Model_id Action ARO_name ARO_category Changes To Summary 2713 UPDATE MexXY-OprM erythromycin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; acridine dye; penam; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2711 UPDATE MexXY-OprM erythromycin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; acridine dye; penam; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2907 UPDATE vmlR virginiamycin S2; lincomycin; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; streptogramin antibiotic; lincosamide antibiotic; ARO_category "UPDATED category_aro_name with virginiamycin S2 UPDATED category_aro_cvterm_id with 37021 UPDATED category_aro_accession with 3000677 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Virginiamycin S2 is a streptogramin B antibiotic. UPDATED category_aro_name with streptogramin antibiotic UPDATED category_aro_cvterm_id with 35945 UPDATED category_aro_accession with 0000026 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Streptogramin antibiotics are natural products produced by various members of the Streptomyces genus. These antibiotics bind to the P site of the 50S subunit of bacterial ribosomes to inhibit protein synthesis. The family consists of two subgroups, type A and type B, which are simultaneously produced by the same bacterial species in a ratio of roughly 70:30. UPDATED category_aro_name with lincomycin UPDATED category_aro_cvterm_id with 35964 UPDATED category_aro_accession with 0000046 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Lincomycin is a lincosamide antibiotic that comes from the actinomyces Streptomyces lincolnensis. It binds to the 23s portion of the 50S subunit of bacterial ribosomes and inhibit early elongation of peptide chain by inhibiting transpeptidase reaction. UPDATED category_aro_name with lincosamide antibiotic UPDATED category_aro_cvterm_id with 35936 UPDATED category_aro_accession with 0000017 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Lincosamides (e.g. lincomycin, clindamycin) are a class of drugs which bind to the 23s portion of the 50S subunit of bacterial ribosomes. This interaction inhibits early elongation of peptide chains by inhibiting the transpeptidase reaction, acting similarly to macrolides. " 154 UPDATE mgrA penam; peptide antibiotic; ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; sparfloxacin; norfloxacin; moxifloxacin; daptomycin; cefotaxime; acridine dye; cephalosporin; acriflavine; antibiotic efflux; ciprofloxacin; tetracycline antibiotic; fluoroquinolone antibiotic; methicillin; tetracycline; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2732 UPDATE MexVW-OprM antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; macrolide antibiotic; acridine dye; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; tetracycline; chloramphenicol; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2904 UPDATE poxtA antibiotic target protection; linezolid; ABC-F ATP-binding cassette ribosomal protection protein; tetracycline; florfenicol; tetracycline antibiotic; oxazolidinone antibiotic; phenicol antibiotic; doxycycline; chloramphenicol; ARO_description "UPDATED ARO_description with PoxtA is an ABC-F subfamily ATP-binding cassette protein that confers resistance to tetracycline, -phenicol, and oxazolidinone via modification of the bacterial ribosome. The encoding gene was isolated from a methicillin-resistant Staphylococcus aureus strain. " 334 UPDATE mexX erythromycin; arbekacin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; acridine dye; penam; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1344 UPDATE MexH antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; norfloxacin; acridine dye; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; tetracycline; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2775 UPDATE Pseudomonas aeruginosa soxR antibiotic target alteration; tetracycline antibiotic; antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; cephalosporin; cefalotin; ciprofloxacin; tigecycline; protein(s) and two-component regulatory system modulating antibiotic efflux; acridine dye; rifampin; ampicillin; penam; triclosan; efflux pump complex or subunit conferring antibiotic resistance; acriflavine; glycylcycline; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; rifamycin antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1786 UPDATE mexY erythromycin; arbekacin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; acridine dye; penam; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2213 UPDATE opmE kitasamycin; imipenem; thiamphenicol; resistance-nodulation-cell division (RND) antibiotic efflux pump; rokitamycin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim; macrolide antibiotic; antibiotic efflux; carbapenem; acridine dye; diaminopyrimidine antibiotic; acriflavine; tetracycline antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 215 UPDATE bcrC peptide antibiotic; undecaprenyl pyrophosphate related proteins; bacitracin B; bacitracin F; bacitracin A; antibiotic target alteration; ARO_description "UPDATED ARO_description with The bcrC gene product (BcrC) is an undecaprenyl pyrophosphate phosphatase originally isolated from Bacillus subtilis. When overexpressed it can confer resistance to bacitracin. " 1368 UPDATE abeM antibiotic efflux; triclosan; efflux pump complex or subunit conferring antibiotic resistance; ofloxacin; norfloxacin; multidrug and toxic compound extrusion (MATE) transporter; acridine dye; acriflavine; ciprofloxacin; fluoroquinolone antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 276 UPDATE tetR antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; tigecycline; glycylcycline; tetracycline antibiotic; antibiotic target alteration; tetracycline; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 1390 UPDATE arlR antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; norfloxacin; acridine dye; acriflavine; ciprofloxacin; fluoroquinolone antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 84 UPDATE GIM-1 penam; GIM beta-lactamase; penem; carbapenem; cephalosporin; antibiotic inactivation; cephamycin; monobactam; ARO_category "UPDATED category_aro_description with GIM beta-lactamase enzymes isolated from Pseudomonas aeruginosa, and found to confer broad-spectrum resistance to beta-lactam antibiotics. " 182 UPDATE arlS antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; norfloxacin; acridine dye; acriflavine; ciprofloxacin; fluoroquinolone antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2321 UPDATE cdeA antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; multidrug and toxic compound extrusion (MATE) transporter; acridine dye; acriflavine; fluoroquinolone antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2207 UPDATE MexV antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; macrolide antibiotic; acridine dye; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; tetracycline; chloramphenicol; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1191 UPDATE mdtM antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; norfloxacin; acridine dye; lincomycin; puromycin; acriflavine; nucleoside antibiotic; fluoroquinolone antibiotic; lincosamide antibiotic; phenicol antibiotic; chloramphenicol; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 45 UPDATE mdtP antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; acridine dye; puromycin; acriflavine; nucleoside antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2223 UPDATE MexZ erythromycin; arbekacin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; protein(s) and two-component regulatory system modulating antibiotic efflux; acridine dye; penam; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; model_description; ARO_category "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 957 UPDATE tet(G) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; ARO_description "UPDATED ARO_description with TetG is a tetracycline efflux protein found in Gram-negative bacteria. The encoding gene is found in both chromosomal and plasmid DNA where it is frequently linked to the floR, sul1, and cmlA9 genes which encode proteins that can confer florfenicol/chloramphenicol, sulfamethoxazole, and chloramphenicol resistance, respectively. " 2306 UPDATE Escherichia coli acrR with mutation conferring multidrug antibiotic resistance penam; antibiotic efflux; triclosan; rifampin; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; antibiotic target alteration; tetracycline antibiotic; cephalosporin; cefalotin; tigecycline; glycylcycline; ampicillin; fluoroquinolone antibiotic; rifamycin antibiotic; phenicol antibiotic; tetracycline; chloramphenicol; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 1256 UPDATE bmr antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; acridine dye; puromycin; acriflavine; nucleoside antibiotic; fluoroquinolone antibiotic; phenicol antibiotic; chloramphenicol; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2056 UPDATE mdtO antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; acridine dye; puromycin; acriflavine; nucleoside antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1305 UPDATE OprM sulfonamide antibiotic; tetracycline; erythromycin; penem; panipenem; tetracycline antibiotic; clavulanate; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; ofloxacin; norfloxacin; nalidixic acid; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; gentamicin C; amikacin; ceftriaxone; thiamphenicol; peptide antibiotic; acridine dye; diaminopyrimidine antibiotic; ticarcillin; ampicillin; amoxicillin; penam; aminoglycoside antibiotic; sulfamethoxazole; novobiocin; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; acriflavine; monobactam; fluoroquinolone antibiotic; chloramphenicol; trimethoprim; azithromycin; tobramycin; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1442 UPDATE mdtN antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; acridine dye; puromycin; acriflavine; nucleoside antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2263 UPDATE optrA oxazolidinone antibiotic; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; ARO_description "UPDATED ARO_description with OptrA is a member of the ABC-F protein subfamily that confers resistance to oxazolidinones. The gene encoding the protein was originally isolated from a plasmid in Enterococcus faecalis and Enterococcus faecium. " 2112 UPDATE patB antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; norfloxacin; efflux pump complex or subunit conferring antibiotic resistance; ciprofloxacin; fluoroquinolone antibiotic; model_sequences; model_param "UPDATED partial with 0 UPDATED sequence with ATGAAGACAGTTCAATTTTTTTGGCATTATTTTAAGGTCTACAAGTTCTCATTTGTAGTTGTCATCCTGATGATTGTTCTGGCGACTTTTGCCCAAGCCCTCTTTCCAGTCTTTTCTGGACAAGCGGTGACGCAGCTAGCCAATTTAGTTCAAGCTTATCAAAATGGCAATCCAGAACTTGTATGGCAAAGCCTATCAGGAATCATGGTCAATCTTGGCCTGCTGGTTTTGGTTCTATTTATCTCTAGTGTAATATACATGTGTCTCATGACGCGCGTGATTGCAGAATCGACCAACGAGATGCGCAAAGGCCTCTTTGGTAAGCTTGCTCAGTTGACGGTTTCTTTCTTTGACCGTCGACAAGATGGCGATATCCTGTCTCATTTTACCAGTGATTTGGATAATATCCTCCAAGCCTTTAACGAAAGCTTGATTCAGGTCATGAGCAATATTGTTTTATACATTGGTCTGATTCTTGTCATGTTTTCGAGAAATGTGACGCTGGCTCTCATCACCATTGCCAGCACCCCATTGGCTTTCCTTATGCTGATTTTCATCGTGAAAATGGCACGCAAATACACCAACCTCCAGCAGAAAGAGGTAGGGAAGCTCAACGCCTATATGGATGAGAGCATCTCAGGCCAAAAAGCCGTGATTGTGCAAGGAATTCAAGAGGATATGATGGCAGGATTTCTTGAACAAAATGAGCGCGTGCGCAAGGCAACCTTTAAAGGAAGAATGTTCTCAGGAATTCTTTTCCCTGTCATGAATGGGATGAGCCTGATTAATACAGCCATCGTCATCTTTGCTGGTTCGGCTGTACTTTTGAATGATAAGTCTATTGAAACAAGTACAGCCCTAGGTTTGATTGTTATGTTTGCACAATTTTCACAGCAGTACTACCAGCCTATTATCCAAGTTGCAGCGAGTTGGGGAAGCCTTCAGTTGGCCTTTACTGGAGCTGAACGAATTCAGGAAATGTTTGATGCAGAGGAGGAAATCCGACCTGAAAAGGCTCCAACCTTCACTAAGTTGCAAGAAAGTGTTGAAATCAGTCATATCGTTTTTTCATACTTGCCTGATAAACCTATTTTGAAAGATGTCAGCATTTCTGCCCCTAAAGGCCAGATGACAGCAGTTGTTGGGCCGACAGGTTCAGGAAAAACGACTATTATGAACCTCATCAATCGCTTTTATGATGTTGATGCTGGTGGTATTTATTTTGATGGTAAAGACATTCGTGGCTATGACTTAGATAGTCTTAGAAGCAAGGTGGGAATTGTATTGCAAGATTCGGTCTTGTTTAGCGGAACGATTAGAGACAATATCCGATTTGGTGTGCCAGATGCTAGTCAGGAAATGGTTGAGGTAGCAGCAAAAGCAACCCACATTCACGACTATATCGAAAGTTTGCCTGATAAGTACGATACTCTTATTGATGATGACCAGAGCATCTTTTCAACAGGGCAGAAGCAATTGATTTCAATCGCTCGAACCCTGATGACAGATCCAGAAGTTCTCATTCTCGATGAAGCAACTTCAAACGTAGATACGGTGACAGAAAGCAAGATTCAGCATGCCATGGAGGTGGTTGTAGCAGGTAGAACTAGTTTCGTCATTGCCCACCGCTTGAAAACCATTCTCAATGCAGATCAGATTATTGTCCTTAAAGATGGAGAAGTCATTGAACGTGGTAACCACCATGAACTTTTGAAGCTAGGTGGCTTTTATTCAGAACTCTATCACAATCAATTTGTTTTCGAATAA UPDATED fmax with 1982324 UPDATED accession with AE005672.3 UPDATED fmin with 1980557 UPDATED strand with - UPDATED NCBI_taxonomy_name with Streptococcus pneumoniae TIGR4 UPDATED NCBI_taxonomy_id with 170187 UPDATED NCBI_taxonomy_cvterm_id with 40078 UPDATED accession with AAK76136.1 UPDATED sequence with MKTVQFFWHYFKVYKFSFVVVILMIVLATFAQALFPVFSGQAVTQLANLVQAYQNGNPELVWQSLSGIMVNLGLLVLVLFISSVIYMCLMTRVIAESTNEMRKGLFGKLAQLTVSFFDRRQDGDILSHFTSDLDNILQAFNESLIQVMSNIVLYIGLILVMFSRNVTLALITIASTPLAFLMLIFIVKMARKYTNLQQKEVGKLNAYMDESISGQKAVIVQGIQEDMMAGFLEQNERVRKATFKGRMFSGILFPVMNGMSLINTAIVIFAGSAVLLNDKSIETSTALGLIVMFAQFSQQYYQPIIQVAASWGSLQLAFTGAERIQEMFDAEEEIRPEKAPTFTKLQESVEISHIVFSYLPDKPILKDVSISAPKGQMTAVVGPTGSGKTTIMNLINRFYDVDAGGIYFDGKDIRGYDLDSLRSKVGIVLQDSVLFSGTIRDNIRFGVPDASQEMVEVAAKATHIHDYIESLPDKYDTLIDDDQSIFSTGQKQLISIARTLMTDPEVLILDEATSNVDTVTESKIQHAMEVVVAGRTSFVIAHRLKTILNADQIIVLKDGEVIERGNHHELLKLGGFYSELYHNQFVFE UPDATED param_value with 750 " 1670 UPDATE nalC sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; clavulanate; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; protein(s) and two-component regulatory system modulating antibiotic efflux; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; amoxicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 1374 UPDATE blaI penam; antibiotic inactivation; blaZ beta-lactamase; ARO_category "UPDATED category_aro_description with blaZ beta-lactamases are Class A beta-lactamases. These beta-lactamases are responsible for penicillin resistance in Staphylococcus aureus. " 995 UPDATE MexG antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; norfloxacin; acridine dye; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; tetracycline; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1213 UPDATE nalD sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; clavulanate; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; nalidixic acid; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; protein(s) and two-component regulatory system modulating antibiotic efflux; peptide antibiotic; diaminopyrimidine antibiotic; ticarcillin; ampicillin; amoxicillin; penam; sulfamethoxazole; novobiocin; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; trimethoprim; azithromycin; chloramphenicol; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 1139 UPDATE dfrA12 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGAACTCGGAATCAGTACGCATTTATCTCGTTGCTGCGATGGGAGCCAATCGGGTTATTGGCAATGGTCCTAATATCCCCTGGAAAATTCCGGGTGAGCAGAAGATTTTTCGCAGACTCACTGAGGGAAAAGTCGTTGTCATGGGGCGAAAGACCTTTGAGTCTATCGGCAAGCCTCTACCGAACCGTCACACATTGGTAATCTCACGCCAAGCTAACTACCGCGCCACTGGCTGCGTAGTTGTTTCAACGCTGTCGCACGCTATCGCTTTGGCATCCGAACTCGGCAATGAACTCTACGTCGCGGGCGGAGCTGAGATATACACTCTGGCACTACCTCACGCCCACGGCGTGTTTCTATCTGAGGTACATCAAACCTTCGAGGGTGACGCCTTCTTCCCAATGCTCAACGAAACAGAATTCGAGCTTGTCTCAACCGAAACCATTCAAGCTGTAATTCCGTACACCCACTCCGTTTATGCGCGTCGAAACGGCTAA UPDATED fmax with 22103 UPDATED accession with GU585907.1 UPDATED fmin with 21605 UPDATED strand with - UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with ADG84870.1 UPDATED sequence with MNSESVRIYLVAAMGANRVIGNGPNIPWKIPGEQKIFRRLTEGKVVVMGRKTFESIGKPLPNRHTLVISRQANYRATGCVVVSTLSHAIALASELGNELYVAGGAEIYTLALPHAHGVFLSEVHQTFEGDAFFPMLNETEFELVSTETIQAVIPYTHSVYARRNG " 1138 UPDATE tet(D) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGAATAAACCCGCTGTCATCGCGCTGGTGATTACACTGCTGGACGCGATGGGAATTGGTCTGATCATGCCGGTATTACCGTCACTGCTGCGGGAATATCTCCCGGAAGCGGATGTGGCAAACCATTACGGCATTCTGCTGGCGCTGTATGCGGTGATGCAGGTCTGTTTTGCTCCGCTGCTGGGCAGATGGTCAGATAAGCTGGGGCGCAGACCGGTGCTGCTGTTATCCCTGGCGGGTGCCGCGTTTGATTACACACTGCTGGCACTGTCCAATGTGCTGTGGATGTTGTATCTCGGGCGGATTATCTCCGGGATCACTGGTGCCACCGGCGCGGTTGCGGCTTCGGTAGTGGCGGACAGCACGGCGGTCAGCGAGCGTACCGCCTGGTTCGGCCGTCTCGGTGCGGCCTTTGGTGCCGGGCTGATTGCCGGGCCGGCTATCGGCGGACTGGCGGGGGATATCTCACCGCATCTGCCGTTTGTCATTGCGGCAATACTGAATGCCTGCACCTTTCTGATGGTCTTTTTTATCTTTAAACCGGCGGTACAGACAGAAGAAAAACCGGCGGAGCAGAAACAAGAAAGCGCAGGTATCAGCTTTATCACACTGCTTAAACCTCTGGCGCTGTTGCTGTTTGTCTTTTTTACCGCGCAGCTTATCGGGCAGATCCCGGCCACTGTCTGGGTATTGTTTACGGAGAGCCGCTTTGCCTGGGACAGCGCGGCGGTCGGTTTTTCACTGGCGGGACTCGGGGCGATGCATGCACTGTTTCAGGCGGTGGTTGCCGGGGCGCTGGCAAAACGGCTGAGTGAGAAAACCATTATTTTCGCCGGATTTATTGCCGATGCCACCGCGTTTTTACTGATGTCTGCTATCACTTCCGGATGGATGGTGTATCCGGTCCTGATCCTGCTGGCAGGCGGCGGAATTGCACTGCCTGCATTGCAGGGCATTATCTCTGCCGGGGCATCGGCGGCAAATCAGGGAAAACTACAGGGTGTGCTGGTCAGCCTGACCAATCTGACCGGCGTGGCGGGCCCGCTGCTGTTTGCTTTTATTTTCAGTCAGACACAGCAGAGTGCGGACGGTACGGTGTGGCTGATTGGCACGGCACTGTACGGTCTGCTGCTGGCAATCTGTCTGCTGATCAGAAAACCGGCACCGGTGGCGGCCACCTGCTGA UPDATED fmax with 1348 UPDATED accession with AF467077.1 UPDATED fmin with 163 UPDATED strand with + UPDATED NCBI_taxonomy_name with Shigella flexneri Y UPDATED NCBI_taxonomy_id with 424720 UPDATED NCBI_taxonomy_cvterm_id with 42476 UPDATED accession with AAL75563.1 UPDATED sequence with MNKPAVIALVITLLDAMGIGLIMPVLPSLLREYLPEADVANHYGILLALYAVMQVCFAPLLGRWSDKLGRRPVLLLSLAGAAFDYTLLALSNVLWMLYLGRIISGITGATGAVAASVVADSTAVSERTAWFGRLGAAFGAGLIAGPAIGGLAGDISPHLPFVIAAILNACTFLMVFFIFKPAVQTEEKPAEQKQESAGISFITLLKPLALLLFVFFTAQLIGQIPATVWVLFTESRFAWDSAAVGFSLAGLGAMHALFQAVVAGALAKRLSEKTIIFAGFIADATAFLLMSAITSGWMVYPVLILLAGGGIALPALQGIISAGASAANQGKLQGVLVSLTNLTGVAGPLLFAFIFSQTQQSADGTVWLIGTALYGLLLAICLLIRKPAPVAATC " 2874 UPDATE ACI-1 penam; antibiotic inactivation; penem; cephalosporin; cefotaxime; ceftazidime; penicillin; ticarcillin; amoxicillin; ACI beta-lactamase; ARO_category "UPDATED category_aro_name with penicillin UPDATED category_aro_cvterm_id with 35971 UPDATED category_aro_accession with 0000054 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Penicillin (sometimes abbreviated PCN) is a beta-lactam antibiotic used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. It works by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_name with ceftazidime UPDATED category_aro_cvterm_id with 35977 UPDATED category_aro_accession with 0000060 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ceftazidime is a third-generation cephalosporin antibiotic. Like other third-generation cephalosporins, it has broad spectrum activity against Gram-positive and Gram-negative bacteria. Unlike most third-generation agents, it is active against Pseudomonas aeruginosa, however it has weaker activity against Gram-positive microorganisms and is not used for such infections. UPDATED category_aro_name with penem UPDATED category_aro_cvterm_id with 40360 UPDATED category_aro_accession with 3003706 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Penems are a class of unsaturated beta-lactam antibiotics with a broad spectrum of antibacterial activity and have a structure which renders them highly resistant to beta-lactamases. All penems are all synthetically made and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. They are structurally similar to carbapenems, however, where carbapenems have a carbon, penems have a sulfur. UPDATED category_aro_name with ticarcillin UPDATED category_aro_cvterm_id with 40523 UPDATED category_aro_accession with 3003832 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Ticarcillin is a carboxypenicillin used for the treatment of Gram-negative bacteria, particularly P. aeruginosa. Ticarcillin's antibiotic properties arise from its ability to prevent cross-linking of peptidoglycan during cell wall synthesis, when the bacteria try to divide, causing cell death. " 2769 UPDATE MdtNOP antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; acridine dye; puromycin; acriflavine; nucleoside antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 442 UPDATE OpmD antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; norfloxacin; acridine dye; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; tetracycline; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2761 UPDATE MexPQ-OpmE kitasamycin; imipenem; thiamphenicol; resistance-nodulation-cell division (RND) antibiotic efflux pump; rokitamycin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim; macrolide antibiotic; antibiotic efflux; carbapenem; acridine dye; diaminopyrimidine antibiotic; acriflavine; tetracycline antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2760 UPDATE MexGHI-OpmD antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; norfloxacin; acridine dye; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; tetracycline; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2425 UPDATE hmrM antibiotic efflux; acridine dye; norfloxacin; multidrug and toxic compound extrusion (MATE) transporter; efflux pump complex or subunit conferring antibiotic resistance; acriflavine; fluoroquinolone antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 618 UPDATE emeA acridine dye; antibiotic efflux; multidrug and toxic compound extrusion (MATE) transporter; acriflavine; efflux pump complex or subunit conferring antibiotic resistance; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1623 UPDATE GIM-2 penam; GIM beta-lactamase; penem; carbapenem; cephalosporin; antibiotic inactivation; cephamycin; monobactam; ARO_category "UPDATED category_aro_description with GIM beta-lactamase enzymes isolated from Pseudomonas aeruginosa, and found to confer broad-spectrum resistance to beta-lactam antibiotics. " 1992 UPDATE dfrA1 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; ARO_description; model_sequences "UPDATED ARO_description with dfrA1 is an integron-encoded dihydrofolate reductase UPDATED partial with 0 UPDATED sequence with GTGAAACTATCACTAATGGTAGCTATATCGAAGAATGGAGTTATCGGGAATGGCCCTGATATTCCATGGAGTGCCAAAGGTGAACAGCTCCTGTTTAAAGCTATTACCTATAACCAATGGCTGTTGGTTGGACGCAAGACTTTTGAATCAATGGGAGCATTACCCAACCGAAAGTATGCGGTCGTAACACGTTCAAGTTTTACATCTGACAATGAGAACGTAGTGATCTTTCCATCAATTAAAGATGCTTTAACCAACCTAAAGAAAATAACGGATCATGTCATTGTTTCAGGTGGTGGGGAGATATACAAAAGCCTGATCGATCAAGTAGATACACTACATATATCTACAATAGACATCGAGCCGGAAGGTGATGTTTACTTTCCTGAAATCCCCAGCAATTTTAGGCCAGTTTTTACCCAAGACTTCGCCTCTAACATAAATTATAGTTACCAAATCTGGCAAAAGGGTTAA UPDATED fmax with 20000 UPDATED accession with KJ541681.1 UPDATED fmin with 19526 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella oxytoca UPDATED NCBI_taxonomy_id with 571 UPDATED NCBI_taxonomy_cvterm_id with 36788 UPDATED accession with AAP74961.2 UPDATED sequence with MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSSFTSDNENVVIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDIEPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG " 3076 UPDATE dfrB4 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; model_sequences "UPDATED partial with 0 " 1386 UPDATE ANT(9)-Ia antibiotic inactivation; aminoglycoside antibiotic; spectinomycin; ANT(9); model_sequences "UPDATED partial with 0 UPDATED sequence with ATGAGCAATTTGATTAACGGAAAAATACCAAATCAAGCGATTCAAACATTAAAAATCGTAAAAGATTTATTTGGAAGTTCAATAGTTGGAGTATATCTATTTGGTTCAGCAGTAAATGGTGGTTTACGCATTAACAGCGATGTAGATGTTCTAGTCGTCGTGAATCATAGTTTACCTCAATTAACTCGAAAAAAACTAACAGAAAGACTAATGACTATATCAGGAAAGATTGGAAATACGGATTCTGTTAGACCACTTGAAGTTACGGTTATAAATAGGAGTGAAGTTGTCCCTTGGCAATATCCTCCAAAAAGAGAATTTATATACGGTGAGTGGCTCAGGGGTGAATTTGAGAATGGACAAATTCAGGAACCAAGCTATGATCCTGATTTGGCTATTGTTTTAGCACAAGCAAGAAAGAATAGTATTTCTCTATTTGGTCCTGATTCTTCAAGTATACTTGTCTCCGTACCTTTGACAGATATTCGAAGAGCAATTAAGGATTCTTTGCCAGAACTAATTGAGGGGATAAAAGGTGATGAGCGTAATGTAATTTTAACCCTAGCTCGAATGTGGCAAACAGTGACTACTGGTGAAATTACCTCGAAAGATGTCGCTGCAGAATGGGCTATACCTCTTTTACCTAAAGAGCATGTAACTTTACTGGATATAGCTAGAAAAGGCTATCGGGGAGAGTGTGATGATAAGTGGGAAGGACTATATTCAAAGGTGAAAGCACTCGTTAAGTATATGAAAAATTCTATAGAAACTTCTCTCAATTAG UPDATED fmax with 1113 UPDATED accession with X02588.1 UPDATED fmin with 330 UPDATED strand with + UPDATED NCBI_taxonomy_name with Staphylococcus aureus UPDATED NCBI_taxonomy_id with 1280 UPDATED NCBI_taxonomy_cvterm_id with 35508 UPDATED accession with CAA26428.1 UPDATED sequence with MSNLINGKIPNQAIQTLKIVKDLFGSSIVGVYLFGSAVNGGLRINSDVDVLVVVNHSLPQLTRKKLTERLMTISGKIGNTDSVRPLEVTVINRSEVVPWQYPPKREFIYGEWLRGEFENGQIQEPSYDPDLAIVLAQARKNSISLFGPDSSSILVSVPLTDIRRAIKDSLPELIEGIKGDERNVILTLARMWQTVTTGEITSKDVAAEWAIPLLPKEHVTLLDIARKGYRGECDDKWEGLYSKVKALVKYMKNSIETSLN " 1608 UPDATE MexT antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; trimethoprim; efflux pump complex or subunit conferring antibiotic resistance; diaminopyrimidine antibiotic; ciprofloxacin; fluoroquinolone antibiotic; phenicol antibiotic; chloramphenicol; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 2550 UPDATE Clostridium difficile gyrA conferring resistance to fluoroquinolones antibiotic target alteration; fluoroquinolone antibiotic; nybomycin; fluoroquinolone resistant gyrA; model_param "UPDATED 8663 with C245T UPDATED 8664 with D71V UPDATED 8665 with T82I UPDATED 8666 with T82V UPDATED 8667 with A118T UPDATED 8663 with C245T UPDATED 8664 with D71V UPDATED 8665 with T82I UPDATED 8666 with T82V UPDATED 8667 with A118T " 2212 UPDATE mexQ kitasamycin; imipenem; thiamphenicol; resistance-nodulation-cell division (RND) antibiotic efflux pump; rokitamycin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim; macrolide antibiotic; antibiotic efflux; carbapenem; acridine dye; diaminopyrimidine antibiotic; acriflavine; tetracycline antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2211 UPDATE mexP kitasamycin; imipenem; thiamphenicol; resistance-nodulation-cell division (RND) antibiotic efflux pump; rokitamycin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim; macrolide antibiotic; antibiotic efflux; carbapenem; acridine dye; diaminopyrimidine antibiotic; acriflavine; tetracycline antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1554 UPDATE norA antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; norfloxacin; acridine dye; acriflavine; ciprofloxacin; fluoroquinolone antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1647 UPDATE MexI antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; norfloxacin; acridine dye; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; tetracycline; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1975 UPDATE blt antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; acridine dye; acriflavine; fluoroquinolone antibiotic; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 2081 UPDATE patA antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; norfloxacin; efflux pump complex or subunit conferring antibiotic resistance; ciprofloxacin; fluoroquinolone antibiotic; model_sequences; model_param "UPDATED partial with 0 UPDATED sequence with ATGCTGATTCAGAAAATAAAAACCTACAAGTGGCAGGCCCTGGCTTCGCTCCTGATGACAGGCTTGATGGTTGCTAGTTCACTTCTGCAACCGCGTTATCTGCAGGAAGTCTTAGGCGCCCTCCTTACTGGGAAATATGAAGCTATTTATAGTATCGGGGCTTGGTTGATTGGTGTGGCCGTAGTCGGTCTAGTTGCTGGTGGACTCAATGTTGTCCTCGCAGCCTATATTGCCCAAGGAGTTTCATCCGACCTTCGGGAGGATGCCTTCCGTAAAATTCAAACCTTTTCTTATGCTGATATTGAACAATTTAATGCGGGAAATCTAGTCGTTCGAATGACAAATGATATCAACCAGATTCAGAACGTTGTCATGATGACCTTCCAAATTCTTTTCAGACTTCCCCTCTTGTTCATCGGTTCGTTTATCCTAGCGGTTCAAACCTTACCTTCTCTGTGGTGGGTGATTGTTCTCATGGTAGTCTTGATTTTTGGTTTGACTGCTGTCATGATGGGAATGATGGGGCCTCGTTTTGCCAAGTTTCAAACCCTTCTTGAGCGCATCAATGCCATTGCCAAGGAAAATTTACGTGGCGTTCGTGTGGTCAAGTCCTTTGTCCAAGAAAAAGAGCAATTTGCTAAGTTTACAGAGGTCTCAGACGAGCTTCTTGGTCAAAACCTTTACATTGGTTATGCCTTTTCAGTAGTGGAACCCTTTATGATGTTGGTTGGTTACGGGGCGGTCTTCCTCTCTATTTGGCTGGTCGCGGGAATGGTTCAGTCGGATCCGTCTGTTGTTGGTTCCATCGCTTCTTTTGTTAATTACCTAAGCCAGATTATCTTTACCATTGTTATGGTTGGATTTTTGGGAAATTCTGTCAGCCGTGCCATGATTTCCATGCGTCGTATTCGAGAAATTCTTGACGCAGAGCCAGCTATGACCTTCAAGGATATCCCAGATGAAGAGTTGGTTGGAAGTCTTAGCTTTGAAAATGTGACCTTTACCTATCCAATGGACAAGGAACCGATGCTGAAAGATGTGAGCTTTACTATTGAACCTGGTCAAATGGTTGGTGTAGTTGGAGCGACTGGTGCAGGAAAGTCAACCTTGGCTCAATTGATTCCACGTCTCTTTGATCCACAGGACGGGGCCATTAAAATCGGTGGCAAGGATATTCGAGAAGTGAGTGAAGGAACCCTGCGTAAAACAGTTTCCATCGTTCTCCAACGTGCCATTCTTTTTAGTGGAACGATTGCAGATAACTTGAGACAGGGGAAGGGGAATGCTACTCTATTTGAAATGGAGCGCGCAGCCAATATTGCCCAGGCTAGTGAATTCATTCATCGTATGGAGAAAACCTTTGAAAGTCCAGTTGAAGAACGGGGAACCAATTTCTCTGGTGGACAAAAACAAAGGATGTCGATTGCGCGTGGGATTGTCAGCAATCCACGTATTCTGATTTTTGATGATTCGACCTCAGCCTTGGATGCCAAATCAGAGCGCTTGGTGCAAGAAGCTTTGAATAAGGACTTGAAGGGGACGACAACCATTATTATTGCTCAAAAAATTAGCTCGGTTGTCCATGCAGACAAGATCTTGGTTCTAAATCAAGGACGATTGATTGGTCAAGGTACGCATGCAGACTTGGTTGCCAACAATGCCGTTTACCGTGAAATCTATGAAACACAGAAATGA UPDATED fmax with 1984810 UPDATED accession with AE005672.3 UPDATED fmin with 1983115 UPDATED strand with - UPDATED NCBI_taxonomy_name with Streptococcus pneumoniae TIGR4 UPDATED NCBI_taxonomy_id with 170187 UPDATED NCBI_taxonomy_cvterm_id with 40078 UPDATED accession with AAK76137.1 UPDATED sequence with MLIQKIKTYKWQALASLLMTGLMVASSLLQPRYLQEVLGALLTGKYEAIYSIGAWLIGVAVVGLVAGGLNVVLAAYIAQGVSSDLREDAFRKIQTFSYADIEQFNAGNLVVRMTNDINQIQNVVMMTFQILFRLPLLFIGSFILAVQTLPSLWWVIVLMVVLIFGLTAVMMGMMGPRFAKFQTLLERINAIAKENLRGVRVVKSFVQEKEQFAKFTEVSDELLGQNLYIGYAFSVVEPFMMLVGYGAVFLSIWLVAGMVQSDPSVVGSIASFVNYLSQIIFTIVMVGFLGNSVSRAMISMRRIREILDAEPAMTFKDIPDEELVGSLSFENVTFTYPMDKEPMLKDVSFTIEPGQMVGVVGATGAGKSTLAQLIPRLFDPQDGAIKIGGKDIREVSEGTLRKTVSIVLQRAILFSGTIADNLRQGKGNATLFEMERAANIAQASEFIHRMEKTFESPVEERGTNFSGGQKQRMSIARGIVSNPRILIFDDSTSALDAKSERLVQEALNKDLKGTTTIIIAQKISSVVHADKILVLNQGRLIGQGTHADLVANNAVYREIYETQK UPDATED param_value with 750 " 1971 UPDATE dfrB2 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGGGTCAAAGTAGCGATGAAGCCAACGCTCCCGTTGCAGGGCAGTTTGCGCTTCCCCTGAGTGCCACCTTTGGCTTAGGGGATCGCGTACGCAAGAAATCTGGTGCCGCTTGGCAGGGTCAAGTCGTCGGTTGGTATTGCACAAAACTCACTCCTGAAGGCTATGCGGTCGAGTCCGAATCCCACCCAGGCTCAGTGCAAATTTATCCTGTGGCTGCACTTGAACGTGTGGCCTAA UPDATED fmax with 38255 UPDATED accession with DQ839391.1 UPDATED fmin with 38018 UPDATED strand with + UPDATED NCBI_taxonomy_name with uncultured bacterium UPDATED NCBI_taxonomy_id with 77133 UPDATED NCBI_taxonomy_cvterm_id with 36791 UPDATED accession with ABI20482.1 UPDATED sequence with MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGWYCTKLTPEGYAVESESHPGSVQIYPVAALERVA " 726 UPDATE PC1 beta-lactamase (blaZ) penam; antibiotic inactivation; blaZ beta-lactamase; ARO_category "UPDATED category_aro_description with blaZ beta-lactamases are Class A beta-lactamases. These beta-lactamases are responsible for penicillin resistance in Staphylococcus aureus. " 2208 UPDATE MexW antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; macrolide antibiotic; acridine dye; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; tetracycline; chloramphenicol; ARO_category "UPDATED category_aro_name with acriflavine UPDATED category_aro_description with Acriflavine is a topical antiseptic. It has the form of an orange or brown powder. It may be harmful in the eyes or if inhaled. Acriflavine is also used as treatment for external fungal infections of aquarium fish. " 1041 UPDATE MexS antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; trimethoprim; efflux pump complex or subunit conferring antibiotic resistance; diaminopyrimidine antibiotic; ciprofloxacin; fluoroquinolone antibiotic; phenicol antibiotic; chloramphenicol; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 2752 UPDATE ANT(3'')-IIa antibiotic inactivation; ANT(3''); aminoglycoside antibiotic; model_sequences "UPDATED partial with 0 UPDATED sequence with GTGGTAACGGCGCAGTGGCGGTTTTCATGGCTTCTTGTTATGACATGTTTTTTTGGGGTACAGTCTATGCCTCGGGCATCCAAGCAGCAAGCGCGTTACGCCGTGGGTCGATGTTTGATGTTATGGAGCAGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAAACATCATGAGGGAAGCGGTGATCGCCGAAGTATCGACTCAACTATCAGAGGTAGTTGGCGTCATCGAGCGCCATCTCGAACCGACGTTGCTGGCCGTACATTTGTACGGCTCCGCAGTGGATGGCGGCCTGAAGCCACACAGTGATATTGATTTGCTGGTTACGGTGACCGTAAGGCTTGATGAAACAACGCGGCGAGCTTTGATCAACGACCTTTTGGAAACTTCGGCTTCCCCTGGAGAGAGCGAGATTCTCCGCGCTGTAGAAGTCACCATTGTTGTGCACGACGACATCATTCCGTGGCGTTATCCAGCTAAGCGCGAACTGCAATTTGGAGAATGGCAGCGCAATGACATTCTTGCAGGTATCTTCGAGCCAGCCACGATCGACATTGATCTGGCTATCTTGCTGACAAAAGCAAGAGAACATAGCGTTGCCTTGGTAGGTCCAGCGGCGGAGGAACTCTTTGATCCGGTTCCTGAACAGGATCTATTTGAGGCGCTAAATGAAACCTTAACGCTATGGAACTCGCCGCCCGACTGGGCTGGCGATGAGCGAAATGTAGTGCTTACGTTGTCCCGCATTTGGTACAGCGCAGTAACCGGCAAAATCGCGCCGAAGGATGTCGCTGCCGACTGGGCAATGGAGCGCCTGCCGGCCCAGTATCAGCCCGTCATACTTGAAGCTAGACAGGCTTATCTTGGACAAGAAGAAGATCGCTTGGCCTCGCGCGCAGATCAGTTGGAAGAATTTGTCCACTACGTGAAAGGCGAGATCACCAAGGTAGTCGGCAAATAA UPDATED fmax with 1194 UPDATED accession with X02340.1 UPDATED fmin with 222 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with CAA26199.1 UPDATED sequence with MVTAQWRFSWLLVMTCFFGVQSMPRASKQQARYAVGRCLMLWSSNDVTQQGSRPKTKLNIMREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK " 2066 UPDATE Escherichia coli soxS with mutation conferring antibiotic resistance penem; antibiotic target alteration; tetracycline antibiotic; antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; reduced permeability to antibiotic; carbapenem; cephalosporin; cefalotin; ciprofloxacin; protein(s) and two-component regulatory system modulating antibiotic efflux; rifampin; ampicillin; penam; triclosan; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; tigecycline; glycylcycline; General Bacterial Porin with reduced permeability to beta-lactams; monobactam; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; rifamycin antibiotic; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 1474 UPDATE MexR sulfonamide antibiotic; penem; panipenem; antibiotic target alteration; tetracycline antibiotic; clavulanate; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; protein(s) and two-component regulatory system modulating antibiotic efflux; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; amoxicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 1820 UPDATE bacA peptide antibiotic; undecaprenyl pyrophosphate related proteins; bacitracin B; bacitracin F; bacitracin A; antibiotic target alteration; ARO_description "UPDATED ARO_description with The bacA gene product (BacA) recycles undecaprenyl pyrophosphate during cell wall biosynthesis which confers resistance to bacitracin. " 1005 UPDATE Escherichia coli soxR with mutation conferring antibiotic resistance tetracycline antibiotic; antibiotic target alteration; antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; cephalosporin; cefalotin; ciprofloxacin; protein(s) and two-component regulatory system modulating antibiotic efflux; rifampin; ampicillin; penam; triclosan; efflux pump complex or subunit conferring antibiotic resistance; tigecycline; glycylcycline; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; rifamycin antibiotic; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 2063 UPDATE blaR1 penam; antibiotic inactivation; blaZ beta-lactamase; ARO_category "UPDATED category_aro_description with blaZ beta-lactamases are Class A beta-lactamases. These beta-lactamases are responsible for penicillin resistance in Staphylococcus aureus. " 2693 UPDATE Type B NfxB penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; ofloxacin; trimethoprim; aminocoumarin antibiotic; novobiocin; macrolide antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; gentamicin C; chloramphenicol; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 2691 UPDATE Type A NfxB penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; ofloxacin; trimethoprim; aminocoumarin antibiotic; novobiocin; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; tetracycline; chloramphenicol; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 431 UPDATE Escherichia coli marR mutant conferring antibiotic resistance penam; antibiotic efflux; triclosan; rifampin; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; antibiotic target alteration; tetracycline antibiotic; cephalosporin; cefalotin; tigecycline; glycylcycline; ampicillin; fluoroquinolone antibiotic; rifamycin antibiotic; phenicol antibiotic; tetracycline; chloramphenicol; model_description "UPDATED model_description with This model detects protein overexpression based on the presence of mutations. The detection of the protein without an associated mutation indicates that the protein is likely to be expressed at low or basal levels. The detection of the protein with the mutation indicates that the protein is likely overexpressed. This model reflects how certain proteins are functional with and without mutations. For example, efflux pump subunits and regulators are functional with mutations and without mutations. Without mutations, efflux pump subunits and regulators are usually expressed at a low level. When an efflux pump regulator has a mutation, it can cause the overexpression of the efflux pump it is responsible for regulating, leading to resistance to specific drugs. Protein overexpression models have two parameters: a curated BLASTP cutoff, and a curated set of mutations (single resistance variants, frameshift mutations, indels, etc.) shown clinically to confer resistance. This model type is a combination of the protein homolog and protein variant model. A detected hit can be categorized as Perfect, Strict, or Loose with no mutation(s) or as Strict or Loose with mutation(s). " 2325 DELETE Mrx antibiotic inactivation; macrolide phosphotransferase (MPH); macrolide antibiotic; N/A N/A 3258 ADD dfrA27 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3259 ADD dfrA28 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3267 ADD Clostridium difficile murG with mutation conferring resistance to vancomycin glycopeptide antibiotic; antibiotic target alteration; vancomycin; murG transferase; N/A N/A 3266 ADD CAM-1 penam; carbapenem; imipenem; cephalosporin; doripenem; cefotaxime; ceftazidime; antibiotic inactivation; cephamycin; CAM beta-lactamase; piperacillin; tazobactam; ceftolozane; cefoxitin; meropenem; N/A N/A 3254 ADD NDM-11 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; N/A N/A 3255 ADD dfrA6 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3256 ADD dfrA9 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3257 ADD dfrB5 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3261 ADD dfr-lie iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3260 ADD dfrA30 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3263 ADD dfrA32 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3262 ADD dfrA29 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3272 ADD PNGM-1 carbapenem; penam; cephalosporin; PNGM beta-lactamase; antibiotic inactivation; N/A N/A 3264 ADD dfrB7 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3270 ADD dfrA18 iclaprim; trimethoprim; brodimoprim; tetroxoprim; diaminopyrimidine antibiotic; antibiotic target replacement; trimethoprim resistant dihydrofolate reductase dfr; N/A N/A 3271 ADD ICR-Mo peptide antibiotic; antibiotic target alteration; colistin B; intrinsic colistin resistant phosphoethanolamine transferase; colistin A; N/A N/A 3269 ADD Clostridium difficile rpoB with mutation conferring resistance to rifampicin rifampin; rifapentine; rifabutin; peptide antibiotic; rifamycin-resistant beta-subunit of RNA polymerase (rpoB); antibiotic target replacement; antibiotic target alteration; rifamycin antibiotic; rifaximin; N/A N/A 3268 ADD Clostridium difficile gyrB conferring resistance to fluoroquinolone fluoroquinolone resistant gyrB; clorobiocin; aminocoumarin antibiotic; novobiocin; Clofazimine; clinafloxacin; coumermycin A1; ciprofloxacin; antibiotic target alteration; fluoroquinolone antibiotic; fleroxacin; cinoxacin; N/A N/A