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1754 UPDATE vanO glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1753 UPDATE SHV-148 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1751 UPDATE Erm(33) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1750 UPDATE OXA-254 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1177 UPDATE KPC-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1176 UPDATE Mycobacterium tuberculosis katG mutations conferring resistance to isoniazid antibiotic resistant gene variant or mutant; isoniazid resistance protein; ARO_category; model_param "UPDATED category_aro_name with isoniazid resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to the antibiotic drug, isoniazid. UPDATED 3926 with nt518+4:GGTC UPDATED 3927 with nt60-1:A UPDATED 3925 with nt135+1:T UPDATED 3935 with nt249-1:G UPDATED 3934 with nt368-1:G UPDATED 3928 with nt241-1:G UPDATED 3931 with nt54-1:C UPDATED 3930 with nt325+1:T UPDATED 3933 with nt126-1:G UPDATED 3932 with nt81-1:C UPDATED 3940 with nt1365+1:G UPDATED 3942 with nt571-6:GGCGGC UPDATED 3941 with nt1501-1:G UPDATED 3939 with nt1525-1:A UPDATED 3937 with nt392+1:T UPDATED 3938 with nt1293-1:G UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. UPDATED 3763 with E506STOP UPDATED 3694 with E454STOP UPDATED param_type_id with 40394 UPDATED param_type with nonsense SNP UPDATED param_description with A SNP that changes an amino acid residue to a STOP codon resulting in a truncated protein product. These mutations are recorded in the format: [wild type amino acid][position][STOP] (e.g. Q42STOP) UPDATED 3758 with N596S, Y597H UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 1175 UPDATE Enterococcus faecium cls conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance protein; ARO_category; model_param "UPDATED category_aro_name with lipopeptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to lipopeptide antibiotics. UPDATED 3851 with +MPL110-112 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. " 1174 UPDATE QnrB22 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1173 UPDATE TEM-54 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1172 UPDATE OXA-194 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1171 UPDATE tet44 antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 1170 UPDATE CMY-46 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1179 UPDATE IMP-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1178 UPDATE CMY-81 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1007 UPDATE OKP-A-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 513 UPDATE CARB-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 644 UPDATE OXY-2-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1285 UPDATE sat-1 nucleoside resistance protein; antibiotic inactivation enzyme; ARO_description; ARO_category; ARO_name "UPDATED ARO_description with SAT-1 is a plasmid-mediated streptothricin acetyltransferase, which confers resistance to streptothricin, a nucleoside antibiotic. Originally described from an E. coli plasmid sequence by Heim et al., 1989. SAT-2 is an identical peptide sequence also described from an E. coli plasmid by Tietze et al., 1990. DELETED 37248 UPDATED category_aro_name with nucleoside resistance protein UPDATED category_aro_cvterm_id with 40980 UPDATED category_aro_accession with 3004027 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to nucleoside antibiotics, including aminonucleosides. UPDATED ARO_name with SAT-1 " 1284 UPDATE IND-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1287 UPDATE CTX-M-110 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1004 UPDATE vanRD glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1281 UPDATE OXA-110 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1280 UPDATE QnrB12 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1283 UPDATE KPC-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1282 UPDATE SIM-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1003 UPDATE OXA-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1289 UPDATE OKP-B-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1288 UPDATE OXA-82 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 514 UPDATE LEN-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1579 UPDATE QnrB9 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1578 UPDATE SHV-123 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 689 UPDATE CTX-M-123 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 688 UPDATE MOX-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1573 UPDATE SHV-110 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1572 UPDATE OXA-205 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 687 UPDATE APH(3')-Vc antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 686 UPDATE OXA-162 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 681 UPDATE TEM-120 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 680 UPDATE CMY-54 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 683 UPDATE CMY-75 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1574 UPDATE Mycobacterium tuberculosis inhA mutations conferring resistance to isoniazid antibiotic resistant gene variant or mutant; isoniazid resistance protein; ARO_category "UPDATED category_aro_name with isoniazid resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to the antibiotic drug, isoniazid. " 623 UPDATE OXA-68 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 459 UPDATE CTX-M-94 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1240 UPDATE Bacillus Cluster A intrinsic mph antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 1225 UPDATE TEM-178 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1224 UPDATE Erm(30) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1223 UPDATE viomycin phosphotransferase peptide antibiotic resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 626 UPDATE vanHB glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1221 UPDATE OXA-231 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1220 UPDATE OCH-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 407 UPDATE OXA-352 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1370 UPDATE AAC(6')-Ib10 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 405 UPDATE OXA-202 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1372 UPDATE ANT(2'')-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1375 UPDATE CMY-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1374 UPDATE blaI antibiotic resistance gene cluster, cassette, or operon; beta-lactam resistance protein; gene modulating beta-lactam resistance; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 401 UPDATE ACT-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 400 UPDATE PDC-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1379 UPDATE OXA-313 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1378 UPDATE AAC(3)-IIc antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 452 UPDATE QnrVC4 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 409 UPDATE vanRL glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 408 UPDATE OXA-380 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1242 UPDATE aadA6/aadA10 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 457 UPDATE OXA-93 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1245 UPDATE TEM-114 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 379 UPDATE OXA-148 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 378 UPDATE TEM-214 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 647 UPDATE TEM-89 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 371 UPDATE SHV-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 370 UPDATE SHV-112 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 373 UPDATE MIR-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 374 UPDATE SHV-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 376 UPDATE lnuC lincosamide resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. " 393 UPDATE QnrS5 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 392 UPDATE TUS-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 391 UPDATE VIM-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 390 UPDATE vanSG glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 397 UPDATE OXA-357 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 396 UPDATE sul3 antibiotic target replacement protein; sulfonamide resistance protein; ARO_category "UPDATED category_aro_name with sulfonamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to sulfonamide antibiotics. " 395 UPDATE TLE beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 394 UPDATE OXA-130 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 399 UPDATE MIR-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 398 UPDATE TEM-71 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 244 UPDATE SHV-164 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 247 UPDATE TEM-158 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 246 UPDATE CTX-M-126 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 241 UPDATE ACT-30 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 240 UPDATE vanRF glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 243 UPDATE OXA-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 242 UPDATE SHV-152 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 249 UPDATE PmrB polymyxin resistance protein; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 248 UPDATE OKP-B-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2275 UPDATE desR gene involved in self-resistance to antibiotic; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic " 2274 UPDATE RlmA(II) antibiotic target modifying enzyme; gene involved in self-resistance to antibiotic; macrolide resistance protein; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 2277 UPDATE Bacillus Cluster B intrinsic mph antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 2273 UPDATE oleR gene involved in self-resistance to antibiotic; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic " 2404 UPDATE Neisseria gonorrhoeae gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2279 UPDATE Listeria monocytogenes mprF antibiotic target modifying enzyme; peptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 2278 UPDATE Bifidobacteria intrinsic ileS conferring resistance to mupirocin mupirocin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with mupirocin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to mupirocin antibiotics. Mutations in ileS is shown to confer low-level mupirocin resistance, while high-level resistance is conferred by the presence of alternative isoleucyl-tRNA synthetases. UPDATED category_aro_name with antibiotic resistant gene variant or mutant UPDATED category_aro_cvterm_id with 35950 UPDATED category_aro_accession with 0000031 UPDATED category_aro_description with Resistance to antibiotics is often conferred by single nucleotide polymorphisms (SNPs) and other mutations in target genes. " 646 UPDATE OXA-349 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 179 UPDATE QnrA5 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 178 UPDATE vanHA glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 177 UPDATE IMP-51 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 176 UPDATE CMY-25 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 175 UPDATE CTX-M-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 174 UPDATE CfxA2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 173 UPDATE arr-4 rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 171 UPDATE TEM-78 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 170 UPDATE IMP-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2051 UPDATE dfrA15 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 2050 UPDATE OXA-331 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2053 UPDATE dfrA7 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 2052 UPDATE APH(3'')-Ic antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2055 UPDATE LRA-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2057 UPDATE SHV-179 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 657 UPDATE SHV-142 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2059 UPDATE OKP-A-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1500 UPDATE APH(6)-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 655 UPDATE OXA-243 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1504 UPDATE CMY-108 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2157 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to gentamicin C antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1364 UPDATE CMY-101 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1977 UPDATE AAC(6')-Ik antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1365 UPDATE AAC(6')-I30 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1605 UPDATE cphA5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1604 UPDATE CTX-M-84 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1971 UPDATE dfrB2 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1606 UPDATE CTX-M-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1968 UPDATE SHV-189 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1618 UPDATE OXA-362 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1619 UPDATE L1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1964 UPDATE IMP-45 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1617 UPDATE vanE glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1614 UPDATE TEM-194 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1615 UPDATE APH(2'')-IIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1612 UPDATE ErmR antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1961 UPDATE TEM-105 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1610 UPDATE OXA-74 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1611 UPDATE SME-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1363 UPDATE CARB-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1768 UPDATE CTX-M-144 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1769 UPDATE CTX-M-115 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1762 UPDATE aadA16 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1763 UPDATE NDM-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1760 UPDATE QnrB35 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1761 UPDATE OXA-351 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1766 UPDATE VIM-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1767 UPDATE OKP-A-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1764 UPDATE OXA-97 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1765 UPDATE OXA-56 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1142 UPDATE dfrA17 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1143 UPDATE OXA-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1140 UPDATE CMY-86 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1141 UPDATE OXA-169 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1146 UPDATE TEM-156 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1147 UPDATE CMY-63 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1144 UPDATE VgbB streptogramin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1145 UPDATE CTX-M-124 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1148 UPDATE OXA-363 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1149 UPDATE AER-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 769 UPDATE KPC-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1546 UPDATE Erm(43) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1547 UPDATE vanRC glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 690 UPDATE OXA-347 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 691 UPDATE vanRE glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 696 UPDATE cfrA linezolid resistance protein; lincosamide resistance protein; macrolide resistance protein; antibiotic target modifying enzyme; phenicol resistance protein; streptogramin resistance protein; ARO_category "UPDATED category_aro_name with linezolid resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to linezolids. UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 697 UPDATE Erm(42) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 694 UPDATE CTX-M-40 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1541 UPDATE ACT-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 698 UPDATE TEM-205 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 699 UPDATE QnrS9 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1548 UPDATE APH(3')-Vb antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1549 UPDATE ErmB antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; model_sequences; ARO_category "DELETED 320 UPDATED fmax with 2320111 UPDATED strand with - UPDATED accession with NC_009089.1 UPDATED fmin with 2319373 UPDATED sequence with TTATTTCCTCCCGTTAAATAATAGATAACTATTAAAAATAGACAATACTTGCTCATAAGTAACGGTACTTAAATCGTTTACTTTGGCGTATTTCATTGCTTGATGAAACTGATTTTTAGTAAACAGTTGACGATATTCTCGATTGACCCATTTTGAAACAAAGTACGTATATAGTTTCCAATATTTATCTGGAACATCTGTGGTATGGCGGGTAAGTTTTATTAAGGCACTGTTTACTTTTGGTTTAGGATGAAAGCATTCAGCTGGCAGCTTAAGCAATTGCTTAATCGAGACTTGAGTGTGCAAGAGCAACCCTAGTGTTCGGTGAATATCCAAGGTACGCTTGTAGAATCCTTCTTCAACAATCAGATAGATGTCAGACGCACGGCTTTCAAAAACCACTTTTTTAATAATTTGTGTGCTTAAATGGTAAGGAATACTCCCAACAATTTTATACCTCTGTTTGTTAGGGAATTGAAACTGTAGAATATCTTGGTGAATTAAAGTGACACGAGTATTCAGTTTTAATTTTTCTGACGATAAGTTGAATAGATGACTGTCTAATTCAATAGACGTTACCTGTTTACTTATTTTAGCCAGTTTCGTCGTTAAATGCCCTTTACCTGTTCCAATTTCGTAAACGGTATCGGTTTCTTTTAAATTCAATTGTTTTATTATTTGGTTGAGTACTTTTTCACTCGTTAAAAAGTTTTGAGAATATTTTATATTTTTGTTCAT UPDATED NCBI_taxonomy_name with Clostridium difficile 630 UPDATED NCBI_taxonomy_id with 272563 UPDATED NCBI_taxonomy_cvterm_id with 37603 UPDATED GI with YP_001088523.1 UPDATED sequence with MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGSIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIKQLLKLPAECFHPKPKVNSALIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKYAKVNDLSTVTYEQVLSIFNSYLLFNGRK UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 543 UPDATE TEM-106 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 541 UPDATE TEM-133 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 546 UPDATE TLA-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 547 UPDATE arr-5 rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 544 UPDATE AAC(6')-Is antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 763 UPDATE catI phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 548 UPDATE QnrB3 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 549 UPDATE TEM-107 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1782 UPDATE TEM-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1783 UPDATE VIM-36 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 766 UPDATE SHV-102 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 767 UPDATE OXA-207 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1787 UPDATE VIM-42 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 414 UPDATE OXA-377 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 415 UPDATE TEM-33 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 416 UPDATE OXA-204 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 417 UPDATE QnrB6 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 410 UPDATE AAC(3)-IIIb antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 411 UPDATE QnrB11 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 412 UPDATE OXA-117 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 413 UPDATE OXA-144 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1384 UPDATE OXA-382 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1386 UPDATE ANT(9)-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1387 UPDATE OXA-99 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 418 UPDATE OXA-325 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 419 UPDATE SLB-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1382 UPDATE rmtG antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1383 UPDATE IMI-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 368 UPDATE CARB-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 369 UPDATE SHV-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 366 UPDATE Mycobacterium tuberculosis iniA mutant conferring resistance to Ethambutol efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; polyamine resistance protein; ARO_category; model_param "DELETED 36607 UPDATED category_aro_name with polyamine resistance protein UPDATED category_aro_cvterm_id with 40134 UPDATED category_aro_accession with 3003532 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polyamine antibiotics. UPDATED 3907 with nt93-5 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. " 367 UPDATE CTX-M-25 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 364 UPDATE CMY-83 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 365 UPDATE TEM-122 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 362 UPDATE CTX-M-151 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 363 UPDATE TEM-155 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 360 UPDATE AAC(6')-Iy antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 361 UPDATE OXA-278 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 380 UPDATE CTX-M-147 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 381 UPDATE QnrS1 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 382 UPDATE QnrB61 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 383 UPDATE Pseudomonas mutant PhoQ conferring resistance to colistin efflux pump conferring antibiotic resistance; polymyxin resistance protein; gene modulating antibiotic efflux; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 384 UPDATE APH(2'')-IVa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 385 UPDATE OXA-46 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 386 UPDATE LEN-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 388 UPDATE QnrB71 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 389 UPDATE tetW antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 2191 UPDATE AAC(6')-Iaj antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 258 UPDATE OXA-208 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2196 UPDATE Pseudomonas aeruginosa gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category; model_param "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. UPDATED 3315 with T83I,D87G UPDATED 3317 with T83I,D87H UPDATED 3316 with T83I,D87N UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 252 UPDATE APH(9)-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 253 UPDATE vanXYG glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 251 UPDATE APH(3')-VIIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 256 UPDATE CMY-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 257 UPDATE ACT-37 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 254 UPDATE OXA-150 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 255 UPDATE bleomycin resistance protein (BRP) glycopeptide resistance protein; gene involved in antibiotic sequestration; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2200 UPDATE APH(3')-VI antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2201 UPDATE PvrR aminoglycoside resistance protein; gene conferring resistance via absence; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2202 UPDATE AAC(3)-Ib/AAC(6')-Ib'' antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2203 UPDATE MCR-1 polymyxin resistance protein; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 2204 UPDATE AAC(6')-IId antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1848 UPDATE CTX-M-75 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 168 UPDATE VIM-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 169 UPDATE IMP-33 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 164 UPDATE vanN glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 165 UPDATE VIM-29 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 166 UPDATE TEM-77 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 167 UPDATE CMY-39 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 160 UPDATE OXA-236 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 161 UPDATE SHV-56 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 162 UPDATE KPC-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 163 UPDATE OXA-376 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1841 UPDATE OXA-76 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1840 UPDATE CMY-59 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 678 UPDATE PDC-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1091 UPDATE IMP-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1814 UPDATE AAC(6')-Ie-APH(2'')-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1815 UPDATE CTX-M-134 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1816 UPDATE TEM-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1810 UPDATE VIM-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1811 UPDATE CARB-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1812 UPDATE KHM-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1813 UPDATE MOX-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1818 UPDATE GES-26 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1819 UPDATE TEM-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1098 UPDATE vanB glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 671 UPDATE CTX-M-137 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1609 UPDATE QnrC antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1979 UPDATE FosA4 antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 1978 UPDATE OXA-200 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1601 UPDATE LRA-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1600 UPDATE Pseudomonas mutant PhoP conferring resistance to colistin efflux pump conferring antibiotic resistance; polymyxin resistance protein; gene modulating antibiotic efflux; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 1603 UPDATE SHV-86 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1602 UPDATE AAC(6')-Iai antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1973 UPDATE TEM-111 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1972 UPDATE OXA-149 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1607 UPDATE Streptococcus pneumoniae PBP1a conferring resistance to amoxicillin antibiotic resistant gene variant or mutant; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1970 UPDATE SHV-44 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 809 UPDATE lnuB lincosamide resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. " 808 UPDATE TEM-171 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 803 UPDATE cphA4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 802 UPDATE QnrA3 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 801 UPDATE mfpA antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 800 UPDATE CTX-M-87 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 807 UPDATE OKP-B-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 806 UPDATE SHV-150 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 804 UPDATE tetB(P) antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 1775 UPDATE QnrS7 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1774 UPDATE CTX-M-106 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1777 UPDATE OXA-177 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1776 UPDATE SHV-159 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1771 UPDATE TEM-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1770 UPDATE TEM-127 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1772 UPDATE aadA11 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1779 UPDATE CTX-M-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1778 UPDATE OKP-A-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1159 UPDATE TEM-129 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1158 UPDATE SHV-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1155 UPDATE ACT-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1154 UPDATE TEM-146 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1157 UPDATE vanG glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1156 UPDATE Erm(31) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1151 UPDATE OXA-240 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1150 UPDATE QnrVC5 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1153 UPDATE KPC-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1152 UPDATE CTX-M-39 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 59 UPDATE OXA-256 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1551 UPDATE OXA-78 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1553 UPDATE tetS antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 1552 UPDATE MUS-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1555 UPDATE SHV-140 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 58 UPDATE QnrB47 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1557 UPDATE SHV-187 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1556 UPDATE VIM-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 55 UPDATE OXA-69 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 54 UPDATE TEM-34 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 57 UPDATE SHV-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 56 UPDATE TEM-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 51 UPDATE AAC(3)-IIIc antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 50 UPDATE SME-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 53 UPDATE MOX-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 52 UPDATE OXY-2-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 537 UPDATE OXA-120 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 536 UPDATE TEM-95 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 535 UPDATE Morganella morganii gyrB conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 534 UPDATE vanV glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 533 UPDATE CARB-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 532 UPDATE CTX-M-47 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 531 UPDATE sat-3 nucleoside resistance protein; antibiotic inactivation enzyme; ARO_description; ARO_category; ARO_name "UPDATED ARO_description with SAT-3 is a plasmid-mediated streptothricin acetyltransferase and streptothricin resistance determinant. Originally described from an E. coli plasmid gene by Tietze and Brevet, 1995. DELETED 37248 UPDATED category_aro_name with nucleoside resistance protein UPDATED category_aro_cvterm_id with 40980 UPDATED category_aro_accession with 3004027 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to nucleoside antibiotics, including aminonucleosides. UPDATED ARO_name with SAT-3 " 530 UPDATE VIM-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 539 UPDATE QnrB59 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1558 UPDATE Bacillus subtilis mprF antibiotic target modifying enzyme; peptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 428 UPDATE OXY-2-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1399 UPDATE OXA-315 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1398 UPDATE OXA-108 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 421 UPDATE TEM-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 420 UPDATE CTX-M-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1395 UPDATE Neisseria gonorrhoeae mutant porin PIB (por) with reduced permeability to antibiotic beta-lactam resistance protein; antibiotic resistant gene variant or mutant; tetracycline resistance protein; protein modulating permeability to antibiotic; ARO_category; model_param "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. UPDATED 3289 with G120P,A121P UPDATED 3288 with G120R,A121H UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 1394 UPDATE OXA-257 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1393 UPDATE THIN-B beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1392 UPDATE aadA22 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1391 UPDATE CTX-M-92 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 426 UPDATE aadK antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1321 UPDATE mecA antibiotic resistance gene cluster, cassette, or operon; beta-lactam resistance protein; antibiotic target replacement protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2183 UPDATE glycopeptide resistance gene cluster VanB antibiotic resistance gene cluster, cassette, or operon; model_type; model_description "UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 2182 UPDATE glycopeptide resistance gene cluster VanD antibiotic resistance gene cluster, cassette, or operon; ARO_description; model_type; model_description "UPDATED ARO_description with Homologous to vanA, contains a D-Ala-D-Lac ligase. This cluster is constitutively expressed in the chromosome due to a dysfunctional D-ala-D-ala ligase and confers moderate resistance to both vancomycin and teicoplanin.Gene orientation: vanRSYHDX UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 2181 UPDATE glycopeptide resistance gene cluster VanF antibiotic resistance gene cluster, cassette, or operon; model_type; model_description "UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 2180 UPDATE glycopeptide resistance gene cluster VanL antibiotic resistance gene cluster, cassette, or operon; ARO_description; model_type; model_description "UPDATED ARO_description with Homologous to VanC, contains a D-Ala-D-Ser ligase. The chromosome-located vanL gene cluster is inducible and confers low resistance to vancomycin. vanL organisms remain susceptible to teicoplanin. It is the only van gene cluster with two vanT genes.Gene orientation: vanL(XY)TmTrRS UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 2186 UPDATE glycopeptide resistance gene cluster VanG antibiotic resistance gene cluster, cassette, or operon; ARO_description; model_type; model_description "UPDATED ARO_description with Contains a D-Ala-D-Ser ligase. The vanG gene cluster is inducible and confers low resistance to vancomycin. vanG organisms remain susceptible to teicoplanin. It is the only van gene cluster that contains two vanY genes.Gene orientation: vanRSYWGYT UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 2185 UPDATE glycopeptide resistance gene cluster VanM antibiotic resistance gene cluster, cassette, or operon; model_type; model_description "UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 2184 UPDATE glycopeptide resistance gene cluster VanC antibiotic resistance gene cluster, cassette, or operon; model_type; model_description "UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 227 UPDATE OKP-B-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 226 UPDATE OXA-113 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 225 UPDATE CTX-M-88 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 224 UPDATE MIR-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 223 UPDATE GES-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 222 UPDATE JOHN-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 221 UPDATE CMY-100 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 220 UPDATE TEM-92 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2215 UPDATE Pseudomonas aeruginosa gyrA and parC conferring resistance to fluoroquinolone gene involved in self-resistance to antibiotic; antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 151 UPDATE OKP-A-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 150 UPDATE catB3 phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 155 UPDATE TEM-195 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 157 UPDATE dfrA21 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 156 UPDATE AAC(6')-Iaf antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2432 UPDATE Klebsiella OmpK35 conferring resistance to beta-lactam protein modulating permeability to antibiotic; gene conferring resistance via absence; ARO_category "UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 2436 UPDATE D-Ala-D-Ala ligase glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; ARO_category; model_param "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. UPDATED 4530 with nt41+5:GAGCA UPDATED 4529 with -DV244-245 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. " 2434 UPDATE Klebsiella OmpK36 conferring resistance to beta-lactam protein modulating permeability to antibiotic; gene conferring resistance via absence; ARO_category "UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 1807 UPDATE OXA-70 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1806 UPDATE OXA-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1805 UPDATE TEM-131 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1804 UPDATE OXA-107 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1803 UPDATE QnrVC3 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1802 UPDATE OXA-168 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1801 UPDATE AAC(6')-Ib11 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1800 UPDATE SHV-120 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1809 UPDATE QnrB5 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1948 UPDATE TEM-167 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1949 UPDATE cphA6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1257 UPDATE QnrB68 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1942 UPDATE BJP-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1943 UPDATE Mycobacterium tuberculosis kasA mutant conferring resistance to isoniazid antibiotic resistant gene variant or mutant; isoniazid resistance protein; ARO_category "UPDATED category_aro_name with isoniazid resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to the antibiotic drug, isoniazid. " 1940 UPDATE QnrB30 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1941 UPDATE SHV-98 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1946 UPDATE CTX-M-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1947 UPDATE CTX-M-160 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1944 UPDATE CTX-M-148 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1945 UPDATE SHV-50 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 818 UPDATE SHV-141 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 819 UPDATE CTX-M-68 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1527 UPDATE SHV-51 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 810 UPDATE mecC antibiotic resistance gene cluster, cassette, or operon; antibiotic target replacement protein; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 811 UPDATE TEM-26 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 812 UPDATE CMY-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 813 UPDATE OXA-216 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 814 UPDATE TEM-113 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 815 UPDATE GOB-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 816 UPDATE OXA-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 817 UPDATE CTX-M-158 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1250 UPDATE CTX-M-96 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1990 UPDATE CMY-82 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1621 UPDATE SHV-45 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1490 UPDATE SHV-107 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1491 UPDATE lnuF lincosamide resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. " 1492 UPDATE MOX-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1493 UPDATE PER-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1494 UPDATE LAT-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1495 UPDATE ACT-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1496 UPDATE OXA-224 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1497 UPDATE dfrA10 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1498 UPDATE cphA8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1627 UPDATE CTX-M-95 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 423 UPDATE DHA-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1700 UPDATE ACT-28 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1701 UPDATE Erm(39) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1702 UPDATE MIR-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1703 UPDATE FosK antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 1704 UPDATE CMY-57 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1705 UPDATE SHV-111 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1706 UPDATE OXA-142 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1707 UPDATE QnrB4 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1708 UPDATE tet36 antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 1709 UPDATE TEM-115 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 424 UPDATE SHV-36 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 427 UPDATE OCH-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1128 UPDATE OXA-23 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1129 UPDATE CMY-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1120 UPDATE IMI-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1121 UPDATE APH(3')-VIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1122 UPDATE OXA-180 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1123 UPDATE FOX-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1124 UPDATE TEM-186 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1125 UPDATE OKP-B-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1126 UPDATE OXA-184 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1127 UPDATE CTX-M-64 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 524 UPDATE dfrA25 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 525 UPDATE CMY-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 526 UPDATE ACT-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 527 UPDATE SHV-38 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1018 UPDATE APH(3')-IIc antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1019 UPDATE IMP-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 523 UPDATE OXA-75 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1014 UPDATE SHV-25 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 695 UPDATE CMY-66 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1016 UPDATE OXA-255 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1017 UPDATE CTX-M-86 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 528 UPDATE OCH-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1011 UPDATE TEM-29 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1012 UPDATE KPC-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1013 UPDATE APH(2'')-IIIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1234 UPDATE MIR-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1235 UPDATE AAC(6')-Ib' antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1236 UPDATE CMY-53 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1237 UPDATE Mycobacterium tuberculosis rpoB mutants conferring resistance to rifampicin rifamycin resistance protein; antibiotic resistant gene variant or mutant; ARO_category; model_param "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. UPDATED 4081 with -517Q UPDATED 4054 with -527K UPDATED 4085 with -519N UPDATED 4050 with -520P UPDATED 4017 with +F514 UPDATED 4006 with -N516 UPDATED 4026 with -DQ516-517 UPDATED 4027 with -QN517-518 UPDATED 3999 with +R514 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. UPDATED 4045 with Q513STOP UPDATED 4074 with S522STOP UPDATED param_type_id with 40394 UPDATED param_type with nonsense SNP UPDATED param_description with A SNP that changes an amino acid residue to a STOP codon resulting in a truncated protein product. These mutations are recorded in the format: [wild type amino acid][position][STOP] (e.g. Q42STOP) UPDATED 4057 with S531L,S622A UPDATED 4062 with D516E,S522L UPDATED 4060 with H526Y,E541G UPDATED 4061 with D516Y,L511R UPDATED 4066 with S531L,H526C UPDATED 4067 with L511R,D516V UPDATED 4086 with H526D,S531 UPDATED 4065 with S531L,F514V UPDATED 4068 with L511P,M515I UPDATED 4069 with L524W,T525P,H526Q,-527K UPDATED 4070 with Q513H,-514F,-515M,-516D UPDATED 4059 with H526S,P535H UPDATED 4058 with H526S,M515V UPDATED 4103 with T516I,G523W,D525Y UPDATED 4105 with H526P,K527Q UPDATED 4087 with L511P,S512T,D516V UPDATED 4108 with E562G,P564L UPDATED 4072 with -515M,-516D,-517Q,-518N UPDATED 4084 with -519N,S522L,S531L UPDATED 4104 with H526D,E541G,S553A UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 1230 UPDATE CTX-M-33 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1233 UPDATE tet32 antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 1238 UPDATE OXA-397 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1239 UPDATE SHV-81 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " _version N/A N/A N/A N/A NEW: 1.1.4 , OLD: 1.1.3 438 UPDATE VIM-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 439 UPDATE SHV-83 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 436 UPDATE OXY-4-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 437 UPDATE SHV-69 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 434 UPDATE LEN-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 435 UPDATE OKP-A-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 433 UPDATE ACT-25 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 430 UPDATE OXA-87 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 431 UPDATE Escherichia coli marR mutant conferring antibiotic resistance efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; gene modulating antibiotic efflux; model_param "UPDATED 3898 with E31STOP UPDATED param_type_id with 40394 UPDATED param_type with nonsense SNP UPDATED param_description with A SNP that changes an amino acid residue to a STOP codon resulting in a truncated protein product. These mutations are recorded in the format: [wild type amino acid][position][STOP] (e.g. Q42STOP) " 1630 UPDATE IMP-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 238 UPDATE SHV-137 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 239 UPDATE OXA-83 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 234 UPDATE QnrS8 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 235 UPDATE OXA-181 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 236 UPDATE ACT-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 237 UPDATE BlaB beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 230 UPDATE OXA-422 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 231 UPDATE OXA-178 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 232 UPDATE imiH antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 233 UPDATE LEN-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2462 UPDATE Propionibacterium acnes gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2228 UPDATE PEDO-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2229 UPDATE PEDO-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2227 UPDATE VCC-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2224 UPDATE Pseudomonas aeruginosa oprD conferring resistance to imipenem protein modulating permeability to antibiotic; ARO_category "UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 2222 UPDATE VEB-1b antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2221 UPDATE VEB-1a antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1 UPDATE PDC-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 146 UPDATE OXA-98 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 147 UPDATE OXA-27 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 144 UPDATE IMP-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 145 UPDATE OXA-229 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 143 UPDATE cphA7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 140 UPDATE AAC(6')-IIb antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 141 UPDATE vanRB glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 148 UPDATE SHV-92 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 149 UPDATE aadA12 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2088 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2083 UPDATE Mycoplasma hominis parC conferring resistance to fluoroquinolone gene involved in self-resistance to antibiotic; antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2080 UPDATE Escherichia coli 16S rRNA mutation in the rrsH gene conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2086 UPDATE Escherichia coli 16S rRNA mutation in the rrnB gene conferring resistance to tetracycline antibiotic resistant gene variant or mutant; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 2087 UPDATE aadA13 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2084 UPDATE Mycobacterium abscessus 16S rRNA mutation conferring resistance to amikacin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2085 UPDATE Escherichia coli 16S rRNA mutation in the rrnB gene conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1832 UPDATE QnrS2 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1833 UPDATE OXA-374 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1830 UPDATE APH(3'')-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1831 UPDATE AAC(6')-Iid antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1836 UPDATE OXA-201 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1837 UPDATE CTX-M-59 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1834 UPDATE TEM-94 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1838 UPDATE ACT-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1839 UPDATE aadA14 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2154 UPDATE Borrelia burgdorferi 16S rRNA mutation conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2155 UPDATE Propionibacterium acnes 16S rRNA mutation conferring resistance to tetracycline antibiotic resistant gene variant or mutant; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 2156 UPDATE NDM-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2405 UPDATE Neisseria gonorrhoeae parC conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2402 UPDATE Haemophilus parainfluenzae parC conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2403 UPDATE Salmonella enterica gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2152 UPDATE Neisseria meningitidis 16S rRNA mutation conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2401 UPDATE Haemophilus parainfluenzae gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 933 UPDATE OKP-A-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 932 UPDATE GES-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 931 UPDATE OXA-316 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2158 UPDATE Escherichia coli EF-Tu mutants conferring resistance to Pulvomycin antibiotic resistant gene variant or mutant; elfamycin resistance protein; ARO_category "UPDATED category_aro_name with elfamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to elfamycin antibiotics. " 936 UPDATE OKP-A-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 935 UPDATE OXA-314 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2409 UPDATE Neisseria meningititis PBP2 conferring resistance to beta-lactam antibiotic resistant gene variant or mutant; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1955 UPDATE OXA-29 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1954 UPDATE TEM-154 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1957 UPDATE VIM-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1956 UPDATE IMI-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1951 UPDATE TEM-76 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1950 UPDATE arr-1 rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 1953 UPDATE SHV-155 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1952 UPDATE OXA-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1959 UPDATE ACT-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1958 UPDATE VIM-33 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 829 UPDATE DHA-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 828 UPDATE TEM-83 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 825 UPDATE SHV-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 824 UPDATE vanD glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 827 UPDATE QnrB55 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 821 UPDATE Mycobacterium tuberculosis embB mutants conferring resistance to rifampicin rifamycin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 823 UPDATE cat phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 822 UPDATE QnrD1 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1483 UPDATE AAC(3)-Xa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1482 UPDATE SME-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1481 UPDATE OXY-1-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1480 UPDATE EXO beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1487 UPDATE SHV-48 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1486 UPDATE CARB-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1485 UPDATE MOX-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1484 UPDATE ACT-27 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1489 UPDATE CMY-37 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1488 UPDATE TEM-75 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 797 UPDATE TEM-55 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2411 UPDATE Shigella flexneri gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1711 UPDATE AQU-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 794 UPDATE Staphylococcus aureus rpoC conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with lipopeptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to lipopeptide antibiotics. " 1717 UPDATE OXA-230 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1716 UPDATE OXA-398 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1715 UPDATE OXA-73 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1714 UPDATE ErmW antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1718 UPDATE DIM-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 799 UPDATE CTX-M-31 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1270 UPDATE QnrS3 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2144 UPDATE Mycobacterium bovis embB mutations conferring resistance to ethambutol antibiotic resistant gene variant or mutant; polyamine resistance protein; ARO_category "DELETED 36607 UPDATED category_aro_name with polyamine resistance protein UPDATED category_aro_cvterm_id with 40134 UPDATED category_aro_accession with 3003532 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polyamine antibiotics. " 613 UPDATE VEB-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 610 UPDATE SHV-153 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1139 UPDATE dfrA12 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 611 UPDATE OXA-328 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1133 UPDATE SHV-109 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1274 UPDATE VIM-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1131 UPDATE AAC(3)-Ic antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1130 UPDATE PDC-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1137 UPDATE TEM-90 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1136 UPDATE MIR-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1135 UPDATE Staphylococcus aureus parE conferring resistance to aminocoumarin aminocoumarin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with aminocoumarin resistance protein UPDATED category_aro_description with Point mutations to DNA topoisomerase enzymes clinically shown to confer resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. " 1275 UPDATE ErmT antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1276 UPDATE OXA-210 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1277 UPDATE GES-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 519 UPDATE VIM-26 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 518 UPDATE vanXYN glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 926 UPDATE KPC-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1009 UPDATE IND-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1008 UPDATE BEL-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 511 UPDATE dfrA3 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 510 UPDATE CTX-M-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1005 UPDATE Escherichia coli soxR mutants efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; gene modulating antibiotic efflux; model_param "UPDATED 3893 with -S128 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. UPDATED 3894 with T38S, G74R UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 512 UPDATE CTX-M-82 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 515 UPDATE mgt antibiotic inactivation enzyme; macrolide resistance protein; ARO_description; ARO_category; ARO_name "UPDATED ARO_description with A macrolide glycosyltransferase encoded by the mgtA gene in Streptomyces lividans. This enzyme inactivates macrolides using UDP-glucose as a cofactor. Its optimal substrates are lankamycin, calcomycin, rosaramicin, methymycin, and pikromycin, while interactions with erythomycin, oldeandomycin, azithromycin, and tylosin were weaker. It is inactive against spiramycin and carbomycin. Mechanism first described by Cundliffe, 1992. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED ARO_name with mgtA " 1002 UPDATE AAC(6')-Ib4 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1001 UPDATE Staphylococcus aureus mprF mutations conferring resistance to daptomycin peptide antibiotic resistance protein; antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. UPDATED category_aro_name with lipopeptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to lipopeptide antibiotics. " 1000 UPDATE AAC(6')-Ib-Hangzhou antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1227 UPDATE aadA2 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 622 UPDATE DHA-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 621 UPDATE ErmF antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 620 UPDATE OXA-320 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 627 UPDATE Escherichia coli rpoB mutants conferring resistance to rifampicin rifamycin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 1222 UPDATE FosA antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 625 UPDATE QnrB46 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 624 UPDATE Mycobacterium leprae rpoB mutants conferring resistance to rifampicin rifamycin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 629 UPDATE VIM-28 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 628 UPDATE catB10 phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1229 UPDATE CTX-M-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1228 UPDATE CMY-30 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1535 UPDATE CMY-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2 UPDATE CblA-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1286 UPDATE SHV-34 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 11 UPDATE Erm(34) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 10 UPDATE CARB-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 13 UPDATE LRA-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 12 UPDATE TEM-126 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 15 UPDATE TEM-59 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 14 UPDATE TEM-72 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 16 UPDATE KPC-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 19 UPDATE IMP-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 18 UPDATE OXA-212 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 929 UPDATE GES-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 201 UPDATE OCH-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 200 UPDATE LEN-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 203 UPDATE OXY-2-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 202 UPDATE SHV-101 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 205 UPDATE APH(4)-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 204 UPDATE VIM-43 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 207 UPDATE GES-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 206 UPDATE FomA antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 209 UPDATE AAC(3)-Ib/AAC(6')-Ib'' antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 208 UPDATE CMY-105 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 685 UPDATE OXA-239 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 684 UPDATE SHV-37 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1571 UPDATE vanSE glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2231 UPDATE CPS-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2230 UPDATE PEDO-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2233 UPDATE MSI-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2232 UPDATE ESP-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2235 UPDATE SPG-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2234 UPDATE MSI-OXA antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1576 UPDATE OXA-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1575 UPDATE OXA-91 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 682 UPDATE QnrS4 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 229 UPDATE vanTmL glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2097 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to paromomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2096 UPDATE Escherichia coli 16S rRNA mutation in the rrsC gene conferring resistance to kasugamicin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2091 UPDATE Mycobacterium chelonae 16S rRNA mutation conferring resistance to gentamicin C antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2090 UPDATE Mycobacterium abscessus 16S rRNA mutation conferring resistance to kanamycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2093 UPDATE Chlamydophila psittaci 16S rRNA mutation conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2092 UPDATE Enterobacter aerogenes acrR mutation conferring antibiotic resistance efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; gene modulating antibiotic efflux; model_param "UPDATED 3892 with 139-1 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. " 2099 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to kanamycin A antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2098 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to viomycin peptide antibiotic resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 1829 UPDATE CMY-87 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1828 UPDATE GES-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1825 UPDATE CTX-M-27 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1824 UPDATE oleI antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 1827 UPDATE SHV-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1821 UPDATE AAC(6')-Ir antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1820 UPDATE bacA peptide antibiotic resistance protein; gene conferring antibiotic resistance via molecular bypass; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 1823 UPDATE OXY-1-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1822 UPDATE Staphylococcus aureus gyrB conferring resistance to aminocoumarin aminocoumarin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with aminocoumarin resistance protein UPDATED category_aro_description with Point mutations to DNA topoisomerase enzymes clinically shown to confer resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. " 2147 UPDATE Escherichia coli EF-Tu mutants conferring resistance to Enacyloxin IIa antibiotic resistant gene variant or mutant; elfamycin resistance protein; ARO_category "UPDATED category_aro_name with elfamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to elfamycin antibiotics. " 2146 UPDATE Escherichia coli 16S rRNA mutation in the rrnB gene conferring resistance to streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2145 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to tetracycline antibiotic resistant gene variant or mutant; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 2412 UPDATE Shigella flexneri parC conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2143 UPDATE Borrelia burgdorferi 16S rRNA mutation conferring resistance to gentamicin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2142 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to viomycin peptide antibiotic resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 2141 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to neomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2140 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 920 UPDATE TEM-152 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 921 UPDATE OKP-A-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 922 UPDATE AAC(6')-30/AAC(6')-Ib' fusion protein antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 923 UPDATE VIM-25 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 924 UPDATE AAC(6')-33 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 925 UPDATE AAC(3)-IIb antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2149 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to hygromycin B antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2148 UPDATE Ureaplasma urealyticum gyrB conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category; model_param "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. UPDATED 4638 with E502Q UPDATED 4638 with E502Q " 1920 UPDATE vanSF glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1921 UPDATE EreB antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 1922 UPDATE marA efflux pump conferring antibiotic resistance; protein modulating permeability to antibiotic; gene modulating antibiotic efflux; ARO_category "UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 1923 UPDATE APH(3'')-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1924 UPDATE vanM glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1926 UPDATE CMY-34 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1927 UPDATE SHV-29 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1928 UPDATE OXA-50 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1929 UPDATE ACT-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 832 UPDATE SHV-161 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 833 UPDATE CfxA5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 830 UPDATE SHV-157 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 831 UPDATE OKP-B-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 836 UPDATE TEM-68 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 837 UPDATE vatH streptogramin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 834 UPDATE FosA3 antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 835 UPDATE APH(3')-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 838 UPDATE CTX-M-102 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 839 UPDATE CMY-44 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 3 UPDATE Escherichia coli ompF mutants antibiotic resistant gene variant or mutant; beta-lactam resistance protein; protein modulating permeability to antibiotic; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 1987 UPDATE QnrA1 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 784 UPDATE AAC(6')-Iv antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 785 UPDATE OXY-2-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 786 UPDATE vanHO glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 787 UPDATE dfrA23 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 780 UPDATE CARB-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 781 UPDATE QnrB25 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 782 UPDATE OXA-63 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1729 UPDATE CTX-M-66 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1726 UPDATE FOX-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1727 UPDATE SHV-73 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1724 UPDATE vanHM glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1725 UPDATE TEM-101 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 788 UPDATE SHV-46 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1723 UPDATE IMP-44 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1721 UPDATE Mycobacterium leprae dapsone resistant folP mutants antibiotic resistant gene variant or mutant; sulfonamide resistance protein; ARO_category "UPDATED category_aro_name with sulfonamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to sulfonamide antibiotics. " 60 UPDATE QnrS6 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 61 UPDATE OXA-330 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 62 UPDATE CMY-42 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 63 UPDATE AAC(6')-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 64 UPDATE CMY-70 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 65 UPDATE GES-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 66 UPDATE SHV-41 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 67 UPDATE OXA-391 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 68 UPDATE TEM-132 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 69 UPDATE aadA23 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1371 UPDATE CTX-M-26 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1588 UPDATE QnrB50 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1589 UPDATE PER-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 406 UPDATE ACC-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1582 UPDATE dfrA5 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1583 UPDATE QnrVC6 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1580 UPDATE catIII phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1581 UPDATE ACT-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1586 UPDATE CTX-M-32 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1373 UPDATE CMY-26 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1585 UPDATE CMY-73 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 404 UPDATE OXA-217 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 509 UPDATE FOX-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1032 UPDATE OXA-365 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 403 UPDATE dfrA8 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 504 UPDATE TEM-52 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1031 UPDATE APH(6)-Id antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1036 UPDATE vanWB glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 503 UPDATE CTX-M-69 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 500 UPDATE OXA-164 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1035 UPDATE Streptococcus pneumoniae PBP2b conferring resistance to amoxicillin antibiotic resistant gene variant or mutant; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1212 UPDATE OXA-141 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 631 UPDATE TEM-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 632 UPDATE PmrA polymyxin resistance protein; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 633 UPDATE OXA-355 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1216 UPDATE SHV-119 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 635 UPDATE OXA-332 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1214 UPDATE TEM-134 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 637 UPDATE OXY-6-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 638 UPDATE ACT-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 639 UPDATE AAC(3)-IV antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1218 UPDATE TEM-219 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 927 UPDATE OXA-381 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 465 UPDATE vanSO glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1728 UPDATE OXA-42 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 783 UPDATE NDM-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1454 UPDATE CMY-112 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1455 UPDATE IND-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1456 UPDATE IMP-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1457 UPDATE CTX-M-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1102 UPDATE QnrB29 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1103 UPDATE CMY-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1452 UPDATE TEM-216 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1453 UPDATE vanYD glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1458 UPDATE TEM-157 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1459 UPDATE CTX-M-78 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1108 UPDATE Enterococcus faecium liaS mutant conferring daptomycin resistance peptide antibiotic resistance protein; antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. UPDATED category_aro_name with lipopeptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to lipopeptide antibiotics. " 1109 UPDATE CAU-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1722 UPDATE TEM-184 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 789 UPDATE IMP-43 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1577 UPDATE AAC(6')-32 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2136 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to kanamycin A antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2137 UPDATE Escherichia coli EF-Tu mutants conferring resistance to kirromycin antibiotic resistant gene variant or mutant; elfamycin resistance protein; ARO_category "UPDATED category_aro_name with elfamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to elfamycin antibiotics. " 216 UPDATE LEN-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 217 UPDATE vanXA glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 214 UPDATE SHV-121 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 215 UPDATE bcrC peptide antibiotic resistance protein; gene conferring antibiotic resistance via molecular bypass; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 213 UPDATE OXA-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 210 UPDATE SHV-35 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 211 UPDATE TEM-206 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 218 UPDATE npmA antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 219 UPDATE OKP-A-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 956 UPDATE TEM-88 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 4 UPDATE SHV-52 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2396 UPDATE OXA-368 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2397 UPDATE pgpB polymyxin resistance protein; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 2395 UPDATE apmA antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2398 UPDATE TEM-220 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1858 UPDATE OXA-387 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1859 UPDATE QnrVC7 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1850 UPDATE FomB antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 1851 UPDATE KPC-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1852 UPDATE rmtF antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1853 UPDATE OXA-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1854 UPDATE rmtA antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1855 UPDATE CTX-M-72 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1856 UPDATE QnrB20 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1857 UPDATE VIM-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2176 UPDATE glycopeptide resistance gene cluster VanN antibiotic resistance gene cluster, cassette, or operon; model_type; model_description "UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 918 UPDATE TEM-49 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 915 UPDATE SHV-106 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 914 UPDATE ANT(6)-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 917 UPDATE SHV-186 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 916 UPDATE OXA-36 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 911 UPDATE CMY-50 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 910 UPDATE rifampin phosphotransferase rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 913 UPDATE OXY-6-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 912 UPDATE LEN-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 516 UPDATE PmrC polymyxin resistance protein; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 1420 UPDATE aadA5 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1933 UPDATE SHV-160 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1932 UPDATE IMP-32 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1931 UPDATE TEM-150 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1930 UPDATE CTX-M-29 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1937 UPDATE OXA-118 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1936 UPDATE CTX-M-43 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1935 UPDATE Mycobacterium tuberculosis gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category; model_param "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. UPDATED 4589 with D94T UPDATED 4589 with D94T UPDATED 3611 with 39879,G247S+40052,D500N UPDATED 3843 with 39879,A90V+40052,D472H UPDATED param_type_id with 40438 UPDATED param_type with co-dependent single resistance variant UPDATED param_description with A model parameter to describe mutations in multiple genes that are dependent on each other's presence to confer resistance. For example, the G247S SNP in M. tuberculosis gyrA does not confer resistance to fluoroquinolones. However, when the D500N SNP is also present in gyrB, resistance is conferred. In this case, gyrA G247S is co-dependent on gyrB D500N to confer resistance. Notation: [cvterm-id-gene-1],[gene-1-SNP]+[cvterm-id-gene-2],[gene-2-SNP]+ ... +[cvterm-id-gene-n],[gene-n-SNP] e.g. 39879,G247S+40052,D500N UPDATED 3842 with A90V,D94G UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 1934 UPDATE lnuD lincosamide resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. " 1939 UPDATE AAC(6')-Ix antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 847 UPDATE CTX-M-108 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 846 UPDATE DHA-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 845 UPDATE TEM-163 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 844 UPDATE CMY-117 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 843 UPDATE QnrB14 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 842 UPDATE PmrE polymyxin resistance protein; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 841 UPDATE CTX-M-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 840 UPDATE CMY-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 849 UPDATE OXA-138 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 848 UPDATE OKP-A-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1587 UPDATE OXA-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2407 UPDATE Capnocytophaga gingivalis gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1739 UPDATE SHV-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1738 UPDATE CTX-M-45 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1731 UPDATE mphB antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 1730 UPDATE OXA-235 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1733 UPDATE OXA-415 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1732 UPDATE SHV-151 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 662 UPDATE TEM-162 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1734 UPDATE IND-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1737 UPDATE ANT(4')-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1736 UPDATE GES-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1039 UPDATE dfrB3 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 796 UPDATE iri rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 753 UPDATE SMB-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 752 UPDATE vanRM glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 751 UPDATE TEM-217 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 750 UPDATE SHV-172 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 757 UPDATE CMY-80 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 756 UPDATE Enterococcus faecium liaR mutant conferring daptomycin resistance peptide antibiotic resistance protein; antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. UPDATED category_aro_name with lipopeptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to lipopeptide antibiotics. " 755 UPDATE KPC-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 754 UPDATE CTX-M-48 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 759 UPDATE OCH-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 758 UPDATE OXA-198 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1595 UPDATE mecB antibiotic resistance gene cluster, cassette, or operon; beta-lactam resistance protein; antibiotic target replacement protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1594 UPDATE VgbA streptogramin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1597 UPDATE SHV-2A antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1596 UPDATE OXA-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1591 UPDATE CMY-64 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1590 UPDATE QnrB27 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1593 UPDATE CMY-99 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1592 UPDATE dfrA14 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1599 UPDATE SHV-23 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1598 UPDATE OXA-101 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1025 UPDATE TEM-136 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1024 UPDATE AAC(6')-Ib-SK antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1026 UPDATE SHV-74 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1021 UPDATE CTX-M-54 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1020 UPDATE OXA-241 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1023 UPDATE IMP-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1022 UPDATE TEM-28 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 502 UPDATE aadA17 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1029 UPDATE CMY-102 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1028 UPDATE SHV-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1034 UPDATE QnrA7 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 501 UPDATE AAC(3)-VIIIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 605 UPDATE OXA-96 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 604 UPDATE OXA-385 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 607 UPDATE TEM-201 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 606 UPDATE IMI-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 601 UPDATE dfrA20 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 600 UPDATE CMY-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 602 UPDATE VIM-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1205 UPDATE VIM-39 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1207 UPDATE DHA-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1201 UPDATE CARB-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 608 UPDATE OXA-361 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1203 UPDATE Mycobacterium tuberculosis ndh mutant conferring resistance to isoniazid antibiotic resistant gene variant or mutant; isoniazid resistance protein; ARO_category "UPDATED category_aro_name with isoniazid resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to the antibiotic drug, isoniazid. " 1202 UPDATE CTX-M-28 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1211 UPDATE VIM-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1217 UPDATE OXA-139 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 636 UPDATE CFE-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1215 UPDATE FosC antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 1111 UPDATE AAC(6')-Ig antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1110 UPDATE LEN-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1113 UPDATE ANT(6)-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1112 UPDATE OXA-58 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1115 UPDATE OXA-435 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1114 UPDATE ACT-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1117 UPDATE ErmD antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1440 UPDATE CTX-M-103 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1119 UPDATE EBR-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1118 UPDATE OXA-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1351 UPDATE QnrVC1 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1449 UPDATE OXA-59 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1448 UPDATE SHV-26 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1219 UPDATE vanRN glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1357 UPDATE CTX-M-132 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 460 UPDATE CMY-29 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1355 UPDATE TEM-149 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 489 UPDATE Mycobacterium tuberculosis gidB mutation conferring resistance to streptomycin antibiotic target modifying enzyme; antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category; model_param "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. UPDATED 3922 with nt350+1:G UPDATED 3923 with nt115-1:C UPDATED 3924 with nt351+1:G UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. UPDATED 3677 with C52STOP UPDATED param_type_id with 40394 UPDATED param_type with nonsense SNP UPDATED param_description with A SNP that changes an amino acid residue to a STOP codon resulting in a truncated protein product. These mutations are recorded in the format: [wild type amino acid][position][STOP] (e.g. Q42STOP) " 488 UPDATE SHV-156 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 485 UPDATE TEM-191 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1354 UPDATE Mycobacterium tuberculosis embA mutant conferring resistance to ethambutol antibiotic resistant gene variant or mutant; polyamine resistance protein; ARO_category "DELETED 36607 UPDATED category_aro_name with polyamine resistance protein UPDATED category_aro_cvterm_id with 40134 UPDATED category_aro_accession with 3003532 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polyamine antibiotics. " 483 UPDATE GES-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 482 UPDATE LEN-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 481 UPDATE VIM-30 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 480 UPDATE GES-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 199 UPDATE SRT-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 198 UPDATE TEM-138 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 195 UPDATE CTX-M-58 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 194 UPDATE SHV-61 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 197 UPDATE CTX-M-56 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 196 UPDATE Mycobacterium tuberculosis embB mutations conferring resistance to ethambutol antibiotic resistant gene variant or mutant; polyamine resistance protein; ARO_category; model_param "DELETED 36607 UPDATED category_aro_name with polyamine resistance protein UPDATED category_aro_cvterm_id with 40134 UPDATED category_aro_accession with 3003532 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polyamine antibiotics. UPDATED 3592 with A314G,Y322C UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 191 UPDATE OXA-199 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 190 UPDATE OXA-195 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 193 UPDATE TEM-121 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 192 UPDATE CTX-M-38 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1106 UPDATE NDM-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1107 UPDATE PDC-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2383 UPDATE ANT(4')-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1105 UPDATE AAC(3)-VIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2387 UPDATE Erm(47) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 2386 UPDATE CIPa linezolid resistance protein; lincosamide resistance protein; macrolide resistance protein; antibiotic target modifying enzyme; phenicol resistance protein; streptogramin resistance protein; ARO_category; ARO_name "UPDATED category_aro_name with linezolid resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to linezolids. UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. UPDATED ARO_name with cipA " 1450 UPDATE Escherichia coli parC conferring resistance to fluoroquinolone gene involved in self-resistance to antibiotic; antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1451 UPDATE MIR-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1100 UPDATE OXA-245 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1101 UPDATE CTX-M-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 902 UPDATE OXA-92 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 903 UPDATE APH(2'')-Ig antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1849 UPDATE Mycobacterium tuberculosis tlyA mutations conferring resistance to aminoglycosides antibiotic target modifying enzyme; antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category; model_param "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. UPDATED 3917 with nt586-1:G UPDATED 3916 with nt477-1:G UPDATED 3915 with nt400-1:A UPDATED 3913 with nt23-1:A UPDATED 3911 with nt26-1:C UPDATED 3910 with nt310-1:G UPDATED 3909 with nt397+1:C UPDATED 3919 with nt673-2:GT UPDATED 3918 with nt653-1:T UPDATED 3920 with nt758-1:G UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. UPDATED 3835 with Q184STOP UPDATED 3908 with R3STOP UPDATED 3829 with Q22STOP UPDATED 3828 with R18STOP UPDATED param_type_id with 40394 UPDATED param_type with nonsense SNP UPDATED param_description with A SNP that changes an amino acid residue to a STOP codon resulting in a truncated protein product. These mutations are recorded in the format: [wild type amino acid][position][STOP] (e.g. Q42STOP) " 901 UPDATE LCR-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 906 UPDATE CARB-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 904 UPDATE rmtB antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 905 UPDATE CTX-M-93 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1843 UPDATE rmtD antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1842 UPDATE IMI-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 908 UPDATE CTX-M-139 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 909 UPDATE OXA-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1846 UPDATE CTX-M-91 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1845 UPDATE OXA-312 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1844 UPDATE OXA-128 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1908 UPDATE OKP-A-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1909 UPDATE AAC(6')-Iak antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1906 UPDATE CTX-M-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1907 UPDATE vanSA glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1904 UPDATE ACT-32 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1905 UPDATE ACT-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1902 UPDATE OXA-246 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1900 UPDATE ACT-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1901 UPDATE CTX-M-51 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 854 UPDATE CMY-58 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 855 UPDATE TEM-142 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 850 UPDATE OXA-26 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 851 UPDATE Mycobacterium tuberculosis pncA mutations conferring resistance to pyrazinamide antibiotic resistant gene variant or mutant; pyrazinamide resistance protein; ARO_category; model_param "UPDATED category_aro_name with pyrazinamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to the antibiotic drug pyrazinamide. UPDATED 4189 with nt1-11 UPDATED 4188 with nt475+1:C UPDATED 4262 with nt382+2:AG UPDATED 4264 with nt391+2:GG UPDATED 4265 with nt414+1:G UPDATED 4266 with nt465+1:T UPDATED 4261 with nt368+18 UPDATED 4181 with nt28-1:C UPDATED 4183 with nt104-1:C UPDATED 4182 with nt71-1:G UPDATED 4185 with nt416-2:TG UPDATED 4184 with nt391-1:G UPDATED 4186 with nt443-1:G UPDATED 4203 with nt388+9:AGGTCGATG UPDATED 4200 with nt70-1:G UPDATED 4206 with nt267-24 UPDATED 4305 with nt420+1:G UPDATED 4161 with nt84-1:C UPDATED 4288 with nt218+10:CGCATTGCCG UPDATED 4289 with nt386-3:ATG UPDATED 4267 with nt480+4:TGAC UPDATED 4268 with nt532+1:C UPDATED 4250 with nt77-1:G UPDATED 4194 with nt397+1:T UPDATED 4259 with nt452-1:T UPDATED 4258 with nt406-1:G UPDATED 4271 with nt512-1:C UPDATED 4270 with nt392+1:G UPDATED 4302 with nt52+1:G UPDATED 4275 with nt195-68 UPDATED 4251 with nt151-80 UPDATED 4197 with nt403+1:C UPDATED 4253 with nt161-1:C UPDATED 4252 with nt158-1:A UPDATED 4255 with nt341-1:C UPDATED 4254 with nt307-5:TACAG UPDATED 4190 with nt446-8 UPDATED 4191 with nt518-5 UPDATED 4257 with nt386-4:ATGT UPDATED 4256 with nt381-2:GG UPDATED 4260 with nt287+1:T UPDATED 4171 with nt379-11 UPDATED 4277 with nt221+1:G UPDATED 4290 with nt493+1:C UPDATED 4273 with nt407+1:C UPDATED 4304 with nt301-1:G UPDATED 4303 with nt193+1:A UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. UPDATED 4160 with Q10STOP UPDATED 4309 with S88STOP UPDATED 3433 with Y99STOP UPDATED 4243 with Q141STOP UPDATED 3436 with Y41STOP UPDATED 4168 with Y103STOP UPDATED 4238 with W119STOP UPDATED 4230 with W68STOP UPDATED param_type_id with 40394 UPDATED param_type with nonsense SNP UPDATED param_description with A SNP that changes an amino acid residue to a STOP codon resulting in a truncated protein product. These mutations are recorded in the format: [wild type amino acid][position][STOP] (e.g. Q42STOP) UPDATED 4215 with Q10P,Y99D UPDATED 4220 with A25E,A26G,A28D UPDATED 4306 with V130G,nt420+2:GG UPDATED 4285 with D53N,nt349+5:CACTG UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 852 UPDATE QnrB62 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 853 UPDATE OXA-160 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 858 UPDATE IND-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 425 UPDATE TEM-182 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 740 UPDATE QnrB21 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 741 UPDATE CfxA antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 742 UPDATE AAC(3)-Id antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 743 UPDATE arr-3 rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 744 UPDATE vanSL glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 745 UPDATE CMY-40 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 746 UPDATE AAC(2')-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 747 UPDATE QnrA4 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 749 UPDATE SHV-97 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1050 UPDATE AAC(6')-Ii antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1051 UPDATE LEN-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1052 UPDATE OXA-206 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1053 UPDATE SHV-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1055 UPDATE Escherichia coli parE conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1056 UPDATE VIM-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1057 UPDATE CTX-M-114 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1058 UPDATE VIM-27 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1059 UPDATE APH(9)-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1696 UPDATE Salmonella serovars gyrB conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1697 UPDATE TEM-135 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1694 UPDATE OXA-353 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1695 UPDATE DHA-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1692 UPDATE tetM antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 1693 UPDATE TEM-143 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1690 UPDATE OXA-317 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1691 UPDATE CMY-31 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 715 UPDATE PDC-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1698 UPDATE OCH-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1699 UPDATE vanXO glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1278 UPDATE TEM-45 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1279 UPDATE TEM-104 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 619 UPDATE SHV-30 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 612 UPDATE PDC-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1271 UPDATE AAC(6')-Iw antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1272 UPDATE CTX-M-67 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1273 UPDATE otrA antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 616 UPDATE NDM-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 617 UPDATE OXA-147 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 614 UPDATE SFB-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 615 UPDATE OXA-211 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 711 UPDATE SHV-62 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 710 UPDATE dfrB6 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1472 UPDATE DHA-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1473 UPDATE CTX-M-44 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1470 UPDATE QnrB26 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1476 UPDATE TEM-199 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1477 UPDATE SHV-39 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1475 UPDATE SHV-99 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1478 UPDATE CARB-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1479 UPDATE IMP-40 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1304 UPDATE CTX-M-85 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1306 UPDATE IND-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1307 UPDATE OXY-1-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1301 UPDATE Staphylococcus aureus cls conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with lipopeptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to lipopeptide antibiotics. " 1303 UPDATE BEL-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1308 UPDATE vanTE glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1309 UPDATE ACT-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 498 UPDATE QnrB17 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 499 UPDATE vanSB glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1499 UPDATE VEB-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 494 UPDATE KPC-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 495 UPDATE CMY-28 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 496 UPDATE KPC-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 497 UPDATE OXA-79 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 490 UPDATE TEM-188 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 491 UPDATE PER-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 492 UPDATE catB phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 493 UPDATE TEM-84 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 24 UPDATE fusB antibiotic inactivation enzyme; fusidic acid resistance protein; ARO_category "UPDATED category_aro_name with fusidic acid resistance protein UPDATED category_aro_description with Enzymes, other proteins and other gene products shown clinically to confer resistance to fusidic acid. " 25 UPDATE CTX-M-121 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 26 UPDATE VEB-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 27 UPDATE lnuA lincosamide resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. " 20 UPDATE CMY-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 21 UPDATE OXA-329 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 22 UPDATE ACT-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 23 UPDATE OXA-371 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 28 UPDATE OXA-45 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 29 UPDATE Escherichia coli sulfonamide resistant mutant folP antibiotic resistant gene variant or mutant; sulfonamide resistance protein; ARO_category "UPDATED category_aro_name with sulfonamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to sulfonamide antibiotics. " 1516 UPDATE CMY-45 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 7 UPDATE CTX-M-130 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2281 UPDATE Brucella suis mprF antibiotic target modifying enzyme; peptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 2282 UPDATE Clostridium perfringens mprF antibiotic target modifying enzyme; peptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 2283 UPDATE Streptococcus agalactiae mprF antibiotic target modifying enzyme; peptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 2284 UPDATE Escherichia coli mutant murA conferring resistance to fosfomycin fosfomycin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 2375 UPDATE Rm3 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2372 UPDATE Escherichia coli mutant GlpT conferring resistance to fosfomycin fosfomycin resistance protein; antibiotic resistant gene variant or mutant; ARO_category; model_param "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. UPDATED 4324 with 602-20 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. UPDATED 4321 with E448K, G33R UPDATED 4323 with E448K, G302D UPDATED 4322 with E448K, Q444E, E443Q, L297F UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 2373 UPDATE Escherichia coli mutant UhpT conferring resistance to fosfomycin fosfomycin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 591 UPDATE CTX-M-122 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 590 UPDATE IND-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1876 UPDATE LEN-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1877 UPDATE CMY-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1874 UPDATE OXA-196 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1875 UPDATE MIR-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1872 UPDATE vanXYL glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1873 UPDATE linG lincosamide resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. " 1870 UPDATE OXA-66 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1871 UPDATE OXA-389 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1083 UPDATE OXA-323 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1878 UPDATE SRT-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1879 UPDATE AAC(3)-IIIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 977 UPDATE OXA-112 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 976 UPDATE CTX-M-61 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 975 UPDATE QnrB1 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 973 UPDATE OXA-378 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 972 UPDATE CMY-23 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 970 UPDATE OKP-B-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 596 UPDATE ROB-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 979 UPDATE TEM-96 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 978 UPDATE OXA-134 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2119 UPDATE LRA-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 180 UPDATE DHA-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 181 UPDATE GES-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 186 UPDATE OXA-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 187 UPDATE OXA-348 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 184 UPDATE OCH-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 185 UPDATE OXA-232 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2110 UPDATE CARB-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2111 UPDATE Mycobacterium chelonae 16S rRNA mutation conferring resistance to tobramycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 188 UPDATE SHV-89 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2113 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to tobramycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2114 UPDATE APH(3')-IIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2115 UPDATE TEM-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2116 UPDATE Pasteurella multocida 16S rRNA mutation conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2117 UPDATE AAC(6')-Ib7 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1919 UPDATE SHV-27 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1918 UPDATE spd antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1911 UPDATE AAC(6')-Iad antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1910 UPDATE CTX-M-136 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1913 UPDATE dfrK antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1912 UPDATE LRA-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1915 UPDATE CMY-47 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1914 UPDATE BEL-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1916 UPDATE TEM-208 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 868 UPDATE DHA-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_description; ARO_category "UPDATED ARO_description with DHA-1 is a class C beta-lactamase found in Morganella morganii and Salmonella enterica UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 189 UPDATE CTX-M-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 861 UPDATE OXA-215 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 860 UPDATE TEM-42 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 863 UPDATE PER-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 862 UPDATE IMP-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 865 UPDATE OXA-244 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 864 UPDATE CMY-61 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 867 UPDATE OXA-175 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2024 UPDATE ACC-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2025 UPDATE TEM-57 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2026 UPDATE OXA-84 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2027 UPDATE CMY-84 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2020 UPDATE tetO antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 2021 UPDATE SHV-165 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2022 UPDATE CTX-M-104 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2023 UPDATE OXA-132 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2028 UPDATE QnrB43 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2029 UPDATE TEM-123 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 656 UPDATE OXA-219 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 883 UPDATE LRA-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 882 UPDATE NPS beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 881 UPDATE ErmC antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 880 UPDATE APH(6)-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 887 UPDATE SHV-33 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 886 UPDATE IND-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 885 UPDATE TEM-63 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 884 UPDATE CTX-M-99 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 889 UPDATE CMY-74 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 888 UPDATE Erm(36) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 775 UPDATE CMY-113 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 774 UPDATE tet37 antibiotic inactivation enzyme; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 776 UPDATE tetX antibiotic inactivation enzyme; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 771 UPDATE CMY-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 770 UPDATE SHV-57 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 773 UPDATE OCH-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 772 UPDATE LEN-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 779 UPDATE OXA-350 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 778 UPDATE IMP-25 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 77 UPDATE TEM-47 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 76 UPDATE SHV-79 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 75 UPDATE fusH antibiotic inactivation enzyme; fusidic acid resistance protein; ARO_category "UPDATED category_aro_name with fusidic acid resistance protein UPDATED category_aro_description with Enzymes, other proteins and other gene products shown clinically to confer resistance to fusidic acid. " 74 UPDATE SHV-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 73 UPDATE OXA-35 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 72 UPDATE SHV-42 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 71 UPDATE QnrB66 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 70 UPDATE NDM-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 79 UPDATE VIM-37 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 78 UPDATE TEM-16 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1043 UPDATE SHV-76 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1042 UPDATE catB7 phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1040 UPDATE OXA-95 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1047 UPDATE catS phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1045 UPDATE ErmO antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1044 UPDATE CTX-M-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1049 UPDATE MOX-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1048 UPDATE QnrB33 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1681 UPDATE APH(4)-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1683 UPDATE QnrB67 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1682 UPDATE aadA24 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1685 UPDATE SHV-40 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1684 UPDATE LEN-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1687 UPDATE CEPH-A3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1686 UPDATE OXA-34 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1689 UPDATE vanRO glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1688 UPDATE CTX-M-90 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1269 UPDATE OXA-192 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1268 UPDATE CMY-115 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 669 UPDATE MIR-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 668 UPDATE CTX-M-65 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 667 UPDATE ACT-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 666 UPDATE CTX-M-34 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 665 UPDATE TEM-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 664 UPDATE CMY-43 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 663 UPDATE ACT-36 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1266 UPDATE ANT(4')-IIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 661 UPDATE VIM-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 660 UPDATE Streptococcus pneumoniae parC conferring resistance to fluoroquinolone gene involved in self-resistance to antibiotic; antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1469 UPDATE facT efflux pump conferring antibiotic resistance; elfamycin resistance protein; ARO_category "UPDATED category_aro_name with elfamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to elfamycin antibiotics. " 1468 UPDATE SHV-135 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1465 UPDATE SHV-181 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 8 UPDATE NDM-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1467 UPDATE LEN-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1466 UPDATE SHV-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1461 UPDATE SHV-63 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1460 UPDATE FosB3 antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 1463 UPDATE GES-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 521 UPDATE OXA-386 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1317 UPDATE CTX-M-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1316 UPDATE catB6 phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1314 UPDATE OXA-214 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1312 UPDATE OXA-111 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1311 UPDATE OXY-5-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1310 UPDATE IMP-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1319 UPDATE SHV-147 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1010 UPDATE TEM-209 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 529 UPDATE SHV-185 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 319 UPDATE OXA-366 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 318 UPDATE OXA-358 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 313 UPDATE OXA-143 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 312 UPDATE OXA-167 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 311 UPDATE IND-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 310 UPDATE SHV-78 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 317 UPDATE TEM-148 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 316 UPDATE CTX-M-36 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 315 UPDATE DHA-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 314 UPDATE TEM-176 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1335 UPDATE QnrB8 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1030 UPDATE vanZA glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1331 UPDATE CTX-M-52 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 445 UPDATE TEM-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 444 UPDATE AAC(6')-Ib-Suzhou antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2298 UPDATE SPM-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2292 UPDATE Streptomyces rishiriensis parY mutant conferring resistance to aminocoumarin gene involved in self-resistance to antibiotic; aminocoumarin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with aminocoumarin resistance protein UPDATED category_aro_description with Point mutations to DNA topoisomerase enzymes clinically shown to confer resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. " 2291 UPDATE Chlamydia trachomatis murA fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 2290 UPDATE Mycobacterium tuberculosis murA fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 2294 UPDATE Campylobacter jejuni gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1521 UPDATE VIM-32 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1861 UPDATE LEN-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1860 UPDATE OXA-165 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1863 UPDATE VIM-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1862 UPDATE OXA-109 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1865 UPDATE ACC-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1864 UPDATE CMY-67 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1867 UPDATE CTX-M-116 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1866 UPDATE KPC-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1869 UPDATE OXY-2-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1868 UPDATE TEM-82 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 964 UPDATE OXA-129 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 965 UPDATE OXA-333 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 966 UPDATE vanSC glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 967 UPDATE AAC(6')-Isa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 960 UPDATE TEM-137 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 961 UPDATE SHV-93 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 962 UPDATE OXA-356 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 963 UPDATE CMY-69 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 968 UPDATE MIR-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 969 UPDATE VEB-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2109 UPDATE Mycobacterium tuberculosis gyrB mutant conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category; model_param "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. UPDATED 3610 with 39879,G247S+40052,D500N UPDATED 3846 with 39879,A90V+40052,D472H UPDATED param_type_id with 40438 UPDATED param_type with co-dependent single resistance variant UPDATED param_description with A model parameter to describe mutations in multiple genes that are dependent on each other's presence to confer resistance. For example, the G247S SNP in M. tuberculosis gyrA does not confer resistance to fluoroquinolones. However, when the D500N SNP is also present in gyrB, resistance is conferred. In this case, gyrA G247S is co-dependent on gyrB D500N to confer resistance. Notation: [cvterm-id-gene-1],[gene-1-SNP]+[cvterm-id-gene-2],[gene-2-SNP]+ ... +[cvterm-id-gene-n],[gene-n-SNP] e.g. 39879,G247S+40052,D500N UPDATED 3512 with R485C,T546M UPDATED 3464 with R485C,T539N UPDATED 3463 with N538D,T546M UPDATED 3506 with N538T,T546M UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 2108 UPDATE Enterococcus faecium EF-Tu mutants conferring resistance to GE2270A antibiotic resistant gene variant or mutant; elfamycin resistance protein; ARO_category "UPDATED category_aro_name with elfamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to elfamycin antibiotics. " 2103 UPDATE SHV-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2102 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsB gene conferring resistance to hygromycin B antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2100 UPDATE Mycobacterium chelonae 16S rRNA mutation conferring resistance to amikacin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2106 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to kanamycin A antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2105 UPDATE Mycobacterium abscessus 16S rRNA mutation conferring resistance to neomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2104 UPDATE Ureaplasma urealyticum parC conferring resistance to fluoroquinolone gene involved in self-resistance to antibiotic; antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category; model_param "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. UPDATED 4636 with E87Q UPDATED 4636 with E87Q " 641 UPDATE CARB-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 878 UPDATE CTX-M-142 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 879 UPDATE TEM-185 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 877 UPDATE SHV-124 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 874 UPDATE AAC(1) antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 875 UPDATE dfrA19 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 872 UPDATE vatC streptogramin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 873 UPDATE KPC-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 871 UPDATE CGB-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2037 UPDATE tetT antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 2036 UPDATE SHV-163 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2035 UPDATE CTX-M-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 642 UPDATE aadA25 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2032 UPDATE CTX-M-62 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2031 UPDATE OXA-173 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2030 UPDATE AAC(3)-IXa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 9 UPDATE ACT-35 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 645 UPDATE mecR1 antibiotic resistance gene cluster, cassette, or operon; antibiotic target replacement protein; beta-lactam resistance protein; gene modulating beta-lactam resistance; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2039 UPDATE CARB-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2038 UPDATE KPC-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 890 UPDATE SHV-53 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 891 UPDATE QnrB37 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 892 UPDATE APH(6)-Ic antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 893 UPDATE linA lincosamide resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. " 894 UPDATE CMY-90 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 895 UPDATE SHV-122 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 896 UPDATE CTX-M-131 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 897 UPDATE OXA-383 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 898 UPDATE VEB-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 899 UPDATE OXA-94 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1530 UPDATE OXA-67 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1249 UPDATE FOX-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1537 UPDATE GES-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1616 UPDATE CTX-M-152 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 422 UPDATE FOX-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1965 UPDATE LEN-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1788 UPDATE ACT-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1789 UPDATE QnrB44 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 768 UPDATE SHV-43 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1967 UPDATE OXA-116 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 265 UPDATE SHV-128 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1780 UPDATE OXA-146 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1781 UPDATE AAC(2')-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 760 UPDATE TEM-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 761 UPDATE GES-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1784 UPDATE OXA-334 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1785 UPDATE TEM-48 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 764 UPDATE FOX-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1613 UPDATE CMY-38 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1962 UPDATE OXA-47 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1963 UPDATE TEM-190 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1078 UPDATE VIM-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1079 UPDATE OXA-161 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1076 UPDATE IMP-37 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1077 UPDATE OXA-420 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1074 UPDATE LEN-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1075 UPDATE TEM-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1072 UPDATE OXA-37 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1073 UPDATE OKP-B-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1070 UPDATE sul1 antibiotic target replacement protein; sulfonamide resistance protein; ARO_category "UPDATED category_aro_name with sulfonamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to sulfonamide antibiotics. " 1071 UPDATE DHA-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1678 UPDATE AAC(6')-Ib-cr antibiotic inactivation enzyme; aminoglycoside resistance protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1679 UPDATE OXA-49 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1674 UPDATE AAC(6')-It antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1675 UPDATE CTX-M-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1676 UPDATE GES-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1677 UPDATE cepA beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1671 UPDATE Salmonella serovars soxS mutants efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; protein modulating permeability to antibiotic; gene modulating antibiotic efflux; ARO_category "UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 1672 UPDATE TEM-211 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1673 UPDATE QnrA6 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1094 UPDATE CARB-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1095 UPDATE SHV-59 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1096 UPDATE TEM-79 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1097 UPDATE Erm(38) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1090 UPDATE TEM-169 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 679 UPDATE SHV-108 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1093 UPDATE AAC(6')-31 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 674 UPDATE OXA-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 675 UPDATE OXA-25 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 676 UPDATE AAC(6')-Ih antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 677 UPDATE OXA-171 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 670 UPDATE IND-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1099 UPDATE OXA-48 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 672 UPDATE CMY-27 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 673 UPDATE IMP-48 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1418 UPDATE DHA-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1419 UPDATE OXA-454 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1410 UPDATE OXA-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1411 UPDATE OXA-62 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1412 UPDATE SHV-167 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1413 UPDATE OXA-172 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1414 UPDATE QnrB15 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1415 UPDATE AAC(2')-Id antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1416 UPDATE OXA-89 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1417 UPDATE OXA-131 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1322 UPDATE SHV-65 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1323 UPDATE Salmonella serovars parE conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1320 UPDATE Klebsiella mutant PhoP conferring antibiotic resistance to colistin efflux pump conferring antibiotic resistance; polymyxin resistance protein; antibiotic resistant gene variant or mutant; gene modulating antibiotic efflux; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 1532 UPDATE OXA-249 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1326 UPDATE OXA-170 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1327 UPDATE AAC(6')-Iq antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1324 UPDATE LRA-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1325 UPDATE OXA-65 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1328 UPDATE vanSM glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1329 UPDATE ANT(4')-IIb antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1531 UPDATE TEM-81 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1620 UPDATE CTX-M-156 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1524 UPDATE cat-TC phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1525 UPDATE TEM-160 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1254 UPDATE CTX-M-46 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1255 UPDATE OXA-119 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1520 UPDATE SHV-85 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1253 UPDATE GES-23 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1522 UPDATE IMP-38 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1251 UPDATE CTX-M-157 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1528 UPDATE TEM-168 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1529 UPDATE TEM-130 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1258 UPDATE OXA-55 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1259 UPDATE SHV-31 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 308 UPDATE CMY-118 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 309 UPDATE CMY-35 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 300 UPDATE AAC(6')-29a antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 301 UPDATE CMY-95 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 302 UPDATE TEM-207 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 303 UPDATE ErmQ antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 304 UPDATE IND-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 305 UPDATE chrB antibiotic target modifying enzyme; gene involved in self-resistance to antibiotic; macrolide resistance protein; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 306 UPDATE SHV-32 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 307 UPDATE CTX-M-101 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 473 UPDATE mphE antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " _timestamp N/A N/A N/A N/A NEW: 2017-02-06T14:52:56+00:00 , OLD: 2016-12-05T20:10:01+00:00 985 UPDATE ErmA antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 114 UPDATE dfrA13 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1898 UPDATE OXA-379 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1899 UPDATE vanYF glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1895 UPDATE CfxA3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1896 UPDATE NDM-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1443 UPDATE CARB-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1890 UPDATE TEM-86 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1891 UPDATE AAC(6')-Iih antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1892 UPDATE OXA-114a antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1893 UPDATE SHV-127 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 959 UPDATE OXA-64 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 958 UPDATE OXA-418 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2134 UPDATE CMY-36 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2135 UPDATE ACT-33 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2132 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to kanamycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2133 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to viomycin peptide antibiotic resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 2131 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 951 UPDATE ACT-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 950 UPDATE ErmX antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 952 UPDATE sul2 antibiotic target replacement protein; sulfonamide resistance protein; ARO_category "UPDATED category_aro_name with sulfonamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to sulfonamide antibiotics. " 955 UPDATE SHV-96 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 954 UPDATE APH(3')-IIb antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2138 UPDATE NmcA beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2139 UPDATE vanSD glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2002 UPDATE cat86 phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 2000 UPDATE TEM-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2001 UPDATE OXA-250 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2006 UPDATE IMP-27 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2007 UPDATE OXA-335 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2004 UPDATE TEM-189 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2005 UPDATE CTX-M-89 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2008 UPDATE SHV-145 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2009 UPDATE aadA6 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 506 UPDATE IMP-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1544 UPDATE dfrE antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1263 UPDATE QnrB56 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1262 UPDATE SHV-149 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 919 UPDATE PER-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2177 UPDATE glycopeptide resistance gene cluster VanA antibiotic resistance gene cluster, cassette, or operon; ARO_description; model_type; model_description "UPDATED ARO_description with This inducible cluster confers high resistance to both vancomycin and teicoplanin by allowing restructuring of peptidoglycan precursors to end in D-Ala-D-Lac. The vanA gene cluster can be located either on plasmids or on the chromosome.Gene orientation: vanRSHAXYZ UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 1799 UPDATE TEM-147 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1798 UPDATE SHV-183 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 719 UPDATE CMY-33 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 718 UPDATE LRA-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 717 UPDATE CTX-M-100 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1267 UPDATE QnrB40 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1791 UPDATE TEM-164 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 714 UPDATE dfrB1 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1797 UPDATE ErmY antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 712 UPDATE catB2 phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1795 UPDATE VEB-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1794 UPDATE tmrB nucleoside resistance protein; protein modulating permeability to antibiotic; ARO_category "UPDATED category_aro_name with nucleoside resistance protein UPDATED category_aro_cvterm_id with 40980 UPDATED category_aro_accession with 3004027 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to nucleoside antibiotics, including aminonucleosides. UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_cvterm_id with 36409 UPDATED category_aro_accession with 3000270 UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 1265 UPDATE MIR-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 716 UPDATE QnrB32 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 505 UPDATE Mycobacterium tuberculosis iniC mutant conferring resistance to ethambutol efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; polyamine resistance protein; ARO_category; model_param "DELETED 36607 UPDATED category_aro_name with polyamine resistance protein UPDATED category_aro_cvterm_id with 40134 UPDATED category_aro_accession with 3003532 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polyamine antibiotics. UPDATED 3531 with 98+1:A UPDATED 3532 with 79+1:T UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. UPDATED 3530 with Q351STOP UPDATED param_type_id with 40394 UPDATED param_type with nonsense SNP UPDATED param_description with A SNP that changes an amino acid residue to a STOP codon resulting in a truncated protein product. These mutations are recorded in the format: [wild type amino acid][position][STOP] (e.g. Q42STOP) " 2178 UPDATE glycopeptide resistance gene cluster VanO antibiotic resistance gene cluster, cassette, or operon; model_type; model_description "UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 1069 UPDATE IMP-35 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1068 UPDATE AAC(6')-Ib3 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2179 UPDATE glycopeptide resistance gene cluster VanE antibiotic resistance gene cluster, cassette, or operon; model_type; model_description "UPDATED model_type with gene cluster model UPDATED model_description with A meta-model to detect a defined gene cluster based on gene detection by other models. " 1061 UPDATE OXY-2-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1060 UPDATE SHV-103 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1063 UPDATE QnrB73 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1062 UPDATE SHV-71 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1065 UPDATE OXA-384 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1064 UPDATE CTX-M-141 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1066 UPDATE TEM-118 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1669 UPDATE vanZF glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1668 UPDATE CMY-68 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1667 UPDATE TEM-80 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1666 UPDATE vanXB glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1665 UPDATE ramA efflux pump conferring antibiotic resistance; protein modulating permeability to antibiotic; gene modulating antibiotic efflux; ARO_category "UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 1663 UPDATE ACC-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1662 UPDATE OKP-B-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1661 UPDATE CARB-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1660 UPDATE OXA-375 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1087 UPDATE OXA-253 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1086 UPDATE CMY-41 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1085 UPDATE OKP-B-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1084 UPDATE LEN-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 595 UPDATE SHV-75 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 594 UPDATE QnrB41 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1081 UPDATE IMP-30 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1080 UPDATE SHV-158 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 599 UPDATE OKP-A-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 598 UPDATE dfrA16 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1089 UPDATE CMY-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1088 UPDATE Staphylococcus aureus rpoB mutants conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with lipopeptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to lipopeptide antibiotics. " 1526 UPDATE AAC(6')-Iaa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 713 UPDATE CTX-M-81 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1409 UPDATE CMY-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1408 UPDATE TEM-124 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1403 UPDATE OXA-388 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1402 UPDATE OXA-390 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1400 UPDATE CTX-M-74 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1407 UPDATE CMY-62 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1406 UPDATE OXA-121 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1405 UPDATE armA antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1404 UPDATE IMP-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 692 UPDATE TEM-159 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 449 UPDATE SHV-133 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 448 UPDATE dfrG antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1339 UPDATE Mycobacterium tuberculosis embR mutant conferring resistance to ethambutol antibiotic resistant gene variant or mutant; polyamine resistance protein; ARO_category "DELETED 36607 UPDATED category_aro_name with polyamine resistance protein UPDATED category_aro_cvterm_id with 40134 UPDATED category_aro_accession with 3003532 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polyamine antibiotics. " 1338 UPDATE BLA1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 693 UPDATE OXA-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 443 UPDATE OKP-B-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1334 UPDATE SHV-126 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 441 UPDATE OXA-54 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1336 UPDATE BcII antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 447 UPDATE SHV-67 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 446 UPDATE catB8 phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1333 UPDATE vanHD glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1332 UPDATE APH(3')-IIIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1545 UPDATE Escherichia coli gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category; model_param "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. UPDATED 3328 with S83L,D87Y UPDATED 3329 with S83L,D87N UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 1543 UPDATE CMY-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 39 UPDATE AAC(3)-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 38 UPDATE APH(3')-Va antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1540 UPDATE rmtC antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 32 UPDATE DHA-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 31 UPDATE CTX-M-155 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 30 UPDATE OXA-226 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 36 UPDATE Mycobaterium leprae gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 35 UPDATE FosA2 antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 34 UPDATE OXY-6-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1241 UPDATE TEM-144 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1536 UPDATE OXA-421 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1243 UPDATE mphA antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 1534 UPDATE PER-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1533 UPDATE SHV-143 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1244 UPDATE OXY-5-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1247 UPDATE CMY-72 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1246 UPDATE AAC(2')-Ic antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 649 UPDATE OXA-115 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 648 UPDATE GES-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1539 UPDATE aadA3 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1538 UPDATE SHV-104 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 339 UPDATE ANT(3'')-Ii-AAC(6')-IId fusion protein antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 338 UPDATE OXY-1-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 335 UPDATE Staphylococcus aureus parE conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 337 UPDATE Enterococcus faecium adeC efflux pump conferring antibiotic resistance; ARO_id; model_sequences; ARO_accession; model_param; ARO_name "UPDATED ARO_id with 40499 UPDATED fmax with 2065140 UPDATED strand with + UPDATED accession with CP013924.1 UPDATED fmin with 2063742 UPDATED sequence with ATGTCTAAATCGACAATCGTATCTCGTGGACTCATTCTTTCTACACTCTCAATTGCACTCGTTGCATGTGTCAATATGCAAGCGCCACAGCCTGCAATTACATCTCATATTCCTCAAAATTTTAGTCAAAATCATTCTGGAAAAATGATTGCAGAAAAAAGTTATAAAGAATTTATTTCTGATCCGAAATTATTACAGGTCATTGAAATCAGTTTAAATAACAACCGTGATTTACGGACTGCTACGCTTAATATTGAACGTGTACAGCAAGAATACCAAATCACAAAAAATAGCCAGCTCCCAACCATTGGTGTAACGGGAAATGCAGTGCGGCAGGTTAGCCCATCGATTAACCCCAATAACCCAGTTTCTACATTTCAAGTTGGCTTGGGAATGACTGCCTATGAGCTAGATTTTTGGGGCCGTGTTCAAAATTTAAAAGATGCTGCATTAAATAACTATCTTGCAACTCAAAGTGCAAAAGAAGCTGTACAAATTGGTTTAATCAGTAATATTACACAGGTCTGGTTAAATTATGCTTTTGCACAAGCAAATTTAAACCTTGCCGAGCAAACCTTAAAAGCACAAGTCGATGCTTATAACCTTAACAAGAAGCGCTTTGATGTTGGTATTGATAGTGAAGTGCCATTAAAACAAGCACAAATTTCGGTAGAGACTGCTCGAAATGATGTTGCAACTTATAAAACTCAAATTCAACAGGCAAAAAATTTACTGGATTTGTTAGCAGGTCATCCTGTTCCGCAAAATTTACTTCCGGATCATGCTATTCAAAATATTACCTTTGAGAAAAACTTTGCAGCCGGTTTACCAAGTGATTTATTAAATCATCGTCCAGACCTTAAAGCTGCCGAATATGAGTTACGTGTTGCAGGAGCAAATATTGGTGCTGCTAAAGCACGGATGTTCCCAACCATAAGCTTGACAGGCTCGACGGGTTATGCATCATCTGAACTGAAAGATTTATTTAAAACAGGCAATTTTGCATGGTCGATTGGACCTAATATCGATCTACCAATTTTTGATTGGGGAACAAGAAAAACTAATATTAAAATTGCGGAAACTGACCAGAAAATTGCTTTAGCTAAATATGAAAAAGCCATTCAATCAGCTTTTCGTGAAGTTAATGATGCACTTGCTACACATGCACATATTGGTGAACGATTAGACGCTCAGCGTCGCTTAGTCTCTGCGACTGCTGCAACCTATAAACTCTCAATGGCACGTTACAAAGCTGGAGTGGATAGTTATTTTACGGTTTTAGATGCTCAGCGTTCTGCTTATGCTGCACAACAAGGCTTACTTGCACTTGAACAAATAAAATTAAATAACCAAATTGAAATTTATAAAGTTTTAGGAGGAGGAATATCAAAAGTCTAA UPDATED NCBI_taxonomy_name with Acinetobacter baumannii UPDATED NCBI_taxonomy_id with 470 UPDATED NCBI_taxonomy_cvterm_id with 35507 UPDATED GI with ALX99516.1 UPDATED sequence with MSKSTIVSRGLILSTLSIALVACVNMQAPQPAITSHIPQNFSQNHSGKMIAEKSYKEFISDPKLLQVIEISLNNNRDLRTATLNIERVQQEYQITKNSQLPTIGVTGNAVRQVSPSINPNNPVSTFQVGLGMTAYELDFWGRVQNLKDAALNNYLATQSAKEAVQIGLISNITQVWLNYAFAQANLNLAEQTLKAQVDAYNLNKKRFDVGIDSEVPLKQAQISVETARNDVATYKTQIQQAKNLLDLLAGHPVPQNLLPDHAIQNITFEKNFAAGLPSDLLNHRPDLKAAEYELRVAGANIGAAKARMFPTISLTGSTGYASSELKDLFKTGNFAWSIGPNIDLPIFDWGTRKTNIKIAETDQKIALAKYEKAIQSAFREVNDALATHAHIGERLDAQRRLVSATAATYKLSMARYKAGVDSYFTVLDAQRSAYAAQQGLLALEQIKLNNQIEIYKVLGGGISKV UPDATED ARO_accession with 3003811 UPDATED param_value with 2000 UPDATED param_type_id with 40725 UPDATED param_type with BLASTP bit-score UPDATED param_description with A score is a numerical value that describes the overall quality of an alignment. Higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (λ × S − lnK)/ ln2 where λ is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. UPDATED ARO_name with adeC " 336 UPDATE tlrB conferring tylosin resistance antibiotic target modifying enzyme; gene involved in self-resistance to antibiotic; macrolide resistance protein; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 331 UPDATE TEM-166 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 330 UPDATE IMP-26 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 333 UPDATE CARB-23 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 332 UPDATE r39 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 545 UPDATE GES-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1464 UPDATE aadA7 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1636 UPDATE QnrB57 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1462 UPDATE LRA-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1352 UPDATE OXA-251 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1350 UPDATE TEM-93 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1889 UPDATE NDM-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1888 UPDATE MIR-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1887 UPDATE TEM-70 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1886 UPDATE LEN-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1884 UPDATE CTX-M-111 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1883 UPDATE DHA-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1882 UPDATE OXA-80 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1881 UPDATE OXA-72 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2121 UPDATE LRA-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2122 UPDATE Mycobacterium chelonae 16S rRNA mutation conferring resistance to neomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2124 UPDATE Clostridium difficile EF-Tu mutants conferring resistance to elfamycin antibiotic resistant gene variant or mutant; elfamycin resistance protein; ARO_category "UPDATED category_aro_name with elfamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to elfamycin antibiotics. " 948 UPDATE mecI antibiotic resistance gene cluster, cassette, or operon; antibiotic target replacement protein; beta-lactam resistance protein; gene modulating beta-lactam resistance; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2126 UPDATE Mycobacterium abscessus 16S rRNA mutation conferring resistance to tobramycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2129 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2128 UPDATE Mycobacterium abscessus 16S rRNA mutation conferring resistance to gentamicin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 942 UPDATE OXA-104 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 943 UPDATE vanU glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 940 UPDATE TEM-125 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 941 UPDATE GES-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2410 UPDATE Salmonella enterica parC conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 133 UPDATE arr-8 rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 132 UPDATE TEM-198 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 131 UPDATE CTX-M-50 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 130 UPDATE CTX-M-112 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 137 UPDATE APH(2'')-Ie antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 136 UPDATE CMY-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 135 UPDATE SME-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 134 UPDATE rgt1438 rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 139 UPDATE QnrB10 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2019 UPDATE OXA-213 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2018 UPDATE CMY-76 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2015 UPDATE DHA-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2014 UPDATE PmrF polymyxin resistance protein; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 2017 UPDATE CTX-M-37 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2016 UPDATE OXA-370 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2011 UPDATE QnrB60 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2010 UPDATE CTX-M-129 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2013 UPDATE Erm(41) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 2012 UPDATE SHV-178 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 158 UPDATE myrA antibiotic target modifying enzyme; gene involved in self-resistance to antibiotic; macrolide resistance protein; ARO_category "UPDATED category_aro_name with gene involved in self-resistance to antibiotic UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 708 UPDATE CTX-M-49 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 709 UPDATE TEM-213 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 705 UPDATE CMY-116 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 706 UPDATE APH(7'')-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 707 UPDATE AIM-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 700 UPDATE ACT-31 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 701 UPDATE SHV-129 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 702 UPDATE CTX-M-98 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 703 UPDATE cmlv phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 88 UPDATE CMY-55 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 89 UPDATE vanYA glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 82 UPDATE PER-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 83 UPDATE IMP-47 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 80 UPDATE ACT-29 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 81 UPDATE FOX-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 86 UPDATE TEM-102 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 87 UPDATE TEM-116 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 84 UPDATE GIM-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 85 UPDATE IMP-42 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 762 UPDATE CTX-M-55 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1658 UPDATE OKP-B-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1659 UPDATE OXA-258 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1652 UPDATE IMP-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1653 UPDATE AAC(6')-Ip antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1650 UPDATE CMY-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1651 UPDATE AAC(6')-If antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1656 UPDATE CTX-M-79 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1657 UPDATE AAC(6')-IIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1654 UPDATE SHV-95 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1655 UPDATE TEM-117 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 586 UPDATE VIM-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 587 UPDATE TEM-73 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 584 UPDATE aadA21 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 585 UPDATE NDM-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 582 UPDATE FOX-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 583 UPDATE SHV-100 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 580 UPDATE TEM-110 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 581 UPDATE QnrB19 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1632 UPDATE CTX-M-53 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 588 UPDATE OKP-A-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 589 UPDATE TEM-145 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1633 UPDATE catQ phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1634 UPDATE CMY-78 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1635 UPDATE vanRG glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1436 UPDATE TEM-40 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1434 UPDATE Erm(35) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1432 UPDATE Mycobacterium tuberculosis mutant embC conferring resistance to ethambutol antibiotic resistant gene variant or mutant; polyamine resistance protein; ARO_category; model_param "DELETED 36607 UPDATED category_aro_name with polyamine resistance protein UPDATED category_aro_cvterm_id with 40134 UPDATED category_aro_accession with 3003532 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polyamine antibiotics. UPDATED 4138 with Y296S,R302G UPDATED 4139 with V287F,Y309N UPDATED 4129 with A244T,G288W,V303G UPDATED 4128 with I297L,W326R UPDATED 4130 with T270I,I297T UPDATED 4131 with V287F,T309N UPDATED 4132 with L251R,A254G,T270I UPDATED 4133 with G288V,M310K,Y327N UPDATED 4134 with T270I,G288W,V303G UPDATED 4140 with A247P,I297L,W326R UPDATED 4136 with G272S,H285Y,M300R,A307T UPDATED 4135 with G288W,V303G UPDATED 4141 with T270I,Y296H,G308D,G325S UPDATED 4137 with A247P,T270I,I297T UPDATED param_type_id with 40330 UPDATED param_type with multiple resistance variants UPDATED param_description with A parameter to describe the gene and the mapped mutation(s) within that gene. The parameter is described by the CVterm ID and the mutation(s) with format [wild-type][position][mutation], separated by commas. " 1433 UPDATE CMY-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1430 UPDATE SHV-125 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1431 UPDATE GES-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1380 UPDATE TEM-193 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1637 UPDATE MOX-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1438 UPDATE SHV-19 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1439 UPDATE SHV-80 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1260 UPDATE APH(3')-IVa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1349 UPDATE IND-2a antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 450 UPDATE OXA-51 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 451 UPDATE LRA-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1342 UPDATE plasmid encoded cat (pp-cat) phenicol resistance protein; antibiotic inactivation enzyme; ARO_category; ARO_name "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. UPDATED ARO_name with plasmid-encoded cat (pp-cat) " 1343 UPDATE OXA-166 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 454 UPDATE KPC-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 455 UPDATE vanC glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1346 UPDATE SHV-94 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1347 UPDATE OXA-425 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1377 UPDATE CTX-M-60 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1082 UPDATE CTX-M-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 517 UPDATE QnrD2 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1502 UPDATE OXA-209 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1503 UPDATE LEN-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 654 UPDATE dfrA26 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1501 UPDATE CMY-49 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1506 UPDATE ACT-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 653 UPDATE AAC(3)-VIIa antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 650 UPDATE aadA antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1505 UPDATE sat-4 nucleoside resistance protein; antibiotic inactivation enzyme; ARO_description; ARO_category; ARO_name "UPDATED ARO_description with SAT-4 is a plasmid-mediated streptothricin acetyltransferase and streptothricin (a nucleoside antibiotic) resistant determinant. Originally described from a Campylobacter coli BE/G4 plasmid gene sequence by Jacob et al, 1994. DELETED 37248 UPDATED category_aro_name with nucleoside resistance protein UPDATED category_aro_cvterm_id with 40980 UPDATED category_aro_accession with 3004027 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to nucleoside antibiotics, including aminonucleosides. UPDATED ARO_name with SAT-4 " 1508 UPDATE QnrA2 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1509 UPDATE vanXF glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 658 UPDATE CMY-104 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 659 UPDATE AAC(6')-29b antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2127 UPDATE Borrelia burgdorferi 16S rRNA mutation conferring resistance to kanamycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 949 UPDATE CTX-M-77 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 946 UPDATE QnrB48 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 947 UPDATE OXA-100 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 765 UPDATE QnrB7 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1292 UPDATE CTX-M-109 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1376 UPDATE MOX-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 322 UPDATE FEZ-1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 323 UPDATE aadA9 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 320 UPDATE Streptococcus pneumoniae PBP2x conferring resistance to amoxicillin antibiotic resistant gene variant or mutant; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 321 UPDATE CTX-M-35 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 326 UPDATE OXA-225 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 327 UPDATE GES-17 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 324 UPDATE QnrB54 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 325 UPDATE LEN-23 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 329 UPDATE CTX-M-159 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2330 UPDATE leuO sulfonamide resistance protein; gene modulating antibiotic efflux; ARO_category "UPDATED category_aro_name with sulfonamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to sulfonamide antibiotics. " 2331 UPDATE kdpE aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2332 UPDATE mfd antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2333 UPDATE LEN-26 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2335 UPDATE ADC-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1341 UPDATE OXA-53 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2482 UPDATE Chlamydomonas reinhardtii 16S rRNA mutation in the rrnS gene conferring resistance to streptomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2248 UPDATE fusD antibiotic inactivation enzyme; fusidic acid resistance protein; ARO_category "UPDATED category_aro_name with fusidic acid resistance protein UPDATED category_aro_description with Enzymes, other proteins and other gene products shown clinically to confer resistance to fusidic acid. " 2249 UPDATE LpxA polymyxin resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistant gene variant or mutant; ARO_category; model_param "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED 3539 with 391-30 UPDATED 3540 with 76-2 UPDATED 3541 with 364-445 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. " 2244 UPDATE vanSI glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2245 UPDATE vanKI glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2246 UPDATE vanRI glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2240 UPDATE vanJ glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2241 UPDATE vanI glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2242 UPDATE vanWI glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2243 UPDATE vanXI glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 994 UPDATE SHV-77 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 997 UPDATE VIM-31 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 996 UPDATE CMY-77 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 991 UPDATE EreA antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 990 UPDATE FOX-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 993 UPDATE AAC(6')-Ib9 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 992 UPDATE SHV-66 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 999 UPDATE LEN-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 998 UPDATE SHV-134 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 120 UPDATE aadA4 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 122 UPDATE VIM-34 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 123 UPDATE SHV-64 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 124 UPDATE IND-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 125 UPDATE SHV-182 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 126 UPDATE TEM-183 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 127 UPDATE clbB linezolid resistance protein; lincosamide resistance protein; macrolide resistance protein; antibiotic target modifying enzyme; phenicol resistance protein; streptogramin resistance protein; ARO_category "UPDATED category_aro_name with linezolid resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to linezolids. UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 129 UPDATE FosX antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 2068 UPDATE Escherichia coli 16S rRNA mutation conferring resistance to edeine peptide antibiotic resistance protein; antibiotic resistant gene variant or mutant; polyamine resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. UPDATED category_aro_name with polyamine resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polyamine antibiotics. " 2069 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to neomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2060 UPDATE FosC2 antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 2061 UPDATE VIM-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2062 UPDATE mphC antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 2063 UPDATE blaR1 antibiotic resistance gene cluster, cassette, or operon; antibiotic inactivation enzyme; beta-lactam resistance protein; gene modulating beta-lactam resistance; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2064 UPDATE TEM-196 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2065 UPDATE CMY-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2066 UPDATE Escherichia coli soxS mutant efflux pump conferring antibiotic resistance; antibiotic resistant gene variant or mutant; protein modulating permeability to antibiotic; gene modulating antibiotic efflux; ARO_category "UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 1134 UPDATE linB lincosamide resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. " 1749 UPDATE IMP-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1397 UPDATE dfrC antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1645 UPDATE ACT-23 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1644 UPDATE SHV-70 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1646 UPDATE TEM-139 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1641 UPDATE OXA-203 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1640 UPDATE MIR-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1643 UPDATE arnA polymyxin resistance protein; gene altering cell wall charge; ARO_category "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED category_aro_name with gene altering cell wall charge " 1642 UPDATE clbC linezolid resistance protein; lincosamide resistance protein; macrolide resistance protein; antibiotic target modifying enzyme; phenicol resistance protein; streptogramin resistance protein; ARO_category "UPDATED category_aro_name with linezolid resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to linezolids. UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1396 UPDATE OXA-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1649 UPDATE DHA-21 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1648 UPDATE CTX-M-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1742 UPDATE SHV-28 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 729 UPDATE CTX-M-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 579 UPDATE vgaA efflux pump conferring antibiotic resistance; streptogramin resistance protein; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 578 UPDATE SHV-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 573 UPDATE OXA-136 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 572 UPDATE OXA-137 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 571 UPDATE clbA linezolid resistance protein; lincosamide resistance protein; macrolide resistance protein; antibiotic target modifying enzyme; phenicol resistance protein; streptogramin resistance protein; ARO_category "UPDATED category_aro_name with linezolid resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to linezolids. UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 570 UPDATE Streptococcus pyogenes sulfonamide resistant folP mutants antibiotic resistant gene variant or mutant; sulfonamide resistance protein; ARO_category "UPDATED category_aro_name with sulfonamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to sulfonamide antibiotics. " 577 UPDATE QnrB65 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 576 UPDATE MIR-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 575 UPDATE AAC(3)-Ib antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 574 UPDATE AAC(6')-Ia antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1209 UPDATE QnrB45 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1208 UPDATE SHV-173 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1421 UPDATE TEM-85 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2406 UPDATE rpsJ antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 1423 UPDATE TEM-15 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1422 UPDATE ACC-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1425 UPDATE RbpA antibiotic target protection protein; rifamycin resistance protein; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 1424 UPDATE OXY-2-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1426 UPDATE IMP-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1429 UPDATE SHV-60 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1428 UPDATE cphA2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 939 UPDATE CTX-M-113 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 731 UPDATE IMP-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 730 UPDATE AAC(6')-IIc antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 938 UPDATE QnrB70 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 735 UPDATE TEM-30 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 734 UPDATE vanTC glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 737 UPDATE MIR-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 736 UPDATE arr-7 rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 739 UPDATE LRA-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 738 UPDATE AAC(6')-Iae antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1359 UPDATE OXA-233 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1358 UPDATE VIM-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 469 UPDATE SHV-49 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 468 UPDATE Erm(37) antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1353 UPDATE GES-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 464 UPDATE NDM-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 467 UPDATE CARB-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 466 UPDATE CTX-M-76 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 461 UPDATE OXA-13 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1356 UPDATE dfrA22 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 463 UPDATE CTX-M-30 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 462 UPDATE Staphylococcus aureus pgsA mutations conferring resistance to daptomycin antibiotic resistant gene variant or mutant; lipopeptide antibiotic resistance protein; ARO_category; model_param "UPDATED category_aro_name with lipopeptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to lipopeptide antibiotics. UPDATED 3863 with +G76 UPDATED 3864 with +E77 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. " 937 UPDATE OXA-242 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1519 UPDATE vatE streptogramin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1518 UPDATE EreA2 antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 1515 UPDATE NDM-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1514 UPDATE IMP-28 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1517 UPDATE OXA-33 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 934 UPDATE IMP-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1511 UPDATE OXA-423 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1510 UPDATE vanTrL glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1513 UPDATE QnrB64 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1512 UPDATE SME-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 281 UPDATE CMY-110 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1735 UPDATE vatA streptogramin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 280 UPDATE CTX-M-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 357 UPDATE VIM-38 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 356 UPDATE ErmU antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 355 UPDATE TEM-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 354 UPDATE QnrB24 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 353 UPDATE QnrB2 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 352 UPDATE PDC-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 351 UPDATE SHV-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 359 UPDATE TEM-112 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 358 UPDATE QnrB42 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1033 UPDATE vanSN glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1447 UPDATE OKP-A-10 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2321 UPDATE CdeA efflux pump conferring antibiotic resistance; ARO_name "UPDATED ARO_name with cdeA " 2320 UPDATE fyuA tetracycline resistance protein; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2327 UPDATE aminocoumarin resistant cysB aminocoumarin resistance protein; ARO_category "UPDATED category_aro_name with aminocoumarin resistance protein UPDATED category_aro_description with Point mutations to DNA topoisomerase enzymes clinically shown to confer resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. " 2326 UPDATE TLA-3 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2325 UPDATE Mrx antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 1446 UPDATE PDC-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2329 UPDATE MOX-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2328 UPDATE MUS-2 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 484 UPDATE QnrB49 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 289 UPDATE OXA-85 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 288 UPDATE CMY-60 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1444 UPDATE IND-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1793 UPDATE DHA-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 5 UPDATE dfrF antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 283 UPDATE CMY-85 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 282 UPDATE CTX-M-125 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 285 UPDATE TEM-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 287 UPDATE TEM-67 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 286 UPDATE SHV-162 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1441 UPDATE Enterobacter aerogenes omp36 mutants antibiotic resistant gene variant or mutant; beta-lactam resistance protein; protein modulating permeability to antibiotic; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. UPDATED category_aro_name with protein modulating permeability to antibiotic UPDATED category_aro_description with Enzymes or other proteins either directly or indirectly reducing overall permeability to antibiotics. " 1116 UPDATE arr-2 rifamycin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with rifamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins, or their products shown clinically to confer resistance to rifamycin (rifampin) antibiotics. " 263 UPDATE dfrA24 antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 262 UPDATE VIM-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 261 UPDATE CMY-65 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 260 UPDATE ErmN antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 267 UPDATE OXA-43 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 266 UPDATE QnrB13 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1792 UPDATE DHA-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1561 UPDATE vanTG glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 269 UPDATE CMY-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 268 UPDATE CfxA6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1562 UPDATE aad(6) antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1291 UPDATE TEM-177 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1296 UPDATE OKP-B-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1297 UPDATE CTX-M-80 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1566 UPDATE vanXD glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 2259 UPDATE mphG antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 2257 UPDATE Planobispora rosea EF-Tu mutants conferring resistance to inhibitor GE2270A antibiotic resistant gene variant or mutant; elfamycin resistance protein; ARO_category "UPDATED category_aro_name with elfamycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to elfamycin antibiotics. " 1295 UPDATE catII phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 2251 UPDATE LpxC polymyxin resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistant gene variant or mutant; ARO_category; model_param "UPDATED category_aro_name with polymyxin resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to polymyxin antibiotics, i.e. colistin. UPDATED 3537 with 858-84 UPDATED 3536 with 135-1 UPDATED param_type_id with 40334 UPDATED param_type with insertion / deletion UPDATED param_description with A parameter to describe the mapped insertion or deletion. For an insertion: insert the location and genetic sequence of the insertion. For a deletion: insert the location of the deletion. For nucleotide space: insertion: [nt][position]+[number of nucleotides]:[nucleotides] eg. nt312+1:G. For protein space: insertion: +[amino acids][start position-end position] eg. +S312. If both are known, a ""/"" may be used to separate the protein and nucleotide notation eg. nt312+3:AGC/+S312. " 989 UPDATE ErmG antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 982 UPDATE TEM-153 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 983 UPDATE GES-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 980 UPDATE y56 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 981 UPDATE OXA-86 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 987 UPDATE CTX-M-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 984 UPDATE Bartonella bacilliformis gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2478 UPDATE Helicobacter pylori 16S rRNA mutation conferring resistance to tetracycline antibiotic resistant gene variant or mutant; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 115 UPDATE TEM-87 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2198 UPDATE Pseudomonas aeruginosa parE conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1790 UPDATE vanHF glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 116 UPDATE QnrB18 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 111 UPDATE Escherichia coli gyrB conferring resistance to aminocoumarin aminocoumarin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with aminocoumarin resistance protein UPDATED category_aro_description with Point mutations to DNA topoisomerase enzymes clinically shown to confer resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. " 110 UPDATE AAC(6')-Iu antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 113 UPDATE VEB-5 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 112 UPDATE FosA5 antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 119 UPDATE VIM-12 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 118 UPDATE LRA-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2079 UPDATE sgm antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2078 UPDATE Mycobacterium chelonae 16S rRNA mutation conferring resistance to kanamycin A antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2073 UPDATE Escherichia coli 16S rRNA mutation in the rrsB gene conferring resistance to G418 antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2072 UPDATE NmcR antibiotic inactivation enzyme; beta-lactam resistance protein; gene modulating beta-lactam resistance; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2071 UPDATE AAC(6')-Ib8 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2070 UPDATE Mycobacterium tuberculosis 16S rRNA mutation conferring resistance to amikacin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2077 UPDATE Mycobacterium smegmatis 16S rRNA mutation in the rrsA gene conferring resistance to neomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2076 UPDATE Neisseria gonorrhoeae 16S rRNA mutation conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 2074 UPDATE Salmonella enterica serovar Typhimurium 16S rRNA mutation in the rrsD gene conferring resistance to spectinomycin antibiotic resistant gene variant or mutant; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1796 UPDATE CMY-119 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1389 UPDATE KPC-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1986 UPDATE OXA-309 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1631 UPDATE CTX-M-71 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1984 UPDATE SHV-144 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1985 UPDATE SHV-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1982 UPDATE IMP-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1983 UPDATE vanTN glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1980 UPDATE OXA-247 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1981 UPDATE vanA glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1638 UPDATE CMY-111 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1639 UPDATE SHV-84 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1988 UPDATE CMY-7 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 568 UPDATE CTX-M-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 569 UPDATE OXA-228 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 560 UPDATE OXA-77 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 561 UPDATE OKP-B-8 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 562 UPDATE TEM-187 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 563 UPDATE OKP-B-6 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 564 UPDATE IMP-22 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 565 UPDATE SHV-82 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 566 UPDATE OXA-32 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 567 UPDATE CTX-M-41 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1188 UPDATE ErmV antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1189 UPDATE vatB streptogramin resistance protein; antibiotic inactivation enzyme; ARO_category "UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 1186 UPDATE OXA-327 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1187 UPDATE OXA-248 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1184 UPDATE OXA-182 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1185 UPDATE OXA-176 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1182 UPDATE CTX-M-105 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1183 UPDATE tetQ antibiotic target protection protein; tetracycline resistance protein; ARO_category "UPDATED category_aro_name with tetracycline resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to tetracycline antibiotics. " 726 UPDATE PC1 beta-lactamase (blaZ) antibiotic resistance gene cluster, cassette, or operon; antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 727 UPDATE ErmS antibiotic target modifying enzyme; lincosamide resistance protein; streptogramin resistance protein; macrolide resistance protein; ARO_category "UPDATED category_aro_name with lincosamide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to lincosamides. UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. UPDATED category_aro_name with streptogramin resistance protein UPDATED category_aro_description with Ezymes, other proteins or their products shown clinically to confer resistance to streptogramin antibiotics. " 724 UPDATE AAC(6')-Ij antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 725 UPDATE GES-11 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 722 UPDATE vanRA glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 723 UPDATE SHV-72 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 720 UPDATE BcI antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 721 UPDATE OXA-28 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1745 UPDATE KPC-2 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1746 UPDATE IMP-24 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1747 UPDATE CMY-103 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1740 UPDATE TEM-53 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1741 UPDATE OXA-359 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 728 UPDATE TEM-192 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1743 UPDATE OXA-338 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1164 UPDATE MIR-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1165 UPDATE OKP-A-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1166 UPDATE Staphylococcus aureus gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1160 UPDATE QnrB34 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1162 UPDATE aadA15 antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1163 UPDATE CMY-94 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1168 UPDATE NDM-9 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1169 UPDATE OXA-360 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 48 UPDATE OXA-90 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 49 UPDATE tsnr antibiotic target modifying enzyme; peptide antibiotic resistance protein; ARO_category "UPDATED category_aro_name with peptide antibiotic resistance protein UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to peptide antibiotics. " 46 UPDATE CMY-114 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 47 UPDATE OXA-60 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 42 UPDATE OXY-6-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 2034 UPDATE TEM-108 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 40 UPDATE QnrB58 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 41 UPDATE rmtH antibiotic target modifying enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1568 UPDATE OXA-183 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1569 UPDATE catD phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 1299 UPDATE AAC(6')-Ic antibiotic inactivation enzyme; aminoglycoside resistance protein; ARO_category "UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 1560 UPDATE OKP-B-20 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1293 UPDATE OXA-197 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1290 UPDATE TEM-141 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1563 UPDATE CTX-M-63 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1564 UPDATE QnrB16 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 1565 UPDATE ACT-18 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1294 UPDATE Sed1 beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1567 UPDATE FosB antibiotic inactivation enzyme; fosfomycin resistance protein; ARO_category "UPDATED category_aro_name with fosfomycin resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fosfomycin antibiotics. " 1713 UPDATE vanYM glycopeptide resistance protein; gene conferring antibiotic resistance via molecular bypass; antibiotic resistance gene cluster, cassette, or operon; ARO_category "UPDATED category_aro_name with glycopeptide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to glycopeptides. " 1360 UPDATE Bartonella bacilliformis gyrB conferring resistance to aminocoumarin aminocoumarin resistance protein; antibiotic resistant gene variant or mutant; ARO_category "UPDATED category_aro_name with aminocoumarin resistance protein UPDATED category_aro_description with Point mutations to DNA topoisomerase enzymes clinically shown to confer resistance to aminocoumarins. In some cases, expression of parY(R), which encodes an aminocoumarin resistant topoisomerase IV, can also confer aminocoumarin resistance. " 1712 UPDATE IMP-41 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 475 UPDATE OXA-106 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 795 UPDATE OXA-324 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1381 UPDATE CcrA beta-lactamase antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1710 UPDATE Mycobacterium leprae gyrB conferring resistance to fluoroquinolone antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 793 UPDATE IMP-34 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 792 UPDATE OXY-1-1 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 791 UPDATE SHV-14 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 732 UPDATE OXA-237 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 790 UPDATE CMY-32 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 472 UPDATE TEM-128 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1367 UPDATE oleD antibiotic inactivation enzyme; macrolide resistance protein; ARO_category "UPDATED category_aro_name with macrolide resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to macrolide antibiotics. " 470 UPDATE OXA-4 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 471 UPDATE TEM-151 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1362 UPDATE IMP-31 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 477 UPDATE catP phenicol resistance protein; antibiotic inactivation enzyme; ARO_category "DELETED 36537 UPDATED category_aro_name with phenicol resistance protein UPDATED category_aro_cvterm_id with 36191 UPDATED category_aro_accession with 3000052 UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to phenicol (chloramphenicol) antibiotics. These include chloramphenicol acetyltransferase (CAT) enzymes, which are found in a large number of species. " 474 UPDATE dfrD antibiotic target replacement protein; diaminopyrimidine resistance protein; ARO_category "DELETED 37616 UPDATED category_aro_name with diaminopyrimidine resistance protein UPDATED category_aro_cvterm_id with 40990 UPDATED category_aro_accession with 3004028 UPDATED category_aro_description with Enzymes, other proteins or other gene products shown clinically to confer resistance to diaminopyrimidine (incl. trimethoprim) antibiotics. " 1361 UPDATE OXA-223 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 478 UPDATE AAC(3)-IIa antibiotic inactivation enzyme; aminoglycoside resistance protein; model_sequences; ARO_category "UPDATED fmax with 16478 UPDATED strand with + UPDATED accession with NC_020088.1 UPDATED fmin with 15617 UPDATED sequence with ATGCATACGCGGAAGGCAATAACGGAGGCGCTTCAAAAACTCGGAGTCCAAACCGGTGACCTCTTGATGGTGCATGCCTCACTTAAAGCGATTGGTCCGGTCGAAGGAGGAGCGGAGACGGTCGTTGCCGCGTTACGCTCCGCGGTTGGGCCGACTGGCACTGTGATGGGATACGCGTCGTGGGACCGATCACCCTACGAGGAGACTCTGAATGGCGCTCGGCTGGATGACGAAGCCCGCCGTACCTGGCTGCCGTTCGATCCCGCAACAGCCGGGACTTACCGTGGGTTCGGCCTGCTGAATCAATTTCTGGTTCAAGCCCCCGGCGCGCGGCGCAGCGCGCACCCCGATGCATCGATGGTCGCGGTTGGTCCGCTGGCTGAAACGCTGACGGAGCCTCACGAACTCGGTCACGCCTTGGGGGAAGGATCGCCCGTCGAGCGGTTCGTTCGCCTTGGCGGGAAGGCCCTGCTGTTGGGTGCGCCGCTAAACTCCGTTACCGCATTGCACTACGCCGAGGCGGTTGCCGATATCCCCAACAAACGGTGGGTGACGTATGAGATGCCGATGCTTGGAAGAGACGGTGAAGTCGCCTGGAAAACGGCATCGGATTACGATTCAAACGGCATTCTCGATTGCTTTGCTATCGAAGGAAAGCCGGATGCGGTTGAAACTATAGCAAATGCTTACGTGAAGCTCGGTCGCCATCGAGAAGGTGTCGTGGGCTTTGCTCAGTGCTACCTGTTCGACGCGCAGGACATCGTGACGTTCGGCGTCACCTATCTTGAGAAGCATTTCGGAACCACTCCGATCGTGCCTCCGCACGAGGCCGTCGAGCGCTCTTGCGAGCCTTCAGGTTAG UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED GI with YP_007349693.1 UPDATED sequence with MHTRKAITEALQKLGVQTGDLLMVHASLKAIGPVEGGAETVVAALRSAVGPTGTVMGYASWDRSPYEETLNGARLDDEARRTWLPFDPATAGTYRGFGLLNQFLVQAPGARRSAHPDASMVAVGPLAETLTEPHELGHALGEGSPVERFVRLGGKALLLGAPLNSVTALHYAEAVADIPNKRWVTYEMPMLGRDGEVAWKTASDYDSNGILDCFAIEGKPDAVETIANAYVKLGRHREGVVGFAQCYLFDAQDIVTFGVTYLEKHFGTTPIVPPHEAVERSCEPSG UPDATED category_aro_name with aminoglycoside resistance protein UPDATED category_aro_description with Enzymes or other proteins shown clinically to confer resistance to aminoglycoside antibiotics. " 479 UPDATE IMP-29 antibiotic inactivation enzyme; beta-lactam resistance protein; ARO_category "UPDATED category_aro_name with beta-lactam resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to beta-lactam antibiotics. " 1369 UPDATE QnrB69 antibiotic target protection protein; fluoroquinolone resistance protein; ARO_category "UPDATED category_aro_name with fluoroquinolone resistance protein UPDATED category_aro_description with Enzymes, other proteins or their products shown clinically to confer resistance to fluoroquinolones. " 2238 DELETE vanXY glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; N/A N/A 2237 DELETE vanW glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; N/A N/A 2236 DELETE vanT glycopeptide resistance gene; gene conferring antibiotic resistance via molecular bypass; N/A N/A 2525 ADD AAC(6')-34 antibiotic inactivation enzyme; aminoglycoside resistance protein; N/A N/A 2524 ADD AAC(2')-IIb antibiotic inactivation enzyme; aminoglycoside resistance protein; N/A N/A 2527 ADD mphI antibiotic inactivation enzyme; macrolide resistance protein; N/A N/A 2526 ADD VgbC streptogramin resistance protein; antibiotic inactivation enzyme; N/A N/A 2521 ADD BahA peptide antibiotic resistance protein; N/A N/A 2520 ADD CatU phenicol resistance protein; antibiotic inactivation enzyme; N/A N/A 2523 ADD VatI streptogramin resistance protein; antibiotic inactivation enzyme; N/A N/A 2522 ADD TaeA efflux pump conferring antibiotic resistance; N/A N/A 2529 ADD cpaA aminoglycoside resistance protein; N/A N/A 2528 ADD rphB rifamycin resistance protein; antibiotic inactivation enzyme; N/A N/A 2518 ADD TetB(48) efflux pump conferring antibiotic resistance; N/A N/A 2519 ADD LlmA 23S ribosomal RNA methyltransferase antibiotic target modifying enzyme; N/A N/A 2551 ADD glycopeptide resistance gene cluster VanI antibiotic resistance gene cluster, cassette, or operon; N/A N/A 2550 ADD Clostridium difficile gyrA conferring resistance to fluoroquinolones antibiotic resistant gene variant or mutant; fluoroquinolone resistance protein; N/A N/A 2517 ADD tetA(48) efflux pump conferring antibiotic resistance; N/A N/A