{"$update": {"2852": {"$update": {"model_sequences": {"$update": {"sequence": {"6225": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCTGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057742.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18013.1", "sequence": "GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNLSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}}}}, "343": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1801": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "813": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1148": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "816": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2910": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2858": {"$update": {"model_sequences": {"$update": {"sequence": {"6230": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGACCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTTCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCAAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057748.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18019.1", "sequence": "GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAKGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}}}}, "2912": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2913": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "714": {"$update": {"model_sequences": {"$update": {"sequence": {"6212": {"dna_sequence": {"partial": "0", "sequence": "ATGGAACGAAGTAGCAATGAAGTCAGTAATCCAGTTGCTGGCAATTTTGTATTCCCATCGAACGCCACGTTTGGTATGGGAGATCGCGTGCGCAAGAAATCCGGCGCCGCCTGGCAAGGTCAGATTGTCGGGTGGTACTGCACAAATTTGACCCCCGAAGGCTACGCCGTCGAGTCTGAGGCTCACCCAGGCTCAGTACAGATTTATCCTGTTGCGGCGCTTGAACGCATCAACTGA", "fmax": "953", "accession": "U36276.1", "fmin": "716", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "AAA82255.1", "sequence": "MERSSNEVSNPVAGNFVFPSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN"}}}}}}}, "2855": {"$update": {"model_sequences": {"$update": {"sequence": {"6227": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGTCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCCCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCATTGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057745.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18016.1", "sequence": "GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPIAERVKIAYAILSGLEQQGKVPLKR"}}}}}}}, "2854": {"$update": {"model_sequences": {"$update": {"sequence": {"6226": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCCCTACGGGTCGGTCCCCGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCATGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057744.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18015.1", "sequence": "GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPRPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}}}}, "2857": {"$update": {"model_sequences": {"$update": {"sequence": {"6229": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGACCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCACTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTTCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCCGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057747.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18018.1", "sequence": "GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSHFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPRPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}}}}, "2856": {"$update": {"model_sequences": {"$update": {"sequence": {"6228": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGACCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTTCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCCGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057746.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18017.1", "sequence": "GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPRPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}}}}, "1496": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3334": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "3338": {"$update": {"ARO_category": {"$delete": ["36999", "35956", "35924"]}}}, "1068": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "916": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1706": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1065": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "295": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1660": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1128": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1083": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1122": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "191": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "190": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1126": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "274": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "18": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "521": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "523": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1403": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1402": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1016": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1406": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1235": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "36996", "35924"]}}}, "441": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1238": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "444": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "104": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "902": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2047": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2041": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1841": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1840": {"$update": {"model_sequences": {"$update": {"sequence": {"6218": {"dna_sequence": {"partial": "1", "sequence": "GGGCCCGGACACCTTTTTGCTTTTAATTACGGAACTGATTTCATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGCTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1188", "accession": "AB587082", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "BAJ17544.1", "sequence": "GPGHLFAFNYGTDFMMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHASPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}}}}, "_version": "3.1.1", "2048": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1844": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1536": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1532": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "439": {"$update": {"model_sequences": {"$update": {"sequence": {"6222": {"dna_sequence": {"partial": "1", "sequence": "AAGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGGATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "861", "accession": "AM176558", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAJ47138.2", "sequence": "KRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR"}}}}}}}, "649": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "430": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "339": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "213": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3800": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1909": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1902": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3452": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3450": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3451": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "850": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3457": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3454": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "853": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3513": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3512": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3511": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3459": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3517": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3516": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3515": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3514": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "555": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "554": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3467": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3466": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3441": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "96": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1995": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1625": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3500": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2860": {"$update": {"model_sequences": {"$update": {"sequence": {"6231": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCTGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057750.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18021.1", "sequence": "GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNLSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2861": {"$update": {"model_sequences": {"$update": {"sequence": {"6232": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGCTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCCTGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057751.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18022.1", "sequence": "GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQLPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLLEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2862": {"$update": {"model_sequences": {"$update": {"sequence": {"6233": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGCGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGCCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057752.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18023.1", "sequence": "GEAPADRLKALVDAAVQPAMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRAGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2863": {"$update": {"model_sequences": {"$update": {"sequence": {"6234": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGCGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGCCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCATTGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057753.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18024.1", "sequence": "GEAPADRLKALVDAAVQPAMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRAGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPIAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2864": {"$update": {"model_sequences": {"$update": {"sequence": {"6235": {"dna_sequence": {"partial": "1", "sequence": "GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCCATGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057754.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18025.1", "sequence": "GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGHGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2866": {"$update": {"model_sequences": {"$update": {"sequence": {"6236": {"dna_sequence": {"partial": "1", "sequence": "GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCTTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCATTGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057756.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18027.1", "sequence": "DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPIAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2867": {"$update": {"model_sequences": {"$update": {"sequence": {"6237": {"dna_sequence": {"partial": "1", "sequence": "GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCTTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1110", "accession": "KR057757.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18028.1", "sequence": "DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2868": {"$update": {"model_sequences": {"$update": {"sequence": {"6238": {"dna_sequence": {"partial": "1", "sequence": "GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGTCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCAATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGGCGCTGCAGCCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1107", "accession": "KR057758.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18029.1", "sequence": "DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2869": {"$update": {"model_sequences": {"$update": {"sequence": {"6239": {"dna_sequence": {"partial": "1", "sequence": "GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCCGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACTCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1107", "accession": "KR057759.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18030.1", "sequence": "DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "3633": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "239": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "235": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3468": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "230": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "231": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1050": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1052": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1190": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3340": {"$update": {"ARO_category": {"$delete": ["35926", "35953", "36998", "36999", "35956", "35932", "36996", "35924"]}}}, "1194": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1196": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1694": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1692": {"$update": {"model_sequences": {"$update": {"sequence": {"6139": {"dna_sequence": {"partial": "0", "sequence": "ATGAAAATTATTAATATTGGAGTTTTAGCTCATGTTGATGCGGGAAAAACTACCTTAACAGAAAGCTTATTATATAACAGTGGAGCGATTACAGAATTAGGAAGCGTGGACAAAGGTACAACGAGGACGGATAATACGCTTTTAGAACGTCAGAGAGGAATTACAATTCAGACAGGAATAACCTCTTTTCAGTGGGAAAATACGAAGGTGAACATCATAGACACGCCAGGACATATGGATTTCTTAGCAGAAGTATATCGTTCATTATCAGTTTTAGATGGGGCAATTCTACTGATTTCTGCAAAAGATGGCGTACAAGCACAAACTCGTATATTATTTCATGCACTTAGGAAAATGGGGATTCCCACAATCTTTTTTATCAATAAGATTGACCAAAATGGAATTGATTTATCAACGGTTTATCAGGATATTAAAGAGAAACTTTCTGCCGAAATTGTAATCAAACAGAAGGTAGAACTGTATCCTAATATGTGTGTGACGAACTTTACCGAATCTGAACAATGGGATACGGTAATAGAGGGAAACGATGACCTTTTAGAGAAATATACGTCTGGGAAATTATTGGAAGCATTAGAACTCGAACAAGAGGAAAGCATAAGATTTCATAATTGTTCCCTGTTCCCTGTTTATCACGGAAGTGCAAAAAACAATATAGGGATTGATAACCTTATAGAAGTGATTACGAATAAATTTTATTCATCAACACATCGAGGTCAGTCTGAACTTTGCGGAAAAGTTTTCAAAATTGAATATACAAAAAAAAGACAACGTCTTGCATATATACGCCTTTATAGTGGAGTACTACATTTACGAGATTCGGTTAGAGTATCAGAAAAAGAAAAAATAAAAGTTACAGAAATGTATACTTCAATAAATGGTGAATTATGTAAGATTGATAGAGCTTATTCTGGAGAAATTGTTATTTTGCAAAATGAGTTTTTGAAGTTAAATAGTGTTCTTGGAGATACAAAACTATTGCCACAGAGAAAAAAGATTGAAAATCCGCACCCTCTACTACAAACAACTGTTGAACCGAGTAAACCTGAACAGAGAGAAATGTTGCTTGATGCCCTTTTGGAAATCTCAGATAGTGATCCGCTTCTACGATATTACGTGGATTCTACGACACATGAAATTATACTTTCTTTCTTAGGGAAAGTACAAATGGAAGTGATTAGTGCACTGTTGCAAGAAAAGTATCATGTGGAGATAGAACTAAAAGAGCCTACAGTCATTTATATGGAGAGACCGTTAAAAAATGCAGAATATACCATTCACATCGAAGTGCCGCCAAATCCTTTCTGGGCTTCCATTGGTTTATCTGTATCACCGCTTCCGTTGGGAAGTGGAATGCAGTATGAGAGCTCGGTTTCTCTTGGATACTTAAATCAATCATTTCAAAATGCAGTTATGGAGGGGATACGCTATGGCTGTGAACAAGGATTGTATGGTTGGAATGTGACGGACTGTAAAATCTGTTTTAAGTATGGCTTATACTATAGCCCTGTTAGTACCCCAGCAGATTTTCGGATGCTTGCTCCTATTGTATTGGAACAAGTCTTAAAAAAAGCTGGAACAGAATTGTTAGAGCCATATCTTAGTTTTAAAATTTATGCGCCACAGGAATATCTTTCACGAGCATACAACGATGCTCCTAAATATTGTGCGAACATCGTAGACACTCAATTGAAAAATAATGAGGTCATTCTTAGTGGAGAAATCCCTGCTCGGTGTATTCAAGAATATCGTAGTGATTTAACTTTCTTTACAAATGGACGTAGTGTTTGTTTAACAGAGTTAAAAGGGTACCATGTTACTACCGGTGAACCTGTTTGCCAGCCCCGTCGTCCAAATAGTCGGATAGATAAAGTACGATATATGTTCAATAAAATAACTTAG", "fmax": "1945", "accession": "AB039845.1", "fmin": "25", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Erysipelothrix rhusiopathiae", "NCBI_taxonomy_id": "1648", "NCBI_taxonomy_cvterm_id": "43311"}, "protein_sequence": {"accession": "BAB82500.1", "sequence": "MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDGVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIEGNDDLLEKYTSGKLLEALELEQEESIRFHNCSLFPVYHGSAKNNIGIDNLIEVITNKFYSSTHRGQSELCGKVFKIEYTKKRQRLAYIRLYSGVLHLRDSVRVSEKEKIKVTEMYTSINGELCKIDRAYSGEIVILQNEFLKLNSVLGDTKLLPQRKKIENPHPLLQTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGKVQMEVISALLQEKYHVEIELKEPTVIYMERPLKNAEYTIHIEVPPNPFWASIGLSVSPLPLGSGMQYESSVSLGYLNQSFQNAVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYSPVSTPADFRMLAPIVLEQVLKKAGTELLEPYLSFKIYAPQEYLSRAYNDAPKYCANIVDTQLKNNEVILSGEIPARCIQEYRSDLTFFTNGRSVCLTELKGYHVTTGEPVCQPRRPNSRIDKVRYMFNKIT"}}}}}}}, "1690": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1758": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1750": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "146": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1176": {"$update": {"model_param": {"$update": {"41343": {"$update": {"param_value": {"$insert": {"10007": "nt1384-1:A"}}}}, "40394": {"$update": {"param_value": {"$insert": {"10019": "W91STOP"}}}}, "snp": {"$update": {"param_value": {"$insert": {"10001": "A312P", "10002": "N660D", "10003": "L147P", "10018": "G33V", "10012": "G125S", "10010": "N508D", "10017": "G111S", "10016": "H417Q", "10015": "E607A", "10014": "Q461P"}}, "clinical": {"$insert": {"10001": "A312P", "10002": "N660D", "10003": "L147P", "10018": "G33V", "10012": "G125S", "10010": "N508D", "10017": "G111S", "10016": "H417Q", "10015": "E607A", "10014": "Q461P"}}}}, "40330": {"$update": {"param_value": {"$insert": {"10004": "C20R, S315T", "10005": "S211G, S315T", "10006": "S315T, V581G", "10008": "S315T, G466R", "10009": "G279V, L436P", "10013": "V431A, G490S", "10011": "P92S, S315T"}}}}}}}}, "145": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1172": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "140": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1271": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "611": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "617": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1276": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "615": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1882": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1881": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1281": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "947": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "942": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1288": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1814": {"$update": {"ARO_category": {"$delete": ["35926", "35924"]}}}, "685": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1572": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "686": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1577": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1576": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1575": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1574": {"$update": {"model_param": {"$update": {"snp": {"$update": {"param_value": {"$insert": {"10055": "G141E"}}, "clinical": {"$insert": {"10055": "G141E"}}}}}, "$insert": {"43012": {"param_value": {"10056": "G3G"}, "param_type_id": "43012", "param_type": "no association with resistance TB", "param_description": "This parameter is part of a confidence model for AMR developed by the Relational Sequencing Tuberculosis Data platform (ReSeqTB, https://platform.reseqtb.org). The confidence model is based on the likelihood ratio test (LR+) statistic that is used to evaluate whether mutations are positively or negatively associated with phenotypic resistance. The LR+ is derived from a drug susceptibility test, testing sensitivity and specificity. Under the null hypothesis of no association, the LR value is expected to be 1, but deviations from this can be due to an association with resistance or a low number of available isolate samples.  The LR+ measures the strength of association between the presence of a mutation and the drug resistance phenotype. A mutation graded as no association has no association of the mutation with phenotypic drug resistance. There is no evidence of an association between the mutation and drug resistance. LR is less than 1. These data are not visible on the CARD website, included in RGI analyses, nor available in CARD download files."}}}}}, "3416": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3417": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3415": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3412": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3413": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3410": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3411": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "497": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3418": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3419": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1833": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1831": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1836": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "21": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "23": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "28": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3792": {"$update": {"ARO_category": {"$insert": {"35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}}}}}, "407": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1370": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "405": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "404": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2019": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1379": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "931": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2016": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "937": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "935": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "408": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1343": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1955": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1952": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "457": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "379": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "147": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2909": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "397": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "394": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "795": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1717": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1716": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1715": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1659": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1653": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1651": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1657": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1132": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "243": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "924": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1003": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1002": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1000": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "623": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1226": {"$update": {"model_sequences": {"$update": {"sequence": {"6249": {"dna_sequence": {"partial": "0", "sequence": "ATGTCATTTTCCCGCAAACAGTTTGCACTGTCTGCCATCTTTGTCGCTATTTTAGCAACCGGTGGCAGTTTTATGTTGTTACATGAAAATGCCGATGCAAAAGCTGCACCAACCGCTGCCCAACAAGCTGCTACTGTTGATGTAGCCCCAGTAGTAAGCAAAACCATTACCGATTGGCAAGAATATTCCGGTCGTTTAGAAGCAATTGATCAAGTTGATATTCGGCCTCAAGTTTCAGGAAAACTTATTGCCGTACATTTCAAAGATGGAAGCCTCGTTAAAAAAGGTGATTTACTTTTCACAATCGACCCTCGTCCTTTTGAAGCAGAACTGAACCGTGCAAAAGCCCAACTTGCTTCAGCTGAAGCACAGGTAACATATACCGCAAGCAATCTTTCGCGTATTCAACGTCTCATTCAGAGTAATGCTGTTTCTCGCCAAGAACTGGATTTAGCCGAAAATGATGCACGTTCAGCGAATGCTAACCTACAAGCCGCTAGAGCTGCTGTCCAATCTGCACGTTTAAATCTAGAATACACCCGTATTACAGCACCTGTCAGCGGCCGGATTTCACGAGCTGAAGTCACCGTTGGTAATGTAGTTTCTGCAGGTAACGGCGCACAGGTTTTAACAAGTTTAGTGTCTGTATCCCGCCTTTATGCATCTTTCGATGTTGATGAACAAACTTACCTGAAATATATCAGTAATCAGCGTAATTCAGCACAAGTACCTGTCTATATGGGACTTGCCAATGAAACAGGCTTTACTCGTGAAGGTACAATCAACTCAATCGATAACAATCTGAATACAACCTCAGGTACGATCCGTGTTCGCGCAACTTTTGACAATCCAAACGGTGTTTTATTACCAGGCCTATATGCACGAATTCGTTTAGGTGGAGGCCAACCTCGCCCAGCGATTCTGATTAGTCCAACCGCGGTTGGTGTCGACCAAGATAAACGTTTTGTCGTAGTAGTAGATGCGAAAAATCAAACTGCTTATCGCGAAGTAAAACTCGGTGCCCAACAAGATGGCTTGCAAATCGTAAATAGCGGATTACAAGCGGGTGATCGTATTGTAGTGAATGGTTTACAACGGATTCGTCCGGGTGACCCTGTTACACCGCATCTCGTCCCTATGCCAAATTCACAAATCACTGCTAGCGCTACTCCTCCTCAACCTCAGCCAACAGATAAAACATCAACTCCGGCAAAAGGTTAA", "fmax": "1221", "accession": "CT025800.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter baumannii AYE", "NCBI_taxonomy_id": "509173", "NCBI_taxonomy_cvterm_id": "35535"}, "protein_sequence": {"accession": "CAJ77857.1", "sequence": "MSFSRKQFALSAIFVAILATGGSFMLLHENADAKAAPTAAQQAATVDVAPVVSKTITDWQEYSGRLEAIDQVDIRPQVSGKLIAVHFKDGSLVKKGDLLFTIDPRPFEAELNRAKAQLASAEAQVTYTASNLSRIQRLIQSNAVSRQELDLAENDARSANANLQAARAAVQSARLNLEYTRITAPVSGRISRAEVTVGNVVSAGNGAQVLTSLVSVSRLYASFDVDEQTYLKYISNQRNSAQVPVYMGLANETGFTREGTINSIDNNLNTTSGTIRVRATFDNPNGVLLPGLYARIRLGGGQPRPAILISPTAVGVDQDKRFVVVVDAKNQTAYREVKLGAQQDGLQIVNSGLQAGDRIVVNGLQRIRPGDPVTPHLVPMPNSQITASATPPQPQPTDKTSTPAKG"}}}}}}}, "620": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1221": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "450": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1341": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "628": {"$update": {"model_sequences": {"$update": {"sequence": {"6208": {"dna_sequence": {"partial": "0", "sequence": "ATGACCAACTATTTTGAAAGTCCATTTAAAGGCAAACTGCTGGCCGACCAGGTAAAGAACCCGAACATCAAAGTCGGACGGTATAGCTATTATTCCGGCTATTACCATGGCCATTCGTTTGACGAGTGCGCTCGCTTTCTCTTGCCAGATCGCAATGACATCGACCAACTGATCGTTGGTAGCTTCTGTTCCATCGGCACGGGCGCCTCCTTCATCATGGCCGGAAATCAGGGGCACCGTTATGACTGGGCGTCTTCTTTTCCCTTCTTCTACATGAAAGAGGAGCCAGCATTCTCGGGCGCACTTGATGCATTCCAAAAAGCCGGTGACACAGTCATCGGAAGTGATGTCTGGATAGGCTCTGAGGCCATGATCATGCCCGGCATCAACGTCGGTCATGGCGCTGTGATTGGAAGCCGCGCTTTGGTCACGAAAGATGTGGAGCCGTACACTATCGTTGGCGGAAATCCCGCCAAACCGATCAAGAAACGCTTCTCCGACGAGGAGATCGCCATGCTTTTGAAAATGAATTGGTGGGATTGGCCAACTGAAAAAATTGAGGAAGCAATGCCTTTGCTATGCTCATCCAACATCGTTGGGCTGCATCGATACTGGCAAGGCTTTGCCGTCTAA", "fmax": "1365", "accession": "FJ495083.1", "fmin": "732", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "ACL13298.1", "sequence": "MTNYFESPFKGKLLADQVKNPNIKVGRYSYYSGYYHGHSFDECARFLLPDRNDIDQLIVGSFCSIGTGASFIMAGNQGHRYDWASSFPFFYMKEEPAFSGALDAFQKAGDTVIGSDVWIGSEAMIMPGINVGHGAVIGSRALVTKDVEPYTIVGGNPAKPIKKRFSDEEIAMLLKMNWWDWPTEKIEEAMPLLCSSNIVGLHRYWQGFAV"}}}}}}}, "3825": {"$update": {"ARO_category": {"$insert": {"35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}}}}}, "1347": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1874": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3824": {"$update": {"ARO_category": {"$insert": {"35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}}}}}, "1870": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1871": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "977": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2050": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "973": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "978": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "656": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "655": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "186": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "187": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "185": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "659": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "3526": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3527": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3524": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3525": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3522": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3523": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3520": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3521": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1911": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "3528": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3529": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3449": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3448": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3445": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "860": {"$update": {"model_sequences": {"$update": {"sequence": {"6246": {"dna_sequence": {"partial": "1", "sequence": "CAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATAAGTTGGGTGTACGAGTGGGTTACATCGAGCTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACCCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCAGTAAGCGTGGATCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACATGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGC", "fmax": "844", "accession": "X98047", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "CAA66659.1", "sequence": "QHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGVRVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIK"}}}}}}}, "3447": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3446": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "865": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3440": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3443": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3442": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2026": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2023": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2117": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1502": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1618": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1967": {"$update": {"model_sequences": {"$update": {"sequence": {"6248": {"dna_sequence": {"partial": "1", "sequence": "TTACTTATAACAAGCGCTATTTTTATTTCAGCCTGCTCACCTTATATAGTGTCTGCTAATCCAAATCACAGTGCTTCAAAATCTGATGACAAAGCAGAGAAAATTAAAAATTTATTTAACGAAGCACACACTACGGGTGTTTTAGTTATCCAACAAGGCCAAACTCAACAAAGCTATGGTAATGATCTTGCTCGTGCTTCGACCGAGTATGTACCTGCTTCGACCTTCAAAATGCTTAATGCTTTGATCGGCCTTGAGCACCATAAGGCAACCACTACAGAAGTATTTAAGTGGGACGGGCAAAAAAGGCTATTCCCAGAATGGGAAAAGAACATGACCCTAGGCGATGCTATGAAAGCTTCCGCTATTCCGGTTTATCAAGATTTAGCTCGTCGTATTGGACTTGAACTCATGTCTAATGAAGTGAAGCGTGTTGGTTATGGCAATGCAGATATCGGTACCCAAGTCGATAATTTTTGGCTGGTGGGTCCTTTAAAAATTACTCCTCAGCAAGAGGCACAGTTTGCTTACAAGCTAGCTAATAAAACGCTTCCATTTAGCCAAAAAGTCCAAGATGAAGTGCAATCCATGTTATTCATAGAAGAAAAGAATGGAAATAAAATATACGCAAAAAGTGGTTGGGGATGGGATGTAGACCCACAAGTGGGTTGGTTAACTGGATGGGTTGTTCAGCCTCAAGGGAATATTGTAGCGTTCTCCCTTAACTTAGAAATGAAAAAAGGAATACCTAGCTCTGTTCGAAAAGAGATTACTTATAAAAGTTTA", "fmax": "786", "accession": "EU220744", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter baumannii", "NCBI_taxonomy_id": "470", "NCBI_taxonomy_cvterm_id": "35507"}, "protein_sequence": {"accession": "ABW95047.1", "sequence": "LLITSAIFISACSPYIVSANPNHSASKSDDKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSL"}}}}}, "ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1610": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "326": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2872": {"$update": {"model_sequences": {"$update": {"sequence": {"6242": {"dna_sequence": {"partial": "1", "sequence": "GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCCGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1116", "accession": "KR057762.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18033.1", "sequence": "DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMAPQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2871": {"$update": {"model_sequences": {"$update": {"sequence": {"6241": {"dna_sequence": {"partial": "1", "sequence": "GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1110", "accession": "KR057761.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18032.1", "sequence": "DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMAPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2870": {"$update": {"model_sequences": {"$update": {"sequence": {"6240": {"dna_sequence": {"partial": "1", "sequence": "GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCTTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1104", "accession": "KR057760.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AKR18031.1", "sequence": "DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSLQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}}}}, "2877": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2876": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "209": {"$update": {"ARO_category": {"$delete": ["35926", "35953", "36998", "36999", "35956", "35932", "36996", "35924"]}}}, "779": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3356": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "73": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1040": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1047": {"$update": {"model_sequences": {"$update": {"sequence": {"6245": {"dna_sequence": {"partial": "1", "sequence": "TTTACGAATATACCTTGCACATACAGTATGACTGTTAAATTGGATATTACACAAATAAAAAAGAAACGAATGAAATTATACCCTGCGATGCTTTATTATCTTGCAACGATTGTAAACCGTCATTCAGAGTTTAGAACGGCAATTAATCAGGAGGGTGAACTGGGAATATATGACGAGATGATACCCAGCTATACCATATTCCATGAGGACACAGAGACATTTTCCAACCTTTGGACACCATACATACCAGATTTTGAAGCATTTTCTATGGCGTATGCGAATGATATGCAAAGGTATGGAAGCAATTATGGAATGATAGGAAAACCAGATATACCAGAAAATGTTTTTAATGTATCGATGATACCATGGTCAACCTTCGATAGCTTTAATCTGAATTTGCAGAAAGGATATGATTATTTGATTCCTATTTTTACGATGGGGAAATATTACAGAGATGATGAAAAAATCATACTTCCTCTCGCCATCCAAGTT", "fmax": "492", "accession": "X74948", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Streptococcus pyogenes", "NCBI_taxonomy_id": "1314", "NCBI_taxonomy_cvterm_id": "36764"}, "protein_sequence": {"accession": "CAA52904.1", "sequence": "FTNIPCTYSMTVKLDITQIKKKRMKLYPAMLYYLATIVNRHSEFRTAINQEGELGIYDEMIPSYTIFHEDTETFSNLWTPYIPDFEAFSMAYANDMQRYGSNYGMIGKPDIPENVFNVSMIPWSTFDSFNLNLQKGYDYLIPIFTMGKYYRDDEKIILPLAIQV"}}}}}}}, "1596": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1686": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1761": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1764": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1765": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1143": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1269": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1141": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3498": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3499": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3496": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3497": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3494": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3495": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3492": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3493": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3490": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3491": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3653": {"$update": {"model_sequences": {"$update": {"sequence": {"6282": {"dna_sequence": {"partial": "0", "sequence": "ATGACAAGATCTGCCCTTTTGATTCCACTCACCACGGCGGCTATCGCGCTAAACGCAATATCGCCGGTTTATGCGAGCGACACCCATTCTATTGATGATACCGTAAAACAGGTTGAAACCACGCTGGGAGCAAAAGTGGGTATAGCCGTCCTGGACACCGGGTCTCAACGTGCCTGGTTCCACCGTGCTGATGACCGTTTCCCGATGGCGAGCACATCCAAAGCTCTGACCTGTGCAGCGCTGTTGGATAAAGGTCAGAGCTTTATGAATAAAGAGGCCTTGATCAAAAAGGCGGACCTGGATGAATATGCACCAGTGACATCCGGCATAGTCGGCAAAAAAGTAAGTGCGGCTGACCTTTGCAGCATTACCATGCGTACAAGTGACAATACCGCCGTCAACAAAGTTCTTGAAATCCTGGGAGGACCGCAAGCTGTAACCGCTTATTTGCGCAAGACAGGTGATAACATTACTCGACTTGACAGAAATGAACCGGACCTCAACGAAGGAACGCCTGGAGACGTGCGCGACACGACAACGCCTCGCGCTATTCTCGAAACACTTAATAAACTGGTACTGGGCCCCACTCTTGGCTCTGACGAGCGAAAACAACTCACAACCTGGCTTGAAAGTAATGAGGTTGGTGACCCTTTGCTGCGCGCTGGAGTTCCTTCTGATTGGCGCGTCGCCGATCGAACTGGCGCTGGAGGTAACGGGACGCGTGGGGTGATTGCCGTCATGTGGCCGCCAAAACACGCGCCAATCATTGCTGCGATTTACATTACACAGACGAAAGCCACTATGGAGGAAAGGAACGCTGCCATCGCCTCTATTGGCAAAGCGATTGCTGCCGAAGTTCTGGAATAA", "fmax": "1988", "accession": "EF063111.1", "fmin": "1121", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter baumannii", "NCBI_taxonomy_id": "470", "NCBI_taxonomy_cvterm_id": "35507"}, "protein_sequence": {"accession": "ABL75133.1", "sequence": "MTRSALLIPLTTAAIALNAISPVYASDTHSIDDTVKQVETTLGAKVGIAVLDTGSQRAWFHRADDRFPMASTSKALTCAALLDKGQSFMNKEALIKKADLDEYAPVTSGIVGKKVSAADLCSITMRTSDNTAVNKVLEILGGPQAVTAYLRKTGDNITRLDRNEPDLNEGTPGDVRDTTTPRAILETLNKLVLGPTLGSDERKQLTTWLESNEVGDPLLRAGVPSDWRVADRTGAGGNGTRGVIAVMWPPKHAPIIAAIYITQTKATMEERNAAIASIGKAIAAEVLE"}}}}}}}, "2525": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "693": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "690": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "544": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1314": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1312": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "993": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "3405": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3407": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3406": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3409": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3408": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1821": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "414": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "861": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "416": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "412": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "413": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1384": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "922": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1387": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "418": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "927": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3827": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3826": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "319": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "318": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3823": {"$update": {"ARO_category": {"$insert": {"35919": {"category_aro_name": "macrolide antibiotic", "category_aro_cvterm_id": "35919", "category_aro_accession": "0000000", "category_aro_class_name": "Drug Class", "category_aro_description": "Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins."}}}}}, "313": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "312": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3276": {"$update": {"model_name": "Staphylococcus aureus LmrS"}}, "867": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1928": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3474": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3475": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3476": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3477": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3470": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3471": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3472": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3473": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3478": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3479": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "360": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "361": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3319": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "385": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3799": {"$update": {"ARO_category": {"$insert": {"36192": {"category_aro_name": "peptide antibiotic", "category_aro_cvterm_id": "36192", "category_aro_accession": "3000053", "category_aro_class_name": "Drug Class", "category_aro_description": "Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36242": {"category_aro_name": "aminocoumarin antibiotic", "category_aro_cvterm_id": "36242", "category_aro_accession": "3000103", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminocoumarin antibiotics bind DNA gyrase subunit B to inhibit ATP-dependent DNA supercoiling."}, "36296": {"category_aro_name": "rifamycin antibiotic", "category_aro_cvterm_id": "36296", "category_aro_accession": "3000157", "category_aro_class_name": "Drug Class", "category_aro_description": "Rifamycin antibiotics are a group of broad-spectrum ansamycin antibiotics that inhibit bacterial RNA polymerase by binding to a highly conserved region, blocking the oligonucleotide exit tunnel, and preventing the extension of nascent mRNAs."}}}}}, "784": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1641": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "782": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "573": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "572": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3755": {"$update": {"ARO_category": {"$insert": {"36193": {"category_aro_name": "acridine dye", "category_aro_cvterm_id": "36193", "category_aro_accession": "3000054", "category_aro_class_name": "Drug Class", "category_aro_description": "Acridine dyes are cell permeable, basic molecules with an acridine chromophore. These compounds intercalate DNA. The image shown represents the core structure of the acridine family, with specific dyes containing varying substituents."}}}}}, "574": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "61": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "258": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "63": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924"]}}}, "67": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "254": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2202": {"$update": {"ARO_category": {"$delete": ["35926", "35953", "36998", "36999", "35956", "35932", "36996", "35924"]}}}, "1587": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "730": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "732": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1032": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "738": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "500": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2001": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1212": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1359": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "633": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1217": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1352": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2422": {"$update": {"model_sequences": {"$update": {"sequence": {"6247": {"dna_sequence": {"partial": "1", "sequence": "TTAGATACGTGTCGCATATTCAGGAGGAATGCTAAATCACCAGTAAATATTGCAAAGCATGCAAAATTCATTAGGAGACTTAAATGGTTATGTTCAGAAAATATGACTGGGTTCAGTGTCTTAAAACTATATGTTCGGAAAAAGAAACCCTTGAAAGGCTTTAAACAAGTCAATCATCGTTTTAAATGGTTTGGCTTCAAAGCATCCTTTATCTCAGGATTAATGTTGCCATTGGTTCAAATGACCGCTTATGGGACCTATATCGGGGTAGCTGTCCTTGGTAGTTACTATGTGGTTGCTGGTGTGATCGTAGTGGGGCAGTTACAAGCGTTTATTCAATATATTTGGCAAATTAGCCAACCAATGGGGAATATTACGCAGTTGTCTGCAGCTTTACAAAGCGCTTCAGCTTCGACCATGCGGATTTTTGAAATCCTAGATGAACCAGAAGAAGAACTTAACGAACAAGATGTTCCTTTGCCAGAACCTATTTTAGGCTCTGTTGAATTTGAAAATGTCAGCTTTAGTTATGACCCAGAAAAACCGTTAATTCGTAATTTGAACTTTAAAGTTGATGCGGGCCAAATGGTTGCGATTGTGGGACCAACTGGCGCTGGGAAAACAACCTTAATCAACTTACTGATGCGTTTTTATGATGTAACAGAAGGCGCCATTAAAATTGATGGTATTGACACAAAAAAAATGAACCGTAGTGATGTCCGATCTGTATTTGGAATGGTATTGCAAGATGCTTGGTTGTATAAAGGTACCATTGCAGATAACATTCGTTTTGGGAAGTTGGATGCCACGGATTATGAAGTTGTCGATGCAGCGAAAACGGCCAATGTGGATCACTTCATTCGGACAATGCCAGATGGGTATGAAATGGAAATCAATTCTGAGGGAGATAACGTTTCCCTTGGTCAAAAACAATTGTTGACCATTGCCCGAGCGGTAATTTCTGATCCGAAAATTTTGATTTTAGATGAGGCGACTAGTTCAGTCGATACACGCTTGGAAGCCTTAATTCAAAAAGCAATGGATCGTGTTATGGAAGGACGAACGAGTTTCGTTATTGCCCACCGT", "fmax": "1086", "accession": "HG970103.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Enterococcus faecium", "NCBI_taxonomy_id": "1352", "NCBI_taxonomy_cvterm_id": "36779"}, "protein_sequence": {"accession": "CDO61516.1", "sequence": "LDTCRIFRRNAKSPVNIAKHAKFIRRLKWLCSENMTGFSVLKLYVRKKKPLKGFKQVNHRFKWFGFKASFISGLMLPLVQMTAYGTYIGVAVLGSYYVVAGVIVVGQLQAFIQYIWQISQPMGNITQLSAALQSASASTMRIFEILDEPEEELNEQDVPLPEPILGSVEFENVSFSYDPEKPLIRNLNFKVDAGQMVAIVGPTGAGKTTLINLLMRFYDVTEGAIKIDGIDTKKMNRSDVRSVFGMVLQDAWLYKGTIADNIRFGKLDATDYEVVDAAKTANVDHFIRTMPDGYEMEINSEGDNVSLGQKQLLTIARAVISDPKILILDEATSSVDTRLEALIQKAMDRVMEGRTSFVIAHR"}}}}}}}, "461": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1356": {"$update": {"model_sequences": {"$update": {"sequence": {"6205": {"dna_sequence": {"partial": "0", "sequence": "ATGAACCGGGAATCGGTCCGCATTTATCTGGTCGCTGCCATGGGTGCCAATCGGGTTATTGGCAATGGCCCCGACATCCCCTGGACAATCCCAGGTGAGCAGAAGATTTTTCGCAGGCTCACCGAGGGCAAAGTGGTCGTGATGGGTCGTAAGACATTTGAGTCCATAGGAAAGCCCTTACCAAGCCGCCGCACAGTGGTGCTCTCCCGCCAAGCTGGTTATAGCGCTGCTGGTTGTGCAGTTGTTTCAACGCTGTCGCAGGCTATTGCCATCGCAGCCGAACACGGCAAAGAACTCTACGTAGCCGGCGGAGCCGAGGTATATGCACTGGCACTACCTCATGCCGACGGCGTCTTTCTATCTGAGGTACATCAAACCTTCGAGGGTGACGCCTTCTTCCCTGTGCTCAACGCAGCAGAATTCGAGGTTGTCTCAGCCGAAACCGTTCAAGCCACTATCACGTACACGCACTCCGTCTATGCACGTCGTAACGGCTAA", "fmax": "603", "accession": "KF525301.1", "fmin": "105", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "uncultured bacterium", "NCBI_taxonomy_id": "77133", "NCBI_taxonomy_cvterm_id": "36791"}, "protein_sequence": {"accession": "AGY30828.1", "sequence": "MNRESVRIYLVAAMGANRVIGNGPDIPWTIPGEQKIFRRLTEGKVVVMGRKTFESIGKPLPSRRTVVLSRQAGYSAAGCAVVSTLSQAIAIAAEHGKELYVAGGAEVYALALPHADGVFLSEVHQTFEGDAFFPVLNAAEFEVVSAETVQATITYTHSVYARRNG"}}}}}}}, "608": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1860": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1862": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "160": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "163": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "964": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "965": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "967": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1728": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "962": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1100": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1517": {"$update": {"model_sequences": {"$update": {"sequence": {"6224": {"dna_sequence": {"partial": "1", "sequence": "GCAAATATTATCTACAGCAGCGCCAGTGCATCAACAGATATCTCTACTGTTGCATCTCCATTATTTGAAGGAACTGAAGGTTGTTTTTTACTTTACGATGTATCCACAAACGCTGAAATTGCTCAATTCAATAAAGCAAAGTGTGCAACGCAAATGGCACCAGATTCAACTTTCAAGATCGCATTATCACTTATGGCATTTGATGCGGAAATAATAGATCAGAAAACCATATTCAAATGGGATAAAACCCCCAAAGGAATGGAGATCTGGAACAGCAATCATACACCAAAGACGTGGATGCAATTTTCTGTTGTTTGGGTTTCGCAAGAAATAACCCAAAAAATTGGATTAAATAAAATCAAGAATTATCTCAAAGATTTTGATTATGGAAATCAAGACTTCTCTGGAGATAAAGAAAGAAACAACGGATTAACAGAAGCATGGCTCGAAAGTAGCTTAAAAATTTCACCAGAAGAACAAATTCAATTCCTGCGTAAAATTATTAATCACAATCTCCCAGTTAAAAACTCAGCCATAGAAAACACCATAGAGAACATGTATCTACAAGATCTGGAGAATAGTACAAAACTGTATGGGAAAACTGGTGCAGGATTCACAGCAAATAGAACCTTACAAAACGGATGGTTTGAAGGGTTTATTATAAGCAAATCAGGACATAAATATGTTTTTGTGTCCGCACTTACAGGAAACTTGGGGTCGAATTTAACATCAAGCATAAAAGCCAAGAAAAATGCGATCACCATTCTAA", "fmax": "769", "accession": "AY008291", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AAG23871.1", "sequence": "ANIIYSSASASTDISTVASPLFEGTEGCFLLYDVSTNAEIAQFNKAKCATQMAPDSTFKIALSLMAFDAEIIDQKTIFKWDKTPKGMEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTEAWLESSLKISPEEQIQFLRKIINHNLPVKNSAIENTIENMYLQDLENSTKLYGKTGAGFTANRTLQNGWFEGFIISKSGHKYVFVSALTGNLGSNLTSSIKAKKNAITIL"}}}}}, "ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1511": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "909": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3531": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3530": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3533": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3532": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3535": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3534": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3537": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3536": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3539": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3538": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3438": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3439": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3430": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3431": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3432": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3433": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3434": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3435": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3436": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3437": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3481": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2031": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3480": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3483": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3482": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "897": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "899": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1087": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1530": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3544": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3545": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3546": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3547": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3540": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3541": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3542": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1978": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1977": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1602": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "3548": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1972": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2960": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1780": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1784": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "767": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1962": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3328": {"$update": {"ARO_description": "AAC(6')-Im is an aminoglycoside acetyltransferase encoded by plasmids in E. coli, and E. faecium.", "ARO_category": {"$delete": ["35953", "36998", "36999", "36996", "35924"]}}}, "2323": {"$update": {"ARO_description": "qacH is a subunit of the qac multidrug efflux pump in Staphylococcus saprophyticus", "model_sequences": {"$update": {"sequence": {"6141": {"dna_sequence": {"partial": "0", "sequence": "ATGCCATATTTATATTTGTTATTATCAATAGTCAGTGAAGTAATAGGCAGTGCATTTTTAAAATCTTCAGACGGTTTCTCAAAATTATATCCAACTATAACAACAATCATTTCATTCCTTATTTGTTTTTATTTTCTGAGTAAAACTATGCAACATTTACCACTTAATATTACTTACGCAAGTTGGGCAGGTTTAGGATTAGTATTAACAACAATTGTTTCAGTTCTTATTTTCAAAGAACAAATAAATTTAATAAGCATTATTTCAATTATTTTAATAATATTTGGTGTTGTTTTACTAAACACATTCGGATCATCACACTAA", "fmax": "2185", "accession": "Y16945.1", "fmin": "1861", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Staphylococcus saprophyticus", "NCBI_taxonomy_id": "29385", "NCBI_taxonomy_cvterm_id": "40387"}, "protein_sequence": {"accession": "CAA76544.1", "sequence": "MPYLYLLLSIVSEVIGSAFLKSSDGFSKLYPTITTIISFLICFYFLSKTMQHLPLNITYASWAGLGLVLTTIVSVLIFKEQINLISIISIILIIFGVVLLNTFGSSH"}}}}}, "ARO_category": {"$delete": ["35920"]}}}, "1111": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1777": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1079": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1077": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1072": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "289": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1112": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1678": {"$update": {"model_sequences": {"$update": {"sequence": {"6152": {"dna_sequence": {"partial": "0", "sequence": "GTGACCAACAGCAACGATTCCGTCACACTGCGCCACATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGACGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA", "fmax": "655", "accession": "NG_052213.1", "fmin": "100", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Stenotrophomonas maltophilia", "NCBI_taxonomy_id": "40324", "NCBI_taxonomy_cvterm_id": "37076"}, "protein_sequence": {"accession": "WP_071846215.1", "sequence": "MTNSNDSVTLRHMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERTRSDA"}}}}}, "ARO_category": {"$delete": ["35953", "36484", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924"], "$insert": {"43328": {"category_aro_name": "AAC(6')-Ib-cr", "category_aro_cvterm_id": "43328", "category_aro_accession": "3005113", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A subfamily of aminoglycoside 6'-N-acetyltransferases, AAC(6'), which doubly confer resistance to aminoglycoside and fluoroquinolone antibiotics through fluoroquinolone-acetylating activity."}}}, "ARO_name": "AAC(6')-Ib-cr1"}}, "1679": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1674": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "3489": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3488": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1093": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "674": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "675": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "676": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "677": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3485": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1099": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3487": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3486": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "267": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "30": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "59": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1551": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1555": {"$update": {"model_sequences": {"$update": {"sequence": {"6223": {"dna_sequence": {"partial": "1", "sequence": "AAGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCCCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATAGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGGATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "861", "accession": "JN051143", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "AEK80394.1", "sequence": "KRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYSQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR"}}}}}}}, "2191": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "55": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2396": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1419": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1410": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1411": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1413": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1416": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1417": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1326": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1327": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1325": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "981": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "110": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1858": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "537": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3455": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1853": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1526": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1255": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1399": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1398": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1396": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "2071": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1394": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1258": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "646": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3543": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "300": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "3519": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3518": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1937": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3456": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1939": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "3508": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3509": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3465": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3464": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3463": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3462": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3461": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3460": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1151": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3501": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3502": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3503": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3504": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3505": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "849": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3507": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3458": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3510": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1986": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1980": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1730": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1733": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "569": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "560": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "758": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "566": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "_timestamp": "2021-01-28T21:11:43+00:00", "3506": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "226": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1598": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1024": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1020": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1186": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1187": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1184": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1185": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1845": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "724": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "721": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1741": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1743": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "605": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "604": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "153": {"$update": {"model_sequences": {"$update": {"sequence": {"6250": {"dna_sequence": {"partial": "0", "sequence": "ATGAATATTTCTAAATTTTTTATTGATCGGCCGATCTTTGCTGGTGTGCTATCAGTCTTGATTTTACTCGCCGGTCTCCTTTCGGTATTTCAGTTACCGATTTCTGAATATCCCGAGGTTGTTCCACCATCTGTGGTGGTACGCGCCCAATATCCGGGTGCAAACCCAAAAGTGATTGCTGAAACGGTTGCATCTCCGCTCGAAGAGTCAATCAACGGCGTCGAAGACATGCTGTATATGCAATCTCAAGCAAACAGCGACGGTAACCTAACCATTACGGTGAACTTTAAGCTCGGTATCGACCCAGACAAAGCCCAACAATTGGTTCAAAACCGTGTGTCTCAGGCCATGCCCCGTTTACCTGAAGATGTACAGCGCTTAGGTGTAACCACACTAAAAAGCTCACCTACTTTAACTATGGTAGTGCATCTGACCTCACCAGATAATCGCTATGACATGACCTACTTACGTAACTATGCGGTGCTCAACGTGAAAGACCGTTTAGCGCGTTTACAAGGGGTTGGTGAAGTCGGATTATTTGGTTCTGGTGACTACGCGATGCGTGTATGGCTTGACCCGCAAAAAGTAGCGCAGCGTAACCTCACCGCGACCGAAATTGTGAATGCAATCCGTGAACAAAATATTCAGGTTGCAGCGGGTACAATCGGTGCATCACCAAGTAATTCACCTTTACAGCTTTCAGTCAATGCTCAAGGTCGTTTAACTACTGAACAAGAATTCGCAGATATCATTTTAAAAACTGCACCAGATGGCGCGGTTACCCGATTGGGTGATGTTGCTCGTGTCGAACTTGCAGCCTCTCAATATGGCTTACGTTCATTGCTTGATAATAAACAAGCGGTCGCGATTCCAATTTTCCAAGCACCGGGTGCGAATGCTTTACAAGTTTCCGATCAAGTGCGTAGCACAATGAAGGAGCTTTCAAAAGATTTCCCATCTTCAATTAAATACGACATTGTTTATGACCCGACTCAATTCGTACGTGCAAGTATTAAAGCGGTCGTTCATACCTTACTTGAAGCAATTACACTGGTTGTTGTGGTCGTTATTTTATTCTTGCAAACATGGCGTGCCTCAATCATTCCATTGCTTGCCGTACCGGTTTCAATTATTGGTACATTCGCGCTCATGCTCGCTTTTGGTTACTCAATCAATGCGCTATCACTGTTCGGAATGGTACTTGCCATCGGGATTGTCGTCGATGACGCGATTGTGGTCGTCGAAAATGTCGAGAGGAATATTGAAGCAGGCTTAAACCCAAGGGAGGCGACTTACCGTGCCATGCGAGAAGTCAGTGGACCGATTATTGCCATTGCTTTAACACTTGTTGCAGTATTCGTACCTCTTGCCTTTATGACAGGCTTAACAGGGCAATTCTATAAACAATTTGCCATGACCATTGCCATTTCAACGGTTATTTCGGCATTTAACTCGCTTACCCTATCTCCTGCTTTGGCAGCGCTGTTACTGAAAGGACATGATGCTAAACCGGATGCCTTAACACGTATTATGAATCGTGTATTCGGTCGTTTCTTTGCACTGTTTAACCGTGTGTTTTCACGTGCTTCAGACCGTTATAGTCAAGGCGTCAGCCGTGTCATTTCCCATAAAGCTTCGGCAATGGGTGTCTATGCAGCACTCTTAGGTTTAACCGTTGGTATTTCCTATATTGTTCCAGGTGGTTTCGTTCCTGCGCAGGACAAACAATATTTAATTAGCTTTGCGCAGCTACCAAACGGCGCATCATTAGATCGTACCGAAGCGGTCATTCGTAAAATGAGTGACACTGCACTTAAACAACCTGGTGTAGAAAGTGCAGTTGCCTTTCCTGGCCTATCAATTAACGGTTTCACCAATAGCTCAAGTGCCGGTATTGTCTTTGTGACTTTAAAGCCATTTGATGAACGTAAGGCAAAAGACTTATCTGCAAATGCAATTGCAGGTGCGCTCAACCAGAAATATTCAGCTATTCAAGATGCCTATATCGCGGTTTTCCCACCGCCACCAGTGATGGGCTTAGGTACTATGGGCGGCTTTAAACTACAACTTGAAGACCGAGGTGCCTTAGGCTATTCAGCCTTGAACGATGCTGCACAAAACTTTATGAAGGCAGCACAATCAGCCCCTGAACTGGGTCCAATGTTCTCAAGTTATCAAATTAACGTACCTCAACTCAACGTAGATCTGGACCGTGTAAAAGCTAAACAGCAAGGCGTTGCTGTGACAGATGTTTTCAATACTATGCAGATTTATTTAGGTTCTCAGTACGTTAACGACTTTAACCGCTTTGGACGTGTTTATCAGGTTCGTGCACAAGCCGATGCGCCTTTCCGTGCTAACCCTGAAGATATTTTGCAGCTTAAAACCCGTAATAGTGCCGGACAAATGGTGCCATTATCTTCATTGGTGAATGTAACTCAAACCTATGGTCCTGAAATGGTCGTTCGTTATAACGGTTACACATCAGCAGATATTAACGGTGGCCCTGCCCCAGGTTATTCATCTAGCCAAGCAGAAGCTGCGGTTGAACGTATTGCTGCACAAACTCTACCGCGTGGTATCAAGTTTGAATGGACAGATTTAACTTATCAAAAAATCTTGGCTGGTAATGCTGGACTTTGGGTATTCCCTATTAGCGTATTACTCGTGTTCTTAGTGTTAGCTGCTCAGTATGAAAGCTTAACCCTACCATTAGCAGTTATCTTAATTGTACCAATGGGAATCTTAGCGGCTCTGACAGGTGTCTGGTTGACAGCTGGAGATAACAACATCTTTACTCAAATCGGTCTAATGGTACTGGTCGGGCTAGCCTGTAAAAATGCCATCTTAATTGTCGAATTTGCGAGGGAACTTGAAATGCAAGGTGCGACTGCCTTTAAAGCAGCCGTTGAAGCAAGTCGTCTACGTTTACGCCCAATTTTAATGACCTCTATTGCATTTATTATGGGTGTAGTGCCACTGGTTACTTCAACTGGCGCAGGTTCTGAAATGCGACATGCGATGGGTGTTGCCGTATTCTTCGGTATGATCGGTGTAACATTCTTTGGTTTATTCCTCACCCCGGCCTTTTACGTTCTGATTCGTACCCTCAACAGCAAACATAAACTGCATTCTGCGGCAGTTCATGAAGCGCCGTTAGCTAGCCCACATGATCATTAA", "fmax": "3180", "accession": "CT025801.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter baumannii AYE", "NCBI_taxonomy_id": "509173", "NCBI_taxonomy_cvterm_id": "35535"}, "protein_sequence": {"accession": "CAJ77856.1", "sequence": "MNISKFFIDRPIFAGVLSVLILLAGLLSVFQLPISEYPEVVPPSVVVRAQYPGANPKVIAETVASPLEESINGVEDMLYMQSQANSDGNLTITVNFKLGIDPDKAQQLVQNRVSQAMPRLPEDVQRLGVTTLKSSPTLTMVVHLTSPDNRYDMTYLRNYAVLNVKDRLARLQGVGEVGLFGSGDYAMRVWLDPQKVAQRNLTATEIVNAIREQNIQVAAGTIGASPSNSPLQLSVNAQGRLTTEQEFADIILKTAPDGAVTRLGDVARVELAASQYGLRSLLDNKQAVAIPIFQAPGANALQVSDQVRSTMKELSKDFPSSIKYDIVYDPTQFVRASIKAVVHTLLEAITLVVVVVILFLQTWRASIIPLLAVPVSIIGTFALMLAFGYSINALSLFGMVLAIGIVVDDAIVVVENVERNIEAGLNPREATYRAMREVSGPIIAIALTLVAVFVPLAFMTGLTGQFYKQFAMTIAISTVISAFNSLTLSPALAALLLKGHDAKPDALTRIMNRVFGRFFALFNRVFSRASDRYSQGVSRVISHKASAMGVYAALLGLTVGISYIVPGGFVPAQDKQYLISFAQLPNGASLDRTEAVIRKMSDTALKQPGVESAVAFPGLSINGFTNSSSAGIVFVTLKPFDERKAKDLSANAIAGALNQKYSAIQDAYIAVFPPPPVMGLGTMGGFKLQLEDRGALGYSALNDAAQNFMKAAQSAPELGPMFSSYQINVPQLNVDLDRVKAKQQGVAVTDVFNTMQIYLGSQYVNDFNRFGRVYQVRAQADAPFRANPEDILQLKTRNSAGQMVPLSSLVNVTQTYGPEMVVRYNGYTSADINGGPAPGYSSSQAEAAVERIAAQTLPRGIKFEWTDLTYQKILAGNAGLWVFPISVLLVFLVLAAQYESLTLPLAVILIVPMGILAALTGVWLTAGDNNIFTQIGLMVLVGLACKNAILIVEFARELEMQGATAFKAAVEASRLRLRPILMTSIAFIMGVVPLVTSTGAGSEMRHAMGVAVFFGMIGVTFFGLFLTPAFYVLIRTLNSKHKLHSAAVHEAPLASPHDH"}}}}}}}, "156": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1169": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1203": {"$update": {"model_param": {"$update": {"snp": {"$update": {"param_value": {"$insert": {"10057": "G339A"}}, "clinical": {"$insert": {"10057": "G339A"}}}}}, "$insert": {"41345": {"param_value": {"10058": "nt969+1:G"}, "param_type_id": "41345", "param_type": "insertion mutation from nucleotide sequence", "param_description": "A subtype of the insertion mutation detection model parameter. This parameter is used when a set of insertion mutations is reported in a nucleotide sequence format. Such mutations may be of variable length - possibly causing a frameshift, but not causing premature termination or a functional knockout. Mutation parameters of this type are reported in CARD with the notation: [+]nt[position]:[nucleotides]."}}}}}, "1898": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1891": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1892": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "635": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "959": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "958": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "48": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "47": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3444": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1568": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1299": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "1115": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1293": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1562": {"$update": {"model_sequences": {"$update": {"sequence": {"6244": {"dna_sequence": {"partial": "1", "sequence": "GAGGGGTCACGCGCAAATATTAATATACCTAAAGATGAATTTCAGGATTATGATATTACATATTTTGTAAGTGATATAGAACCGTTTATATCTAATGATGACTGGCTTAATCAATTTGGGAATATAATAATGATGCAAAAGCCGGAGGATATGGAATTATTCCCACCTGAAGAAAAGGGATTTTCCTATCTTATGCTATTTGATGATTACAATAAAATTGATCTTACCTTATTGCCCTTGGAAGAGTTAGATAATTACCTAAAGGGCGATAAATTAATAAAGGTTCTAATTGATAAAGATTGTAGAATTAAAAGGGACATAGTTCCGACTGATATAGATTATCATGTAAGAAAGCCAAGCGCAAGGGAGTATGATGATTGCTGCAATGAATTTTGGAATGTAACACCTTATGTTATTAAAGGATTGTGCCGTAAGGAAATTTTATTTGCTATTGATCATTTTAATCAGATTGTTCGCCATGAGCTGCTGAGAATGATATCATGGAAGGTCGGCATCGAAACAGGCTTTAAATTAAGTGTAGGCAAGAACTATAAGTTTATTGAAAGGTATATATCCGAGGATTTGTGGGAGAAACTTTTGTCCACCTACCGGATGGATTCCTATGAAAACATATGGGAAGCATTATTTCTATGCCATCAATTGTTCAGGGCGGTATCCGGTGAGGTGGCGGAAAGGCTTCATTATGCCTATCCGGAGTATGATAGGAATATAACAAAATATACCAGGGACATGTATAAAAAATACACTGGTAAAACCGGCTGCCTGGATAGCACATATGCCGCTGATATAGAAGAGAGGCGGGAACAGTGA", "fmax": "831", "accession": "AY712687", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Streptococcus oralis", "NCBI_taxonomy_id": "1303", "NCBI_taxonomy_cvterm_id": "39527"}, "protein_sequence": {"accession": "AAU10334.1", "sequence": "EGSRANINIPKDEFQDYDITYFVSDIEPFISNDDWLNQFGNIIMMQKPEDMELFPPEEKGFSYLMLFDDYNKIDLTLLPLEELDNYLKGDKLIKVLIDKDCRIKRDIVPTDIDYHVRKPSAREYDDCCNEFWNVTPYVIKGLCRKEILFAIDHFNQIVRHELLRMISWKVGIETGFKLSVGKNYKFIERYISEDLWEKLLSTYRMDSYENIWEALFLCHQLFRAVSGEVAERLHYAYPEYDRNITKYTRDMYKKYTGKTGCLDSTYAADIEERREQ"}}}}}}}, "1296": {"$update": {"model_sequences": {"$update": {"sequence": {"6221": {"dna_sequence": {"partial": "1", "sequence": "ACCGCCCTGCCACTGGCGGTATTCGCCAGCCCTCAGCCGCTTGAGCAGATTAAAATCAGCGAAGGTCAGCTGGCGGGCCGGGTGGGCTATGTTGAAATGGATCTGGCCAGCGGCCGCATGCTGGCCGCCTGGCGCGCCAGTGAGCGCTTTCCGCTGATGAGCACCTTTAAAGTGCTGCTCTGCGGCGCTGTGCTGGCCCGGGTGGATGCCGGCGACGAACAGCTGGATCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCGGTCAGCGAAAAACACCTTGCCGACGGGATGACCGTTGGCGAACTCTGCGCCGCCGCCATCACCATGAGCGATAACAGCGCCGGCAATCTGCTGTTGAAGAGCGTCGGCGGCCCCGCGGGATTGACCACTTTTCTGCGCCAGATCGGTGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTCAATGAGGCGCTTCCCGGCGACGTGCGCGACACCACCACCCCGGCCAGCATGGCCACCACCCTGCGCAAGTTGCTAACCACCCCCTCTCTGAGCGCCCGTTCGCAGCAGCAGCTGCTGCAGTGGATGGTGGACGACCAGGTGGCCGGCCCGTTGATCCGCGCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAAACCGGGGCCGGTGAGCGGGGCTCACGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAAGCGGAGCGTATCGTGGTGATCTATCTGCGGGATACCGCTGCGACCATGGCCGAACGTAACCAGCAGATCGCCGGG", "fmax": "789", "accession": "AJ635420", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAG25831.1", "sequence": "TALPLAVFASPQPLEQIKISEGQLAGRVGYVEMDLASGRMLAAWRASERFPLMSTFKVLLCGAVLARVDAGDEQLDRRIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAGNLLLKSVGGPAGLTTFLRQIGDNVTRLDRWETELNEALPGDVRDTTTPASMATTLRKLLTTPSLSARSQQQLLQWMVDDQVAGPLIRAVLPAGWFIADKTGAGERGSRGIVALLGPDGKAERIVVIYLRDTAATMAERNQQIAG"}}}}}}}, "1449": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "475": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1804": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1807": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1806": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3429": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3428": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1802": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3784": {"$update": {"ARO_category": {"$insert": {"36218": {"category_aro_name": "oxazolidinone antibiotic", "category_aro_cvterm_id": "36218", "category_aro_accession": "3000079", "category_aro_class_name": "Drug Class", "category_aro_description": "Oxazolidinones are a class of synthetic antibiotics discovered the the 1980's.  They inhibit protein synthesis by binding to domain V of the 23S rRNA of the 50S subunit of bacterial ribosomes.  Linezolid is the only member of this class currently in clinical use."}}}}}, "3785": {"$update": {"ARO_category": {"$insert": {"36218": {"category_aro_name": "oxazolidinone antibiotic", "category_aro_cvterm_id": "36218", "category_aro_accession": "3000079", "category_aro_class_name": "Drug Class", "category_aro_description": "Oxazolidinones are a class of synthetic antibiotics discovered the the 1980's.  They inhibit protein synthesis by binding to domain V of the 23S rRNA of the 50S subunit of bacterial ribosomes.  Linezolid is the only member of this class currently in clinical use."}}}}}, "3423": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3422": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3421": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3420": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3427": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3426": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3425": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "3424": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "470": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1365": {"$update": {"ARO_category": {"$delete": ["35953", "35926", "35966", "36998", "36999", "35956", "35932", "36996", "35924", "35969"]}}}, "2007": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}, "1361": {"$update": {"ARO_category": {"$insert": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}}}}}, "$insert": {"3920": {"model_id": "3920", "ARO_accession": "3002109", "model_param": {"blastp_bit_score": {"param_value": "780", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "CMY-96 is a beta-lactamase. From the Lahey list of CMY beta-lactamases.", "model_sequences": {"sequence": {"6281": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTATCCACGTTTGCCGCCGCCAAAACAGAACCACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCTGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCACCAATAACCACCCAGTCACGCAGCAAACTCTGTTTGAGCTAGGGTCGGTCAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCAGCCTGCTGCACTTAGCCACCTACACGGCAGGCGGCCTGCCGCTGCAGATCCCCGATGACGTTACGGATAAAGCCGCATTACTGCGTTTTTATCAAAACTGGCAGCCGCAATGGGCCCCGGGCGCTAAGCGTCTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACAGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGGCTGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGTCAACATGGACGCCAGCCGCGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCAATCATCAACGGTAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGATCCACTGGAGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCTTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_048893", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_063859917.1", "sequence": "MMKKSLCCALLLTASLSTFAAAKTEPQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKAVHVSPGQLDAEAYGVKSSVIDMARWVQVNMDASRVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNLVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-96", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "38509", "model_name": "CMY-96", "model_type_id": "40292"}, "3856": {"model_id": "3856", "ARO_accession": "3005130", "model_param": {"blastp_bit_score": {"param_value": "500", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "OXA-846 is a class D beta-lactamase found in Pseudomonas aeruginosa. It is part of the OXA-50 family of oxacillin-hydrolyzing beta-lactamase.", "model_sequences": {"sequence": {"6173": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCCCTCTCCTCTTCAGTGCCCTTCTCCTGCTTTCCGGGCATGCCCAGGCCAGCGAATGGAACGACAGCCAGGCCGTGGACAAGCTATTCGGCGCGGCCGGGGTGAAAGGCACCTTCGTCCTCTACGATGTGCAGCGGCAGCGCTATGTCGGCCATGACCGGGAGCGCGCGGAAACCCGCTTCGTTCCCGCTTCCACCTACAAGGTGGCGAACAGCCTGATCGGCTTATCCACAGGGGCGGTTAGATCCGCCGACGAGGTTCTTCCCTATGGCGGCAAGCCCCAGCGCTTCAAGGCCTGGGAGCACGACATGAGCCTGCGCGACGCAATCGAGGCATCGAACGTACCGGTCTACCAGGAACTGGCGCGGCGCATCGGCCTGGAGCGGATGCGCGCCAATGTCTCGCGTCTGGGTTACGGCAACGCGGAAATCGGCCAGGTTGTGGATAACTTCTGGTTGGTGGGACCGCTGAAGATCAGCGCGATGGAACAGACCCGCTTTCTGCTCCGACTGGCGCAGGGAGAATTGCCATTCCCCGCCCCGGTGCAGTCCACCGTGCGCGCCATGACCCTGCTGGAAAGCGGCCCGGGCTGGGAGCTGCACGGCAAGACCGGCTGGTGCTTCGACTGCACGCCGGAACTCGGCTGGTGGGTGGGCTGGGTGAAGCGCAACGAGCGGCTCTACGGCTTCGCCCTGAACATCGACATGCCCGGCGGCGAGGCCGACATCGGCAAGCGCGTCGAACTGGGCAAGGCCAGTCTCAAGGCTCTCGGGATACTGCCCTGA", "fmax": "789", "accession": "MN370854.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "QEJ80883.1", "sequence": "MRPLLFSALLLLSGHAQASEWNDSQAVDKLFGAAGVKGTFVLYDVQRQRYVGHDRERAETRFVPASTYKVANSLIGLSTGAVRSADEVLPYGGKPQRFKAWEHDMSLRDAIEASNVPVYQELARRIGLERMRANVSRLGYGNAEIGQVVDNFWLVGPLKISAMEQTRFLLRLAQGELPFPAPVQSTVRAMTLLESGPGWELHGKTGWCFDCTPELGWWVGWVKRNERLYGFALNIDMPGGEADIGKRVELGKASLKALGILP"}}}}, "ARO_category": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36017": {"category_aro_name": "penam", "category_aro_cvterm_id": "36017", "category_aro_accession": "3000008", "category_aro_class_name": "Drug Class", "category_aro_description": "Penams, often referred to as penicillins, are a group of antibiotics derived from Penicillium fungi. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36026": {"category_aro_name": "OXA beta-lactamase", "category_aro_cvterm_id": "36026", "category_aro_accession": "3000017", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "OXA beta-lactamases were long recognized as a less common but also plasmid-mediated beta-lactamase variety that could hydrolyze oxacillin and related anti-staphylococcal penicillins. These beta-lactamases differ from the TEM and SHV enzymes in that they belong to molecular class D and functional group 2d. The OXA-type beta-lactamases confer resistance to ampicillin and cephalothin and are characterized by their high hydrolytic activity against oxacillin and cloxacillin and the fact that they are poorly inhibited by clavulanic acid. Amino acid substitutions in OXA enzymes can also give the ESBL phenotype. The OXA beta-lactamase family was originally created as a phenotypic rather than a genotypic group for a few beta-lactamases that had a specific hydrolysis profile. Therefore, there is as little as 20% sequence homology among some of the members of this family. However, recent additions to this family show some degree of homology to one or more of the existing members of the OXA beta-lactamase family. Some confer resistance predominantly to ceftazidime, but OXA-17 confers greater resistance to cefotaxime and cefepime than it does resistance to ceftazidime."}}, "ARO_name": "OXA-846", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43347", "model_name": "OXA-846", "model_type_id": "40292"}, "3857": {"model_id": "3857", "ARO_accession": "3005131", "model_param": {"blastp_bit_score": {"param_value": "500", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "An NDM metallo-beta-lactamase variant reported in Klebsiella pneumoniae. Sourced from NCBI's Pathogen Reference Gene Browser; no peer-reviewed article.", "model_sequences": {"sequence": {"6177": {"dna_sequence": {"partial": "0", "sequence": "ATGGAATTGCCCAATATTATGCACCCGGTCGCGAAGCTGAGCACCGCATTAGCCGCTGCATTGATGCTGAGCGGGTGCATGCCCGGTGAAATCCGCCCGACGATTGGCCAGCAAATGGAAACTGGCGACCAACGGTTTGGCGATCTGGTTTTCCGCCAGCTCGCACCGAATGTCTGGCAGCACACTTCCTATCTCGACATGCCGGGTTTCGGGGCAGTCGCTTCCAACGGTTTGATCGTCAGGGATGGCGGCCGCGTGCTGGTGGTCGATACCGCCTGGACCGATGACCAGACCGCCCAGATCCTCAACTGGATCAAGCAGGAGATCAACCTGCCGGTCGCGCTGGCGGTGGTGACTCACGCGCATCAGGACAAGATGGGCGGTATGAACGCGCTGCATGCGGCGGGGATTGCGACTTATGCCAATGCGTTGTCGAACCAGCTTGCCCCGCAAGAGGGGATGGTTGCGGCGCAACACAGCCTGACTTTCGCCGCCAATGGCTGGGTCGAACCAGCAACCGCGCCCAACTTTGGCCCGCTCAAGGTATTTTACCCCGGCCCCGGCCACACCAGTGACAATATCACCGTTGGGATCGACGGCACCGACATCGCTTTTGGTGGCTGCCTGATCAAGGACAGCAAGGCCAAGTCGCTCGGCAATCTCGGTGATGCCGACACTGAGCACTACGCCGCGTCAGCGCGCGCGTTTGGTGCGGCGTTCCCCAAGGCCAGCATGATCGTGATGAGCCATTCCGCCCCCGATAGCCGCGCCGCAATCACTCATACGGCCCGCATGGCCGACAAGCTGCGCTGA", "fmax": "1103", "accession": "MN624980.1", "fmin": "290", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "QFZ95817.1", "sequence": "MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMNALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36017": {"category_aro_name": "penam", "category_aro_cvterm_id": "36017", "category_aro_accession": "3000008", "category_aro_class_name": "Drug Class", "category_aro_description": "Penams, often referred to as penicillins, are a group of antibiotics derived from Penicillium fungi. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}, "36196": {"category_aro_name": "NDM beta-lactamase", "category_aro_cvterm_id": "36196", "category_aro_accession": "3000057", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "NDM beta-lactamases or New Delhi metallo-beta-lactamases are class B beta-lactamases that confer resistance to a broad range of antibiotics including carbapenems, cephalosporins and penicillins."}}, "ARO_name": "NDM-29", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43348", "model_name": "NDM-29", "model_type_id": "40292"}, "3854": {"model_id": "3854", "ARO_accession": "3005128", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-47 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6170": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCATACTGCTGTTCGCCACCACCCCGGCCATTGCCGACGAGGCCCCGGCAGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTTGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCTCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAAGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGGTGA", "fmax": "1194", "accession": "KJ949062.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19984.1", "sequence": "MRDTRFPCLCGIAASILLFATTPAIADEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGLVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFSDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-47", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43345", "model_name": "PDC-47", "model_type_id": "40292"}, "3855": {"model_id": "3855", "ARO_accession": "3005129", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-51 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6172": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCAGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGCCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949066.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19988.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRQVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRAGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-51", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43346", "model_name": "PDC-51", "model_type_id": "40292"}, "3852": {"model_id": "3852", "ARO_accession": "3005126", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-66 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6176": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCGGATTCCCCTGCCTGTGCGGCATCGCCGCCTCCACACTGCTGTTCGCCGCCACCTCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGACACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGATATTCCGGGCCTGGCCGTGGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCTTCGAAAGAGGACGGTCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCTGCACTGGCCGGCGCTGCAAGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAAGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACACGCCGGGCAGCCAGCGCCTCTACTCCAACCCGAGCATCGGTCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGATCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCTCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAAGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCGGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGACTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATCCCAGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAATTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949081.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG20003.1", "sequence": "MRDTGFPCLCGIAASTLLFAATSAIAGEAPADRLKTLVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASLHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYTPGSQRLYSNPSIGLFGYLAARSLGQPFERIMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDKPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-66", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43343", "model_name": "PDC-66", "model_type_id": "40292"}, "3853": {"model_id": "3853", "ARO_accession": "3005127", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-14 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6165": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGTCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGAGCTACGGCAAGGACGACCGCCCCCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGATTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "GQ845017.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "ACX31164.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQSYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-14", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43344", "model_name": "PDC-14", "model_type_id": "40292"}, "3850": {"model_id": "3850", "ARO_accession": "3005124", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-63 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6167": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCGGATTCCCCTGCCTGTGCGGCATCGCCGCCTCCACACTGCTGTTCGCCGCCACCTCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGACACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGATATTCCGGGCCTGGCCGTGGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCTTCGAAAGAGGACGGTCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCTGCACTGGCCGGCGCTGCAAGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAAGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACACGCCGGGCAGCCAGCGCCTCTACTCCAACCCGAGCATCGGTCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGATCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAAGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCGGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGACTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATCCCAGGCAGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAATTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949078.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG20000.1", "sequence": "MRDTGFPCLCGIAASTLLFAATSAIAGEAPADRLKTLVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASLHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYTPGSQRLYSNPSIGLFGYLAARSLGQPFERIMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDKPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGSDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-63", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43341", "model_name": "PDC-63", "model_type_id": "40292"}, "3851": {"model_id": "3851", "ARO_accession": "3005125", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-57 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6162": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGAACAAGATGCGTCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCAAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGCCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCATGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949072.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19994.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQNKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPKAALAQYAQGYGKDDRPLRAGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-57", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43342", "model_name": "PDC-57", "model_type_id": "40292"}, "3858": {"model_id": "3858", "ARO_accession": "3005132", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-11 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6179": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCTCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "GQ845014.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "ACX31161.1", "sequence": "MRDTRFSCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-11", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43349", "model_name": "PDC-11", "model_type_id": "40292"}, "3859": {"model_id": "3859", "ARO_accession": "3005133", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-62 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6182": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCCATGCGACAATCCTCAACCTGTGCGGCCTCGCCGCTTCCACCCTGTTCTTCGCGACAACATCGGCCTTCGCCACGGCGGCGCCGGCGGAGCGCCTGAAGGCTCTGGTGGACGCCGCCGTGCAACCGGTCATGAAGGCCAATGATATCCCGGGACTGGCCGTCGCCATCACTCTCAAGGGCGAACCGCATTACTTCAGTTATGGGGTGGCCTCGAAGGAGGACGCCCGCAAGGTGACCCCCGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTACGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCGGCACTGGCCCGCCCTGCAGGGCAGCCGCTTCGACGGTATCAGCCTGCTCGACCTCGGCACCTACAGCGCTGGCGGCCTGCCGCTACAGTTCCCCGATGCGGTGCAGAAGGATCCGGCGCAGATCCGCGACTACTACCGCCAGTGGCAACCGACCTACGCCCCGGGCAGCCACCGCCAGTACTCCAACCCGAGCATCGGTCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCATTCGAGCGCAGCATGGAACGGCAGCTGTTCCCGGCGCTCGGCCTGGAGCACACCTTTATCCGGGTGCCCGCCGCGCAGCAGGGGCTGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTGCGGGTCGGACCCGGTCCGCTGGACGCCGAGGCCTACGGGCTGAAGTCCAGCGCTGCGGACCTGCTGCGCTTCGTCGAGGCCAACCTGCACCCCGAGCGCCTGGAGAAGCCCTGGGCGCAGGCCCTCGACGCCACCCATCGCGGCTACTACAAGGTGGGCGACATGACCCAGGGCCTGGGTTGGGAAGCCTACGATTGGCCGATCGACCTGAAGCGCCTGCAGGCGGGCAACTCGGCGCCGATGGCGCTACAGGCGCACAAGGTCGCCAGGTTGCCGGCGCCGCAAGCCCTGGACGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGTTTCGGCGCCTACCTGGCGTTCATCCCGGGACGCGACGTCGGCCTGGTGATCCTGGCCAATCGCAACTACCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAACAGCAGGCCAAGGTACCGCTGGTGCGCTGA", "fmax": "1194", "accession": "KJ949077.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19999.1", "sequence": "MRHATILNLCGLAASTLFFATTSAFATAAPAERLKALVDAAVQPVMKANDIPGLAVAITLKGEPHYFSYGVASKEDARKVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASRHWPALQGSRFDGISLLDLGTYSAGGLPLQFPDAVQKDPAQIRDYYRQWQPTYAPGSHRQYSNPSIGLFGYLAARSLGQPFERSMERQLFPALGLEHTFIRVPAAQQGLYAQGYGKDDRPLRVGPGPLDAEAYGLKSSAADLLRFVEANLHPERLEKPWAQALDATHRGYYKVGDMTQGLGWEAYDWPIDLKRLQAGNSAPMALQAHKVARLPAPQALDGQRLLNKTGSTNGFGAYLAFIPGRDVGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLVR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-62", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43350", "model_name": "PDC-62", "model_type_id": "40292"}, "3834": {"model_id": "3834", "ARO_accession": "3005102", "model_param": {"snp": {"param_type": "single resistance variant", "param_value": {"10048": "Q461P", "10049": "E607A", "10025": "S315N", "10040": "A110V", "10050": "H417Q", "10043": "N508D", "10052": "G33V", "10046": "Q127P", "10045": "G125S", "10026": "A264V", "10023": "N660D", "10051": "G111S", "10027": "L147P", "10035": "W91R", "10034": "M126I", "10037": "G490S", "10036": "S315G", "10022": "A312P", "10024": "S315T", "10032": "D142G"}, "clinical": {"10048": "Q461P", "10049": "E607A", "10025": "S315N", "10040": "A110V", "10050": "H417Q", "10043": "N508D", "10052": "G33V", "10046": "Q127P", "10045": "G125S", "10026": "A264V", "10023": "N660D", "10051": "G111S", "10027": "L147P", "10035": "W91R", "10034": "M126I", "10037": "G490S", "10036": "S315G", "10022": "A312P", "10024": "S315T", "10032": "D142G"}, "param_type_id": "36301", "param_description": "A nucleotide or amino acid substitution that confers elevated resistance to antibiotic(s) relative to wild type. The most common type encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. When present in the associated gene or protein, a single resistance variant confers resistance to an antibiotic drug or drug class. Single resistance variants are used by the protein variant and rRNA mutation models to detect antibiotic resistance from submitted sequences."}, "40330": {"param_value": {"10053": "S315T, G466R", "10054": "G279V, L436P", "10044": "P92S, S315T", "10047": "V431A, G490S", "10038": "S315T, V581G", "10028": "C20R, S315T", "10031": "T275A, S315T", "10030": "S134S, T308P", "10033": "S211G, S315T"}, "param_type_id": "40330", "param_type": "multiple resistance variants", "param_description": "A set of nucleotide or amino acid substitutions that are each required to confer resistance to an antibiotic drug or drug class by co-mutation. Compare to single resistance variant, where only one substitution is required. Multiple resistance variants parameters are indicated on appropriate models using the following notation: [wild-type 1][position 1][mutation 1],[wild-type 2][position 2][mutation 2],...,[wild-type n][position n][mutation n]. When each included substitution is detected in a protein sequence, resistance is conferred. This parameter is not currently included in any detection algorithms."}, "43012": {"param_value": {"10029": "S134S"}, "param_type_id": "43012", "param_type": "no association with resistance TB", "param_description": "This parameter is part of a confidence model for AMR developed by the Relational Sequencing Tuberculosis Data platform (ReSeqTB, https://platform.reseqtb.org). The confidence model is based on the likelihood ratio test (LR+) statistic that is used to evaluate whether mutations are positively or negatively associated with phenotypic resistance. The LR+ is derived from a drug susceptibility test, testing sensitivity and specificity. Under the null hypothesis of no association, the LR value is expected to be 1, but deviations from this can be due to an association with resistance or a low number of available isolate samples.  The LR+ measures the strength of association between the presence of a mutation and the drug resistance phenotype. A mutation graded as no association has no association of the mutation with phenotypic drug resistance. There is no evidence of an association between the mutation and drug resistance. LR is less than 1. These data are not visible on the CARD website, included in RGI analyses, nor available in CARD download files."}, "41343": {"param_value": {"10039": "nt1384-1:A"}, "param_type_id": "41343", "param_type": "deletion mutation from nucleotide sequence", "param_description": "A subtype of the deletion mutation detection model parameter. This parameter is used when a set of deletion mutations is reported in a nucleotide sequence format. Such mutations may be of variable length - possibly causing a frameshift, but not premature termination of functional knockout. Mutation parameters of this type are reported in the CARD with the notation: [-]nt[position]:[nucleotides]."}, "blastp_bit_score": {"param_value": "1500", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "Mutations in Mycobacterium tuberculosis katG conferring resistance to prothionamide, an analogue of isoniazid", "model_sequences": {"sequence": {"6146": {"dna_sequence": {"partial": "0", "sequence": "GTGCCCGAGCAACACCCACCCATTACAGAAACCACCACCGGAGCCGCTAGCAACGGCTGTCCCGTCGTGGGTCATATGAAATACCCCGTCGAGGGCGGCGGAAACCAGGACTGGTGGCCCAACCGGCTCAATCTGAAGGTACTGCACCAAAACCCGGCCGTCGCTGACCCGATGGGTGCGGCGTTCGACTATGCCGCGGAGGTCGCGACCATCGACGTTGACGCCCTGACGCGGGACATCGAGGAAGTGATGACCACCTCGCAGCCGTGGTGGCCCGCCGACTACGGCCACTACGGGCCGCTGTTTATCCGGATGGCGTGGCACGCTGCCGGCACCTACCGCATCCACGACGGCCGCGGCGGCGCCGGGGGCGGCATGCAGCGGTTCGCGCCGCTTAACAGCTGGCCCGACAACGCCAGCTTGGACAAGGCGCGCCGGCTGCTGTGGCCGGTCAAGAAGAAGTACGGCAAGAAGCTCTCATGGGCGGACCTGATTGTTTTCGCCGGCAACTGCGCGCTGGAATCGATGGGCTTCAAGACGTTCGGGTTCGGCTTCGGCCGGGTCGACCAGTGGGAGCCCGATGAGGTCTATTGGGGCAAGGAAGCCACCTGGCTCGGCGATGAGCGTTACAGCGGTAAGCGGGATCTGGAGAACCCGCTGGCCGCGGTGCAGATGGGGCTGATCTACGTGAACCCGGAGGGGCCGAACGGCAACCCGGACCCCATGGCCGCGGCGGTCGACATTCGCGAGACGTTTCGGCGCATGGCCATGAACGACGTCGAAACAGCGGCGCTGATCGTCGGCGGTCACACTTTCGGTAAGACCCATGGCGCCGGCCCGGCCGATCTGGTCGGCCCCGAACCCGAGGCTGCTCCGCTGGAGCAGATGGGCTTGGGCTGGAAGAGCTCGTATGGCACCGGAACCGGTAAGGACGCGATCACCAGCGGCATCGAGGTCGTATGGACGAACACCCCGACGAAATGGGACAACAGTTTCCTCGAGATCCTGTACGGCTACGAGTGGGAGCTGACGAAGAGCCCTGCTGGCGCTTGGCAATACACCGCCAAGGACGGCGCCGGTGCCGGCACCATCCCGGACCCGTTCGGCGGGCCAGGGCGCTCCCCGACGATGCTGGCCACTGACCTCTCGCTGCGGGTGGATCCGATCTATGAGCGGATCACGCGTCGCTGGCTGGAACACCCCGAGGAATTGGCCGACGAGTTCGCCAAGGCCTGGTACAAGCTGATCCACCGAGACATGGGTCCCGTTGCGAGATACCTTGGGCCGCTGGTCCCCAAGCAGACCCTGCTGTGGCAGGATCCGGTCCCTGCGGTCAGCCACGACCTCGTCGGCGAAGCCGAGATTGCCAGCCTTAAGAGCCAGATCCGGGCATCGGGATTGACTGTCTCACAGCTAGTTTCGACCGCATGGGCGGCGGCGTCGTCGTTCCGTGGTAGCGACAAGCGCGGCGGCGCCAACGGTGGTCGCATCCGCCTGCAGCCACAAGTCGGGTGGGAGGTCAACGACCCCGACGGGGATCTGCGCAAGGTCATTCGCACCCTGGAAGAGATCCAGGAGTCATTCAACTCCGCGGCGCCGGGGAACATCAAAGTGTCCTTCGCCGACCTCGTCGTGCTCGGTGGCTGTGCCGCCATAGAGAAAGCAGCAAAGGCGGCTGGCCACAACATCACGGTGCCCTTCACCCCGGGCCGCACGGATGCGTCGCAGGAACAAACCGACGTGGAATCCTTTGCCGTGCTGGAGCCCAAGGCAGATGGCTTCCGAAACTACCTCGGAAAGGGCAACCCGTTGCCGGCCGAGTACATGCTGCTCGACAAGGCGAACCTGCTTACGCTCAGTGCCCCTGAGATGACGGTGCTGGTAGGTGGCCTGCGCGTCCTCGGCGCAAACTACAAGCGCTTACCGCTGGGCGTGTTCACCGAGGCCTCCGAGTCACTGACCAACGACTTCTTCGTGAACCTGCTCGACATGGGTATCACCTGGGAGCCCTCGCCAGCAGATGACGGGACCTACCAGGGCAAGGATGGCAGTGGCAAGGTGAAGTGGACCGGCAGCCGCGTGGACCTGGTCTTCGGGTCCAACTCGGAGTTGCGGGCGCTTGTCGAGGTCTATGGCGCCGATGACGCGCAGCCGAAGTTCGTGCAGGACTTCGTCGCTGCCTGGGACAAGGTGATGAACCTCGACAGGTTCGACGTGCGCTGA", "fmax": "2156111", "accession": "AL123456.3", "fmin": "2153888", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Mycobacterium tuberculosis H37Rv", "NCBI_taxonomy_id": "83332", "NCBI_taxonomy_cvterm_id": "39507"}, "protein_sequence": {"accession": "CCP44675.1", "sequence": "MPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQNPAVADPMGAAFDYAAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGPLFIRMAWHAAGTYRIHDGRGGAGGGMQRFAPLNSWPDNASLDKARRLLWPVKKKYGKKLSWADLIVFAGNCALESMGFKTFGFGFGRVDQWEPDEVYWGKEATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNGNPDPMAAAVDIRETFRRMAMNDVETAALIVGGHTFGKTHGAGPADLVGPEPEAAPLEQMGLGWKSSYGTGTGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGAWQYTAKDGAGAGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEHPEELADEFAKAWYKLIHRDMGPVARYLGPLVPKQTLLWQDPVPAVSHDLVGEAEIASLKSQIRASGLTVSQLVSTAWAAASSFRGSDKRGGANGGRIRLQPQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSFADLVVLGGCAAIEKAAKAAGHNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGKGNPLPAEYMLLDKANLLTLSAPEMTVLVGGLRVLGANYKRLPLGVFTEASESLTNDFFVNLLDMGITWEPSPADDGTYQGKDGSGKVKWTGSRVDLVFGSNSELRALVEVYGADDAQPKFVQDFVAAWDKVMNLDRFDVR"}}}}, "ARO_category": {"35997": {"category_aro_name": "antibiotic target alteration", "category_aro_cvterm_id": "35997", "category_aro_accession": "0001001", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Mutational alteration or enzymatic modification of antibiotic target which results in antibiotic resistance."}, "43316": {"category_aro_name": "prothionamide resistant katG", "category_aro_cvterm_id": "43316", "category_aro_accession": "3005101", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Mutations associated with katG conferring resistance to prothionamide, an analogue of isoniazid. Like isoniazid, prothionamide targets lnhA"}, "40958": {"category_aro_name": "prothionamide", "category_aro_cvterm_id": "40958", "category_aro_accession": "3004025", "category_aro_class_name": "Drug Class", "category_aro_description": "Prothionamide is a thioamide derivative with antibacterial properties. It increases cell wall permeability and decreases cell wall damage resistance by inhibition of mycolic acid synthesis, resulting in cell death. It is particularly used to treat M. tuberculosis and M. leprae infections."}}, "ARO_name": "Mycobacterium tuberculosis katG mutations conferring resistance to prothionamide", "model_type": "protein variant model", "model_description": "The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.", "ARO_id": "43317", "model_name": "Mycobacterium tuberculosis katG mutations conferring resistance to prothionamide", "model_type_id": "40293"}, "3836": {"model_id": "3836", "ARO_accession": "3005105", "model_param": {"blastp_bit_score": {"param_value": "1000", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}, "41345": {"param_value": {"10093": "nt672+1:G", "10092": "nt342+1:A", "10091": "nt213+1:A", "10097": "nt757+1:C", "10095": "nt756+1:G", "10094": "nt755+1:G", "10118": "nt1219+1:A", "10104": "nt797+1:G", "10114": "nt673+1:G", "10112": "nt1247+1:A", "10103": "nt11+1:A"}, "param_type_id": "41345", "param_type": "insertion mutation from nucleotide sequence", "param_description": "A subtype of the insertion mutation detection model parameter. This parameter is used when a set of insertion mutations is reported in a nucleotide sequence format. Such mutations may be of variable length - possibly causing a frameshift, but not causing premature termination or a functional knockout. Mutation parameters of this type are reported in CARD with the notation: [+]nt[position]:[nucleotides]."}, "40394": {"param_value": {"10107": "W289STOP", "10090": "E420STOP", "10075": "R279STOP"}, "param_type_id": "40394", "param_type": "nonsense mutation", "param_description": "A nucleotide substitution resulting in a change from an amino acid codon to a STOP codon. Nonsense mutations truncate protein translation prematurely, resulting in a defective or completely inactive protein. In CARD, nonsense mutations may be attached to models using the notation: [wild type amino acid][position][STOP] (e.g. Q42STOP). This parameter is not currently used in detection algorithms."}, "41343": {"param_value": {"10089": "nt822-1:G", "10099": "nt884-1:T", "10098": "nt751-1:A", "10105": "nt385-1:A", "10109": "nt697-1:T", "10108": "nt455-1:C", "10119": "nt34-1:G", "10116": "nt43-1:G", "10106": "nt1339-1:C", "10101": "nt1133-1:C", "10100": "nt1043-1:T"}, "param_type_id": "41343", "param_type": "deletion mutation from nucleotide sequence", "param_description": "A subtype of the deletion mutation detection model parameter. This parameter is used when a set of deletion mutations is reported in a nucleotide sequence format. Such mutations may be of variable length - possibly causing a frameshift, but not premature termination of functional knockout. Mutation parameters of this type are reported in the CARD with the notation: [-]nt[position]:[nucleotides]."}, "snp": {"param_type": "single resistance variant", "param_value": {"10062": "P28S", "10063": "L35R", "10066": "D58G", "10067": "W69C", "10064": "G42D", "10065": "D56Y", "10068": "H102P", "10084": "F480S", "10081": "A352E", "10082": "M372R", "10083": "C403Y", "10071": "T186P", "10070": "Y141N", "10073": "Q246P", "10072": "T189R", "10076": "S329P", "10079": "N345K", "10078": "A341V", "10117": "Q254P", "10113": "A395D", "10111": "V179F", "10096": "L267V"}, "clinical": {"10062": "P28S", "10063": "L35R", "10066": "D58G", "10067": "W69C", "10064": "G42D", "10065": "D56Y", "10068": "H102P", "10084": "F480S", "10081": "A352E", "10082": "M372R", "10083": "C403Y", "10071": "T186P", "10070": "Y141N", "10073": "Q246P", "10072": "T189R", "10076": "S329P", "10079": "N345K", "10078": "A341V", "10117": "Q254P", "10113": "A395D", "10111": "V179F", "10096": "L267V"}, "param_type_id": "36301", "param_description": "A nucleotide or amino acid substitution that confers elevated resistance to antibiotic(s) relative to wild type. The most common type encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. When present in the associated gene or protein, a single resistance variant confers resistance to an antibiotic drug or drug class. Single resistance variants are used by the protein variant and rRNA mutation models to detect antibiotic resistance from submitted sequences."}, "40330": {"param_value": {"10088": "S266R, P454L", "10085": "I161V, G324R", "10086": "Q254P, S266R", "10087": "S266R, M373T", "10110": "Q246R, L446P", "10102": "R239Q, S266R"}, "param_type_id": "40330", "param_type": "multiple resistance variants", "param_description": "A set of nucleotide or amino acid substitutions that are each required to confer resistance to an antibiotic drug or drug class by co-mutation. Compare to single resistance variant, where only one substitution is required. Multiple resistance variants parameters are indicated on appropriate models using the following notation: [wild-type 1][position 1][mutation 1],[wild-type 2][position 2][mutation 2],...,[wild-type n][position n][mutation n]. When each included substitution is detected in a protein sequence, resistance is conferred. This parameter is not currently included in any detection algorithms."}, "43012": {"param_value": {"10074": "R258R", "10077": "R331R"}, "param_type_id": "43012", "param_type": "no association with resistance TB", "param_description": "This parameter is part of a confidence model for AMR developed by the Relational Sequencing Tuberculosis Data platform (ReSeqTB, https://platform.reseqtb.org). The confidence model is based on the likelihood ratio test (LR+) statistic that is used to evaluate whether mutations are positively or negatively associated with phenotypic resistance. The LR+ is derived from a drug susceptibility test, testing sensitivity and specificity. Under the null hypothesis of no association, the LR value is expected to be 1, but deviations from this can be due to an association with resistance or a low number of available isolate samples.  The LR+ measures the strength of association between the presence of a mutation and the drug resistance phenotype. A mutation graded as no association has no association of the mutation with phenotypic drug resistance. There is no evidence of an association between the mutation and drug resistance. LR is less than 1. These data are not visible on the CARD website, included in RGI analyses, nor available in CARD download files."}}, "ARO_description": "Mutations in Mycobacterium tuberculosis ethA conferring resistance to isoniazid", "model_sequences": {"sequence": {"6148": {"dna_sequence": {"partial": "0", "sequence": "ATGACCGAGCACCTCGACGTTGTCATCGTGGGCGCTGGAATCTCCGGTGTCAGCGCGGCCTGGCACCTGCAGGACCGTTGCCCGACCAAGAGCTACGCCATCCTGGAAAAGCGGGAATCCATGGGCGGCACCTGGGATTTGTTCCGTTATCCCGGAATTCGCTCCGACTCCGACATGTACACGCTAGGTTTCCGATTCCGTCCCTGGACCGGACGGCAGGCGATCGCCGACGGCAAGCCCATCCTCGAGTACGTCAAGAGCACCGCGGCCATGTATGGAATCGACAGGCATATCCGGTTCCACCACAAGGTGATCAGTGCCGATTGGTCGACCGCGGAAAACCGCTGGACCGTTCACATCCAAAGCCACGGCACGCTCAGCGCCCTCACCTGCGAATTCCTCTTTCTGTGCAGCGGCTACTACAACTACGACGAGGGCTACTCGCCGAGATTCGCCGGCTCGGAGGATTTCGTCGGGCCGATCATCCATCCGCAGCACTGGCCCGAGGACCTCGACTACGACGCTAAGAACATCGTCGTGATCGGCAGTGGCGCAACGGCGGTCACGCTCGTGCCGGCGCTGGCGGACTCGGGCGCCAAGCACGTCACGATGCTGCAGCGCTCACCCACCTACATCGTGTCGCAGCCAGACCGGGACGGCATCGCCGAGAAGCTCAACCGCTGGCTGCCGGAGACCATGGCCTACACCGCGGTACGGTGGAAGAACGTGCTGCGCCAGGCGGCCGTGTACAGCGCCTGCCAGAAGTGGCCACGGCGCATGCGGAAGATGTTCCTGAGCCTGATCCAGCGCCAGCTACCCGAGGGGTACGACGTGCGAAAGCACTTCGGCCCGCACTACAACCCCTGGGACCAGCGATTGTGCTTGGTGCCCAACGGCGACCTGTTCCGGGCCATTCGTCACGGGAAGGTCGAGGTGGTGACCGACACCATTGAACGGTTCACCGCGACCGGAATCCGGCTGAACTCAGGTCGCGAACTGCCGGCTGACATCATCATTACCGCAACGGGGTTGAACCTGCAGCTTTTTGGTGGGGCGACGGCGACTATCGACGGACAACAAGTGGACATCACCACGACGATGGCCTACAAGGGCATGATGCTTTCCGGCATCCCCAACATGGCCTACACGGTTGGCTACACCAATGCCTCCTGGACGCTGAAGGCCGACCTGGTGTCGGAGTTTGTCTGTCGCTTGTTGAATTACATGGACGACAACGGTTTTGACACCGTGGTCGTCGAGCGACCGGGCTCAGATGTCGAAGAGCGGCCCTTCATGGAGTTCACCCCAGGTTACGTGCTGCGCTCGCTGGACGAGCTGCCCAAGCAGGGTTCGCGTACACCGTGGCGCCTGAATCAGAACTACCTACGTGACATCCGGCTCATCCGGCGCGGCAAGATCGACGACGAGGGTCTGCGGTTCGCCAAAAGGCCTGCCCCGGTGGGGGTTTAG", "fmax": "4327473", "accession": "NC_000962.3", "fmin": "4326003", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Mycobacterium tuberculosis H37Rv", "NCBI_taxonomy_id": "83332", "NCBI_taxonomy_cvterm_id": "39507"}, "protein_sequence": {"accession": "NP_218371.1", "sequence": "MTEHLDVVIVGAGISGVSAAWHLQDRCPTKSYAILEKRESMGGTWDLFRYPGIRSDSDMYTLGFRFRPWTGRQAIADGKPILEYVKSTAAMYGIDRHIRFHHKVISADWSTAENRWTVHIQSHGTLSALTCEFLFLCSGYYNYDEGYSPRFAGSEDFVGPIIHPQHWPEDLDYDAKNIVVIGSGATAVTLVPALADSGAKHVTMLQRSPTYIVSQPDRDGIAEKLNRWLPETMAYTAVRWKNVLRQAAVYSACQKWPRRMRKMFLSLIQRQLPEGYDVRKHFGPHYNPWDQRLCLVPNGDLFRAIRHGKVEVVTDTIERFTATGIRLNSGRELPADIIITATGLNLQLFGGATATIDGQQVDITTTMAYKGMMLSGIPNMAYTVGYTNASWTLKADLVSEFVCRLLNYMDDNGFDTVVVERPGSDVEERPFMEFTPGYVLRSLDELPKQGSRTPWRLNQNYLRDIRLIRRGKIDDEGLRFAKRPAPVGV"}}}}, "ARO_category": {"36659": {"category_aro_name": "isoniazid", "category_aro_cvterm_id": "36659", "category_aro_accession": "3000520", "category_aro_class_name": "Drug Class", "category_aro_description": "Isoniazid is an organic compound that is the first-line anti tuberculosis medication in prevention and treatment. As a prodrug, it is activated by mycobacterial catalase-peroxidases such as M. tuberculosis KatG. Isoniazid inhibits mycolic acid synthesis, which prevents cell wall synthesis in mycobacteria."}, "35997": {"category_aro_name": "antibiotic target alteration", "category_aro_cvterm_id": "35997", "category_aro_accession": "0001001", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Mutational alteration or enzymatic modification of antibiotic target which results in antibiotic resistance."}, "43318": {"category_aro_name": "isoniazid resistant ethA", "category_aro_cvterm_id": "43318", "category_aro_accession": "3005103", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Mutations in ethA conferring resistance to isoniazid"}}, "ARO_name": "Mycobacterium tuberculosis ethA mutations conferring resistance to isoniazid", "model_type": "protein variant model", "model_description": "The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.", "ARO_id": "43320", "model_name": "Mycobacterium tuberculosis ethA mutations conferring resistance to isoniazid", "model_type_id": "40293"}, "3837": {"model_id": "3837", "ARO_accession": "3005106", "model_param": {"40394": {"param_value": {"10167": "W289STOP", "10135": "R279STOP", "10150": "E420STOP"}, "param_type_id": "40394", "param_type": "nonsense mutation", "param_description": "A nucleotide substitution resulting in a change from an amino acid codon to a STOP codon. Nonsense mutations truncate protein translation prematurely, resulting in a defective or completely inactive protein. In CARD, nonsense mutations may be attached to models using the notation: [wild type amino acid][position][STOP] (e.g. Q42STOP). This parameter is not currently used in detection algorithms."}, "41345": {"param_value": {"10152": "nt342+1:A", "10153": "nt672+1:G", "10151": "nt213+1:A", "10156": "nt757+1:C", "10180": "nt1336+1:C", "10154": "nt755+1:C", "10179": "nt1219+1:A", "10166": "nt1339-1:C", "10165": "nt385-1:A", "10155": "nt756+1:C", "10163": "nt11+1:A", "10174": "nt673+1:G", "10164": "nt797+1:G", "10172": "nt1247+1:A"}, "param_type_id": "41345", "param_type": "insertion mutation from nucleotide sequence", "param_description": "A subtype of the insertion mutation detection model parameter. This parameter is used when a set of insertion mutations is reported in a nucleotide sequence format. Such mutations may be of variable length - possibly causing a frameshift, but not causing premature termination or a functional knockout. Mutation parameters of this type are reported in CARD with the notation: [+]nt[position]:[nucleotides]."}, "41343": {"param_value": {"10181": "nt1033-1:A", "10169": "nt697-1:T", "10168": "nt455-1:C", "10148": "nt822-1:G", "10158": "nt751-1:A", "10159": "n884-1:T", "10161": "n1133-1:C", "10160": "n1043-1:T", "10176": "nt1043-1:T", "10177": "nt34-1:G"}, "param_type_id": "41343", "param_type": "deletion mutation from nucleotide sequence", "param_description": "A subtype of the deletion mutation detection model parameter. This parameter is used when a set of deletion mutations is reported in a nucleotide sequence format. Such mutations may be of variable length - possibly causing a frameshift, but not premature termination of functional knockout. Mutation parameters of this type are reported in the CARD with the notation: [-]nt[position]:[nucleotides]."}, "snp": {"param_type": "single resistance variant", "param_value": {"10141": "A352E", "10143": "C403Y", "10142": "M372R", "10144": "F480S", "10129": "W69C", "10128": "D58G", "10127": "D56Y", "10126": "G42D", "10125": "L35R", "10124": "P28S", "10157": "L267V", "10178": "Q254P", "10136": "S329P", "10130": "H102P", "10131": "Y141N", "10132": "T186P", "10133": "T189R", "10171": "V179F", "10173": "A395D", "10138": "A341V", "10175": "Q246P", "10139": "N345K"}, "clinical": {"10141": "A352E", "10143": "C403Y", "10142": "M372R", "10144": "F480S", "10129": "W69C", "10128": "D58G", "10127": "D56Y", "10126": "G42D", "10125": "L35R", "10124": "P28S", "10157": "L267V", "10178": "Q254P", "10136": "S329P", "10130": "H102P", "10131": "Y141N", "10132": "T186P", "10133": "T189R", "10171": "V179F", "10173": "A395D", "10138": "A341V", "10175": "Q246P", "10139": "N345K"}, "param_type_id": "36301", "param_description": "A nucleotide or amino acid substitution that confers elevated resistance to antibiotic(s) relative to wild type. The most common type encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. When present in the associated gene or protein, a single resistance variant confers resistance to an antibiotic drug or drug class. Single resistance variants are used by the protein variant and rRNA mutation models to detect antibiotic resistance from submitted sequences."}, "40330": {"param_value": {"10149": "S266R, P454L", "10162": "R239Q, S266R", "10170": "Q246R, L446P", "10237": "I161V, G324R", "10239": "Q254P, S266R", "10238": "S266R, M373T"}, "param_type_id": "40330", "param_type": "multiple resistance variants", "param_description": "A set of nucleotide or amino acid substitutions that are each required to confer resistance to an antibiotic drug or drug class by co-mutation. Compare to single resistance variant, where only one substitution is required. Multiple resistance variants parameters are indicated on appropriate models using the following notation: [wild-type 1][position 1][mutation 1],[wild-type 2][position 2][mutation 2],...,[wild-type n][position n][mutation n]. When each included substitution is detected in a protein sequence, resistance is conferred. This parameter is not currently included in any detection algorithms."}, "blastp_bit_score": {"param_value": "1000", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}, "43012": {"param_value": {"10134": "R258R", "10137": "R331R"}, "param_type_id": "43012", "param_type": "no association with resistance TB", "param_description": "This parameter is part of a confidence model for AMR developed by the Relational Sequencing Tuberculosis Data platform (ReSeqTB, https://platform.reseqtb.org). The confidence model is based on the likelihood ratio test (LR+) statistic that is used to evaluate whether mutations are positively or negatively associated with phenotypic resistance. The LR+ is derived from a drug susceptibility test, testing sensitivity and specificity. Under the null hypothesis of no association, the LR value is expected to be 1, but deviations from this can be due to an association with resistance or a low number of available isolate samples.  The LR+ measures the strength of association between the presence of a mutation and the drug resistance phenotype. A mutation graded as no association has no association of the mutation with phenotypic drug resistance. There is no evidence of an association between the mutation and drug resistance. LR is less than 1. These data are not visible on the CARD website, included in RGI analyses, nor available in CARD download files."}}, "ARO_description": "Mutations in Mycobacterium tuberculosis ethA conferring resistance to prothionamide, an analogue to isoniazid", "model_sequences": {"sequence": {"6149": {"dna_sequence": {"partial": "0", "sequence": "ATGACCGAGCACCTCGACGTTGTCATCGTGGGCGCTGGAATCTCCGGTGTCAGCGCGGCCTGGCACCTGCAGGACCGTTGCCCGACCAAGAGCTACGCCATCCTGGAAAAGCGGGAATCCATGGGCGGCACCTGGGATTTGTTCCGTTATCCCGGAATTCGCTCCGACTCCGACATGTACACGCTAGGTTTCCGATTCCGTCCCTGGACCGGACGGCAGGCGATCGCCGACGGCAAGCCCATCCTCGAGTACGTCAAGAGCACCGCGGCCATGTATGGAATCGACAGGCATATCCGGTTCCACCACAAGGTGATCAGTGCCGATTGGTCGACCGCGGAAAACCGCTGGACCGTTCACATCCAAAGCCACGGCACGCTCAGCGCCCTCACCTGCGAATTCCTCTTTCTGTGCAGCGGCTACTACAACTACGACGAGGGCTACTCGCCGAGATTCGCCGGCTCGGAGGATTTCGTCGGGCCGATCATCCATCCGCAGCACTGGCCCGAGGACCTCGACTACGACGCTAAGAACATCGTCGTGATCGGCAGTGGCGCAACGGCGGTCACGCTCGTGCCGGCGCTGGCGGACTCGGGCGCCAAGCACGTCACGATGCTGCAGCGCTCACCCACCTACATCGTGTCGCAGCCAGACCGGGACGGCATCGCCGAGAAGCTCAACCGCTGGCTGCCGGAGACCATGGCCTACACCGCGGTACGGTGGAAGAACGTGCTGCGCCAGGCGGCCGTGTACAGCGCCTGCCAGAAGTGGCCACGGCGCATGCGGAAGATGTTCCTGAGCCTGATCCAGCGCCAGCTACCCGAGGGGTACGACGTGCGAAAGCACTTCGGCCCGCACTACAACCCCTGGGACCAGCGATTGTGCTTGGTGCCCAACGGCGACCTGTTCCGGGCCATTCGTCACGGGAAGGTCGAGGTGGTGACCGACACCATTGAACGGTTCACCGCGACCGGAATCCGGCTGAACTCAGGTCGCGAACTGCCGGCTGACATCATCATTACCGCAACGGGGTTGAACCTGCAGCTTTTTGGTGGGGCGACGGCGACTATCGACGGACAACAAGTGGACATCACCACGACGATGGCCTACAAGGGCATGATGCTTTCCGGCATCCCCAACATGGCCTACACGGTTGGCTACACCAATGCCTCCTGGACGCTGAAGGCCGACCTGGTGTCGGAGTTTGTCTGTCGCTTGTTGAATTACATGGACGACAACGGTTTTGACACCGTGGTCGTCGAGCGACCGGGCTCAGATGTCGAAGAGCGGCCCTTCATGGAGTTCACCCCAGGTTACGTGCTGCGCTCGCTGGACGAGCTGCCCAAGCAGGGTTCGCGTACACCGTGGCGCCTGAATCAGAACTACCTACGTGACATCCGGCTCATCCGGCGCGGCAAGATCGACGACGAGGGTCTGCGGTTCGCCAAAAGGCCTGCCCCGGTGGGGGTTTAG", "fmax": "4327473", "accession": "NC_000962.3", "fmin": "4326003", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Mycobacterium tuberculosis H37Rv", "NCBI_taxonomy_id": "83332", "NCBI_taxonomy_cvterm_id": "39507"}, "protein_sequence": {"accession": "NP_218371.1", "sequence": "MTEHLDVVIVGAGISGVSAAWHLQDRCPTKSYAILEKRESMGGTWDLFRYPGIRSDSDMYTLGFRFRPWTGRQAIADGKPILEYVKSTAAMYGIDRHIRFHHKVISADWSTAENRWTVHIQSHGTLSALTCEFLFLCSGYYNYDEGYSPRFAGSEDFVGPIIHPQHWPEDLDYDAKNIVVIGSGATAVTLVPALADSGAKHVTMLQRSPTYIVSQPDRDGIAEKLNRWLPETMAYTAVRWKNVLRQAAVYSACQKWPRRMRKMFLSLIQRQLPEGYDVRKHFGPHYNPWDQRLCLVPNGDLFRAIRHGKVEVVTDTIERFTATGIRLNSGRELPADIIITATGLNLQLFGGATATIDGQQVDITTTMAYKGMMLSGIPNMAYTVGYTNASWTLKADLVSEFVCRLLNYMDDNGFDTVVVERPGSDVEERPFMEFTPGYVLRSLDELPKQGSRTPWRLNQNYLRDIRLIRRGKIDDEGLRFAKRPAPVGV"}}}}, "ARO_category": {"35997": {"category_aro_name": "antibiotic target alteration", "category_aro_cvterm_id": "35997", "category_aro_accession": "0001001", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Mutational alteration or enzymatic modification of antibiotic target which results in antibiotic resistance."}, "40958": {"category_aro_name": "prothionamide", "category_aro_cvterm_id": "40958", "category_aro_accession": "3004025", "category_aro_class_name": "Drug Class", "category_aro_description": "Prothionamide is a thioamide derivative with antibacterial properties. It increases cell wall permeability and decreases cell wall damage resistance by inhibition of mycolic acid synthesis, resulting in cell death. It is particularly used to treat M. tuberculosis and M. leprae infections."}, "43319": {"category_aro_name": "prothionamide resistant ethA", "category_aro_cvterm_id": "43319", "category_aro_accession": "3005104", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Mutations in ethA conferring resistance to prothionamide, an analogue of isoniazid"}}, "ARO_name": "Mycobacterium tuberculosis ethA mutations conferring resistance to prothionamide", "model_type": "protein variant model", "model_description": "The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.", "ARO_id": "43321", "model_name": "Mycobacterium tuberculosis ethA mutations conferring resistance to prothionamide", "model_type_id": "40293"}, "3830": {"model_id": "3830", "ARO_accession": "3005098", "model_param": {"blastp_bit_score": {"param_value": "180", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "A subunit of the qac multidrug efflux pump in Vibrio cholerae", "model_sequences": {"sequence": {"6142": {"dna_sequence": {"partial": "0", "sequence": "GTGAAGAACTGGATATTTATGGCTGTTGCAATCTTTGGCGAGGTCATCGCAACTTCCGCACTGAAGTCTAGCCATGGATTCACTAGGTTAGTTCCTTCCGTTGTAGTTGTGGCTGGCTACGGGCTTGCGTTCTATTTCTTGTCTCTCGCGCTCAAGTCCATTCCGGTCGGTATTGCTTACGCTGTATGGGCTGGGCTTGGCATCGTGCTTGTGGCAGCTATTGCTTGGATTTTCCATGGCCAAAAACTAGACTTCTGGGCGTTCATTGGCATGGGACTTATCGTCAGTGGCGTCGCCGTTCTAAACCTGCTATCCAAGGTCAGCGCACATTGA", "fmax": "521", "accession": "DQ149925.1", "fmin": "188", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Vibrio cholerae", "NCBI_taxonomy_id": "666", "NCBI_taxonomy_cvterm_id": "36789"}, "protein_sequence": {"accession": "AAZ42322", "sequence": "MKNWIFMAVAIFGEVIATSALKSSHGFTRLVPSVVVVAGYGLAFYFLSLALKSIPVGIAYAVWAGLGIVLVAAIAWIFHGQKLDFWAFIGMGLIVSGVAVLNLLSKVSAH"}}}}, "ARO_category": {"36298": {"category_aro_name": "efflux pump complex or subunit conferring antibiotic resistance", "category_aro_cvterm_id": "36298", "category_aro_accession": "3000159", "category_aro_class_name": "Efflux Component", "category_aro_description": "Efflux proteins that pump antibiotic out of a cell to confer resistance."}, "36004": {"category_aro_name": "small multidrug resistance (SMR) antibiotic efflux pump", "category_aro_cvterm_id": "36004", "category_aro_accession": "0010003", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Directed pumping of antibiotic out of a cell to confer resistance. Small multidrug resistance (SMR) proteins are a relatively small family of transporters, restricted to prokaryotic cells. They are also the smallest multidrug transporters, with only four transmembrane alpha-helices and no significant extramembrane domain."}, "36001": {"category_aro_name": "antibiotic efflux", "category_aro_cvterm_id": "36001", "category_aro_accession": "0010000", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Antibiotic resistance via the transport of antibiotics out of the cell."}}, "ARO_name": "qacL", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43313", "model_name": "qacL", "model_type_id": "40292"}, "3831": {"model_id": "3831", "ARO_accession": "3005099", "model_param": {"blastp_bit_score": {"param_value": "450", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "Variant of ErmA (ARO:3000347) found in Streptococcus pyogenes. Confers the MLSb phenotype.", "model_sequences": {"sequence": {"6143": {"dna_sequence": {"partial": "0", "sequence": "ATGAAACAGAAAAACCCGAAAAATACGCAAAATTTCATTACATCTAAAAAGCATGTAAAGGAAATATTAAAATATACGAATATCAATAAACAAGATAAAATAATAGAAATTGGGTCAGGAAAAGGACATTTTACCAAGGAACTTGTGGAAATGAGTCAACGGGTGAATGCTATAGAGATTGATGAAGGTTTATGTCATGCCACGAAAAAAGCAGTTGAACCTTTTCAGAATATAAAAGTTATTCATGAGGATATTTTGAAGTTTAGCTTTCCTAAAAATACAGACTATAAAATATTTGGTAATATTCCCTACAATATTAGTACTGATATTGTAAAAAAGATTGCTTTTGATAGTCAAGCGAAATATAGCTACCTTATTGTAGAGAGGGGATTTGCTAAAAGGTTGCAAAATACCCAACGAGCTTTAGGTTTGCTGTTAATGGTGGAAATGGATATAAAAATTCTTAAAAAAGTGCCACGAGCATATTTTCACCCTAAGCCTAATGTAGATTCTGTATTGATTGTACTTGAAAGGCATAAACCATTTATTTTAAAGAAGGACTACAAAAAGTATAGATTTTTCGTTTATAAATGGGTAAACAGGGAATATCATGTTCTTTTTACTAAAAATCAATTAAGACAGGTGCTGAAGCATGCGAATGTTACTGATCTTGATAAATTATCCAATGAACAATTTTTGTCTGTTTTCAATAGTTACAAATTATTTCAATAA", "fmax": "942", "accession": "AF002716.1", "fmin": "210", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Streptococcus pyogenes", "NCBI_taxonomy_id": "1314", "NCBI_taxonomy_cvterm_id": "36764"}, "protein_sequence": {"accession": "AAB60941.1", "sequence": "MKQKNPKNTQNFITSKKHVKEILKYTNINKQDKIIEIGSGKGHFTKELVEMSQRVNAIEIDEGLCHATKKAVEPFQNIKVIHEDILKFSFPKNTDYKIFGNIPYNISTDIVKKIAFDSQAKYSYLIVERGFAKRLQNTQRALGLLLMVEMDIKILKKVPRAYFHPKPNVDSVLIVLERHKPFILKKDYKKYRFFVYKWVNREYHVLFTKNQLRQVLKHANVTDLDKLSNEQFLSVFNSYKLFQ"}}}}, "ARO_category": {"35997": {"category_aro_name": "antibiotic target alteration", "category_aro_cvterm_id": "35997", "category_aro_accession": "0001001", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Mutational alteration or enzymatic modification of antibiotic target which results in antibiotic resistance."}, "35945": {"category_aro_name": "streptogramin antibiotic", "category_aro_cvterm_id": "35945", "category_aro_accession": "0000026", "category_aro_class_name": "Drug Class", "category_aro_description": "Streptogramin antibiotics are natural products produced by various members of the Streptomyces genus. These antibiotics bind to the P site of the 50S subunit of bacterial ribosomes to inhibit protein synthesis. The family consists of two subgroups, type A and type B, which are simultaneously produced by the same bacterial species in a ratio of roughly 70:30."}, "36699": {"category_aro_name": "Erm 23S ribosomal RNA methyltransferase", "category_aro_cvterm_id": "36699", "category_aro_accession": "3000560", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Erm proteins are part of the RNA methyltransferase family and methylate A2058 (E. coli nomenclature) of the 23S ribosomal RNA conferring degrees of resistance to Macrolides, Lincosamides and Streptogramin b. This is called the MLSb phenotype."}, "35919": {"category_aro_name": "macrolide antibiotic", "category_aro_cvterm_id": "35919", "category_aro_accession": "0000000", "category_aro_class_name": "Drug Class", "category_aro_description": "Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins."}, "35936": {"category_aro_name": "lincosamide antibiotic", "category_aro_cvterm_id": "35936", "category_aro_accession": "0000017", "category_aro_class_name": "Drug Class", "category_aro_description": "Lincosamides (e.g. lincomycin, clindamycin) are a class of drugs which bind to the 23s portion of the 50S subunit of bacterial ribosomes. This interaction inhibits early elongation of peptide chains by inhibiting the transpeptidase reaction, acting similarly to macrolides."}}, "ARO_name": "23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(A)", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43314", "model_name": "23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(A)", "model_type_id": "40292"}, "3832": {"model_id": "3832", "ARO_accession": "3005100", "model_param": {"blastp_bit_score": {"param_value": "250", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "Subtype of FosB (ARO:3000172). Present in multiple species.", "model_sequences": {"sequence": {"6144": {"dna_sequence": {"partial": "0", "sequence": "ATGCTACAGGGCATTAACCATATTTGTTTTTCTGTATCAAACTTGGAAAAATCTATTGAATTCTATCAAAAAATACTTCAAGCAAAATTATTAGTAAAAGGTAGAAAATTAGCGTATTTTGATTTAAATGGATTATGGATTGCTTTAAATGTTGAAGAAGATATACCAAGAAATGAAATTAAGCAATCTTATACACATATGGCTTTCACTGTAACTAATGAAGCATTAGACCATTTAAAAGAAGTATTAATTCAAAATGATGTTAATATTTTACCTGGCCGAGAAAGAGATGAGAGAGACCAAAGATCTCTTTACTTTACAGATCCAGATGGCCATAAGTTTGAGTTCCACACTGGCACTTTGCAAAACCGGTTAGAGTACTATAAAGAAGATAAAAAACATATGACTTTTTACATATAA", "fmax": "3778818", "accession": "AE016879.1", "fmin": "3778398", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Bacillus anthracis str. Ames", "NCBI_taxonomy_id": "198094", "NCBI_taxonomy_cvterm_id": "43244"}, "protein_sequence": {"accession": "AAP27834.1", "sequence": "MLQGINHICFSVSNLEKSIEFYQKILQAKLLVKGRKLAYFDLNGLWIALNVEEDIPRNEIKQSYTHMAFTVTNEALDHLKEVLIQNDVNILPGRERDERDQRSLYFTDPDGHKFEFHTGTLQNRLEYYKEDKKHMTFYI"}}}}, "ARO_category": {"35944": {"category_aro_name": "fosfomycin", "category_aro_cvterm_id": "35944", "category_aro_accession": "0000025", "category_aro_class_name": "Drug Class", "category_aro_description": "Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction."}, "36272": {"category_aro_name": "fosfomycin thiol transferase", "category_aro_cvterm_id": "36272", "category_aro_accession": "3000133", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Catalyzes the addition of a thiol group from a nucleophilic molecule to fosfomycin."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}}, "ARO_name": "FosB2", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43315", "model_name": "FosB2", "model_type_id": "40292"}, "3838": {"model_id": "3838", "ARO_accession": "3005108", "model_param": {"blastp_bit_score": {"param_value": "900", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}, "snp": {"param_type": "single resistance variant", "param_value": {"10182": "F355S"}, "clinical": {"10182": "F355S"}, "param_type_id": "36301", "param_description": "A nucleotide or amino acid substitution that confers elevated resistance to antibiotic(s) relative to wild type. The most common type encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. When present in the associated gene or protein, a single resistance variant confers resistance to an antibiotic drug or drug class. Single resistance variants are used by the protein variant and rRNA mutation models to detect antibiotic resistance from submitted sequences."}}, "ARO_description": "Mutations in Mycobacterium tuberculosis mshA conferring resistance to prothionamide, an analogue to isoniazid", "model_sequences": {"sequence": {"6150": {"dna_sequence": {"partial": "0", "sequence": "ATGGCAGGTGTGCGGCACGATGACGGTTCAGGGTTGATCGCCCAGCGCCGTCCGGTCCGCGGCGAGGGTGCCACCCGCTCGCGCGGCCCATCCGGGCCATCCAATCGGAATGTTTCGGCAGCAGACGACCCGCGCCGGGTTGCGCTGCTGGCGGTGCACACCTCACCGCTGGCACAGCCGGGCACCGGTGACGCCGGCGGCATGAACGTCTACATGCTGCAAAGTGCGCTGCACCTGGCCCGTCGGGGCATCGAGGTGGAGATCTTCACCCGGGCCACCGCATCGGCAGATCCACCGGTGGTGCGGGTGGCACCCGGGGTGCTGGTGCGCAACGTGGTGGCGGGGCCCTTCGAGGGTTTGGACAAGTACGACCTGCCCACCCAGCTTTGTGCGTTCGCCGCCGGGGTGCTGCGCGCCGAGGCGGTCCACGAACCGGGTTACTACGACATCGTGCACTCGCACTACTGGCTGTCGGGTCAGGTCGGCTGGCTGGCGCGCGACCGCTGGGCGGTGCCGTTGGTGCACACCGCACACACGCTGGCCGCCGTGAAGAACGCGGCACTGGCCGACGGCGACGGACCCGAGCCGCCGCTGCGTACGGTCGGGGAGCAGCAGGTCGTCGACGAGGCGGATCGGTTGATCGTCAACACCGACGATGAAGCCAGGCAAGTGATTTCGCTTCATGGTGCCGATCCGGCACGAATCGACGTGGTCCATCCCGGTGTCGATCTGGACGTGTTCCGCCCGGGTGATCGGCGCGCGGCCCGGGCCGCGCTAGGACTACCAGTTGACGAGCGCGTGGTGGCCTTCGTCGGACGCATCCAGCCGCTGAAGGCACCCGACATTGTGCTGCGTGCGGCCGCCAAGTTGCCCGGGGTGCGCATCATCGTGGCCGGCGGACCGTCGGGCAGCGGTCTGGCTTCACCGGACGGACTGGTCCGGCTCGCCGACGAACTGGGCATCTCTGCACGGGTGACGTTTCTGCCGCCGCAGTCCCACACGGATCTGGCCACCTTGTTTCGGGCGGCGGACCTGGTTGCGGTGCCGAGCTACTCCGAGTCGTTCGGCCTGGTTGCTGTGGAGGCCCAAGCGTGCGGCACACCGGTGGTGGCCGCGGCGGTGGGCGGGCTGCCCGTCGCGGTGCGCGACGGGATCACCGGCACCCTGGTGTCCGGGCACGAGGTCGGTCAGTGGGCCGACGCCATCGATCACCTGCTGCGGTTGTGTGCCGGGCCACGGGGACGGGTGATGAGCCGGGCGGCGGCACGGCACGCCGCCACGTTCTCGTGGGAGAACACCACCGACGCGCTGTTGGCCAGTTATCGGCGTGCGATCGGCGAGTACAACGCCGAGCGCCAGCGCCGGGGCGGCGAGGTGATATCGGACCTGGTAGCGGTGGGCAAGCCCCGCCACTGGACGCCGCGTCGCGGGGTGGGCGCGTGA", "fmax": "576790", "accession": "NC_000962.3", "fmin": "575347", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Mycobacterium tuberculosis H37Rv", "NCBI_taxonomy_id": "83332", "NCBI_taxonomy_cvterm_id": "39507"}, "protein_sequence": {"accession": "NP_215000.1", "sequence": "MAGVRHDDGSGLIAQRRPVRGEGATRSRGPSGPSNRNVSAADDPRRVALLAVHTSPLAQPGTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPVVRVAPGVLVRNVVAGPFEGLDKYDLPTQLCAFAAGVLRAEAVHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTLAAVKNAALADGDGPEPPLRTVGEQQVVDEADRLIVNTDDEARQVISLHGADPARIDVVHPGVDLDVFRPGDRRAARAALGLPVDERVVAFVGRIQPLKAPDIVLRAAAKLPGVRIIVAGGPSGSGLASPDGLVRLADELGISARVTFLPPQSHTDLATLFRAADLVAVPSYSESFGLVAVEAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWADAIDHLLRLCAGPRGRVMSRAAARHAATFSWENTTDALLASYRRAIGEYNAERQRRGGEVISDLVAVGKPRHWTPRRGVGA"}}}}, "ARO_category": {"35997": {"category_aro_name": "antibiotic target alteration", "category_aro_cvterm_id": "35997", "category_aro_accession": "0001001", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Mutational alteration or enzymatic modification of antibiotic target which results in antibiotic resistance."}, "40958": {"category_aro_name": "prothionamide", "category_aro_cvterm_id": "40958", "category_aro_accession": "3004025", "category_aro_class_name": "Drug Class", "category_aro_description": "Prothionamide is a thioamide derivative with antibacterial properties. It increases cell wall permeability and decreases cell wall damage resistance by inhibition of mycolic acid synthesis, resulting in cell death. It is particularly used to treat M. tuberculosis and M. leprae infections."}, "43322": {"category_aro_name": "prothionamide resistant mshA", "category_aro_cvterm_id": "43322", "category_aro_accession": "3005107", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Mutations in mshA conferring resistance to prothionamide, an analogue of isoniazid"}}, "ARO_name": "Mycobacterium tuberculosis mshA mutations conferring resistance to prothionamide", "model_type": "protein variant model", "model_description": "The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.", "ARO_id": "43323", "model_name": "Mycobacterium tuberculosis mshA mutations conferring resistance to prothionamide", "model_type_id": "40293"}, "3839": {"model_id": "3839", "ARO_accession": "3005111", "model_param": {"blastp_bit_score": {"param_value": "500", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "Predominant beta-lactamase in Mycobacterium smegmatis", "model_sequences": {"sequence": {"6151": {"dna_sequence": {"partial": "0", "sequence": "ATGACGAATCTCTCACGACGCAGTGTGTTGATCGGATCCCTGGCAGTGATGGCGGCCGCCGGTGTGCGTATGCCGACGGCTTCCGCCGCTCCCGTCGACGACCGGATCGCCGATCTCGAACGACGGAACAACGCATCCATCGGCATCTATGCCGTCGACCTCGATTCGAACCGTACGGTCGCGCACCGCGCCGACGACTCGTTCGCGATGTGCTCGACGTTCAAGGCCTACCTCGCGGCCCGGATCCTGCGGGGCGCCGAGCGCGGCGAGTTGTCGCTGGACGATCGTGTCTTCGTGGATCCCGCGGCGCTGCTGAGCAACTCGCCGATCACCGAGACACACGCAGGCGGCGAGATGACGCTGGCCGAGTTGTGCCAGGCGGCACTGCAGCGCAGCGACAACGCCGCGGCCAACCTGTTGCTCAAGCAGATCGGCGGGCCGGCCGAGATCACCGCGTTCGCGCGGTCGATCGGCGACCAGCGCACACGCCTGGACCGCTGGGAGACCGAACTGAACTCGGCGGTGCCCGGCGATCCGCGTGACACCAGCACCCCGGCCGCGCTGGCCGGTGGTTTCCGCGCCGTGCTGACCGGCGACGTGCTGGCCCCGCCGCAGCGTCAATTGCTCGACGAGTGGATGCGGGCCAACGAGACCTCCAGCCTGCGTGCGGGTTTGCCGGACGGCTGGACCAGTGCCGACAAGACCGGCAGCGGCGACTACGGATCCACCAACGATGTGGGTATCGCCTACGGCCCGCAGGGGCAGCGCATCCTGCTGGCGTTGATGGTGCGGACGCGCGGCGACGATCCGAACGCGGACGGGTTCCGGCCCCTCATCGGGGAACTCACCGCGCTGGTGCTGCCCGAACTCGGCGTGCACTGA", "fmax": "1808", "accession": "AY332268.1", "fmin": "926", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Mycolicibacterium smegmatis MC2 155", "NCBI_taxonomy_id": "246196", "NCBI_taxonomy_cvterm_id": "36769"}, "protein_sequence": {"accession": "AAP97895.1", "sequence": "MTNLSRRSVLIGSLAVMAAAGVRMPTASAAPVDDRIADLERRNNASIGIYAVDLDSNRTVAHRADDSFAMCSTFKAYLAARILRGAERGELSLDDRVFVDPAALLSNSPITETHAGGEMTLAELCQAALQRSDNAAANLLLKQIGGPAEITAFARSIGDQRTRLDRWETELNSAVPGDPRDTSTPAALAGGFRAVLTGDVLAPPQRQLLDEWMRANETSSLRAGLPDGWTSADKTGSGDYGSTNDVGIAYGPQGQRILLALMVRTRGDDPNADGFRPLIGELTALVLPELGVH"}}}}, "ARO_category": {"36017": {"category_aro_name": "penam", "category_aro_cvterm_id": "36017", "category_aro_accession": "3000008", "category_aro_class_name": "Drug Class", "category_aro_description": "Penams, often referred to as penicillins, are a group of antibiotics derived from Penicillium fungi. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "43325": {"category_aro_name": "blaS", "category_aro_cvterm_id": "43325", "category_aro_accession": "3005110", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A class A beta-lactamase in Mycobacterium smegmatis"}, "35927": {"category_aro_name": "cefoxitin", "category_aro_cvterm_id": "35927", "category_aro_accession": "0000008", "category_aro_class_name": "Antibiotic", "category_aro_description": "Cefoxitin is a cephamycin antibiotic often grouped with the second generation cephalosporins. Cefoxitin is bactericidal and acts by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. Cefoxitin's 7-alpha-methoxy group and 3' leaving group make it a poor substrate for most beta-lactamases."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}, "35995": {"category_aro_name": "piperacillin", "category_aro_cvterm_id": "35995", "category_aro_accession": "0000078", "category_aro_class_name": "Antibiotic", "category_aro_description": "Piperacillin is an acetylureidopenicillin and has an extended spectrum of targets relative to other beta-lactam antibiotics. It inhibits cell wall synthesis in bacteria, and is usually taken with the beta-lactamase inhibitor tazobactam to overcome penicillin-resistant bacteria."}, "35973": {"category_aro_name": "oxacillin", "category_aro_cvterm_id": "35973", "category_aro_accession": "0000056", "category_aro_class_name": "Antibiotic", "category_aro_description": "Oxacillin is a penicillinase-resistant beta-lactam. It is similar to methicillin, and has replaced methicillin in clinical use. Oxacillin, especially in combination with other antibiotics, is effective against many penicillinase-producing strains of Staphylococcus aureus and Staphylococcus epidermidis."}, "35961": {"category_aro_name": "carbenicillin", "category_aro_cvterm_id": "35961", "category_aro_accession": "0000043", "category_aro_class_name": "Antibiotic", "category_aro_description": "Carbenicillin is a semi-synthetic antibiotic belonging to the carboxypenicillin subgroup of the penicillins. It has gram-negative coverage which includes Pseudomonas aeruginosa but limited gram-positive coverage. The carboxypenicillins are susceptible to degradation by beta-lactamase enzymes. Carbenicillin antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36981": {"category_aro_name": "ampicillin", "category_aro_cvterm_id": "36981", "category_aro_accession": "3000637", "category_aro_class_name": "Antibiotic", "category_aro_description": "Ampicillin is a penicillin derivative that is highly acid stable, with its activity similar to benzylpenicillin."}, "36983": {"category_aro_name": "mezlocillin", "category_aro_cvterm_id": "36983", "category_aro_accession": "3000639", "category_aro_class_name": "Antibiotic", "category_aro_description": "Mezlocillin is a penicillin derivative taken parenterally."}, "35979": {"category_aro_name": "ceftriaxone", "category_aro_cvterm_id": "35979", "category_aro_accession": "0000062", "category_aro_class_name": "Antibiotic", "category_aro_description": "Ceftriaxone is a third-generation cephalosporin antibiotic. The presence of an aminothiazolyl sidechain increases ceftriazone's resistance to beta-lactamases. Like other third-generation cephalosporins, it has broad spectrum activity against Gram-positive and Gram-negative bacteria."}, "36990": {"category_aro_name": "cefixime", "category_aro_cvterm_id": "36990", "category_aro_accession": "3000646", "category_aro_class_name": "Antibiotic", "category_aro_description": "Cefixime is a cephalosporin resistant to most beta-lactamases. It is active against many enterobacteria, but activity against staphylococci is poor."}}, "ARO_name": "blaS1", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43326", "model_name": "blaS1", "model_type_id": "40292"}, "3841": {"model_id": "3841", "ARO_accession": "3005114", "model_param": {"blastp_bit_score": {"param_value": "300", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "A fluoroquinolone-acetylating aminoglycoside acetyltransferase variant identified from Enterobacter. These proteins confer resistance to both fluoroquinolone and aminoglycoside antibiotics.", "model_sequences": {"sequence": {"6154": {"dna_sequence": {"partial": "0", "sequence": "ATGGCAATCACAAAGTACAGCATCGTGACCAACAGCACCGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGACGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA", "fmax": "1366", "accession": "JZKY01000061.1", "fmin": "787", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Enterobacter hormaechei subsp. steigerwaltii", "NCBI_taxonomy_id": "299766", "NCBI_taxonomy_cvterm_id": "43330"}, "protein_sequence": {"accession": "KJX28101.1", "sequence": "MAITKYSIVTNSTDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERTRSDA"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35920": {"category_aro_name": "fluoroquinolone antibiotic", "category_aro_cvterm_id": "35920", "category_aro_accession": "0000001", "category_aro_class_name": "Drug Class", "category_aro_description": "The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death."}, "35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}, "43328": {"category_aro_name": "AAC(6')-Ib-cr", "category_aro_cvterm_id": "43328", "category_aro_accession": "3005113", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A subfamily of aminoglycoside 6'-N-acetyltransferases, AAC(6'), which doubly confer resistance to aminoglycoside and fluoroquinolone antibiotics through fluoroquinolone-acetylating activity."}}, "ARO_name": "AAC(6')-Ib-cr4", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43329", "model_name": "AAC(6')-Ib-cr4", "model_type_id": "40292"}, "3840": {"model_id": "3840", "ARO_accession": "3005112", "model_param": {"blastp_bit_score": {"param_value": "275", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "A fluoroquinolone-acetylating aminoglycoside acetyltransferase variant identified from Aeromonas. These proteins confer resistance to both fluoroquinolone and aminoglycoside antibiotics.", "model_sequences": {"sequence": {"6153": {"dna_sequence": {"partial": "0", "sequence": "ATGAGCAACGCAAAAACAAAGTTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGAAGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAAAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGGTAATGGGTCAAACACGCCAAGCATTCGAGCGAACACGCAGTGATGCCTAA", "fmax": "1026", "accession": "HQ170516.1", "fmin": "426", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Aeromonas media", "NCBI_taxonomy_id": "651", "NCBI_taxonomy_cvterm_id": "39526"}, "protein_sequence": {"accession": "ADY02579.1", "sequence": "MSNAKTKLGITKYSIVTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVVMGQTRQAFERTRSDA"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35920": {"category_aro_name": "fluoroquinolone antibiotic", "category_aro_cvterm_id": "35920", "category_aro_accession": "0000001", "category_aro_class_name": "Drug Class", "category_aro_description": "The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death."}, "35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}, "43328": {"category_aro_name": "AAC(6')-Ib-cr", "category_aro_cvterm_id": "43328", "category_aro_accession": "3005113", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A subfamily of aminoglycoside 6'-N-acetyltransferases, AAC(6'), which doubly confer resistance to aminoglycoside and fluoroquinolone antibiotics through fluoroquinolone-acetylating activity."}}, "ARO_name": "AAC(6')-Ib-cr3", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43327", "model_name": "AAC(6')-Ib-cr3", "model_type_id": "40292"}, "3843": {"model_id": "3843", "ARO_accession": "3005116", "model_param": {"blastp_bit_score": {"param_value": "300", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "A fluoroquinolone-acetylating aminoglycoside acetyltransferase variant identified from Escherichia coli. These proteins confer resistance to both fluoroquinolone and aminoglycoside antibiotics.", "model_sequences": {"sequence": {"6156": {"dna_sequence": {"partial": "0", "sequence": "ATGAGCAACGCAAAAACAAAGTTAGGCATCACAAAGTACAGCATCGTGACCAACTGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGGGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGACGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA", "fmax": "1860", "accession": "EU675686.2", "fmin": "1260", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "ACD56150.1", "sequence": "MSNAKTKLGITKYSIVTNCNDSVTLRLMTEHDLAMLYGWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERTRSDA"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35920": {"category_aro_name": "fluoroquinolone antibiotic", "category_aro_cvterm_id": "35920", "category_aro_accession": "0000001", "category_aro_class_name": "Drug Class", "category_aro_description": "The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death."}, "35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}, "43328": {"category_aro_name": "AAC(6')-Ib-cr", "category_aro_cvterm_id": "43328", "category_aro_accession": "3005113", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A subfamily of aminoglycoside 6'-N-acetyltransferases, AAC(6'), which doubly confer resistance to aminoglycoside and fluoroquinolone antibiotics through fluoroquinolone-acetylating activity."}}, "ARO_name": "AAC(6')-Ib-cr6", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43332", "model_name": "AAC(6')-Ib-cr6", "model_type_id": "40292"}, "3842": {"model_id": "3842", "ARO_accession": "3005115", "model_param": {"blastp_bit_score": {"param_value": "300", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "A fluoroquinolone-acetylating aminoglycoside acetyltransferase variant identified from Pseudomonas. These proteins confer resistance to both fluoroquinolone and aminoglycoside antibiotics.", "model_sequences": {"sequence": {"6155": {"dna_sequence": {"partial": "0", "sequence": "GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGAAGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA", "fmax": "1576", "accession": "EU161636.1", "fmin": "1021", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "ABX24471.1", "sequence": "MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERTRSDA"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35920": {"category_aro_name": "fluoroquinolone antibiotic", "category_aro_cvterm_id": "35920", "category_aro_accession": "0000001", "category_aro_class_name": "Drug Class", "category_aro_description": "The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death."}, "35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}, "43328": {"category_aro_name": "AAC(6')-Ib-cr", "category_aro_cvterm_id": "43328", "category_aro_accession": "3005113", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A subfamily of aminoglycoside 6'-N-acetyltransferases, AAC(6'), which doubly confer resistance to aminoglycoside and fluoroquinolone antibiotics through fluoroquinolone-acetylating activity."}}, "ARO_name": "AAC(6')-Ib-cr5", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43331", "model_name": "AAC(6')-Ib-cr5", "model_type_id": "40292"}, "3845": {"model_id": "3845", "ARO_accession": "3005118", "model_param": {"blastp_bit_score": {"param_value": "300", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "A fluoroquinolone-acetylating aminoglycoside acetyltransferase variant, identified from Salmonella. These variants confers resistance to both aminoglycoside and fluoroquinolone antibiotics.", "model_sequences": {"sequence": {"6158": {"dna_sequence": {"partial": "0", "sequence": "GTGACCAATAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGCCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGACGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCGAGGCATTCGAGCGAACACGCAGTGATGCCTAA", "fmax": "426644", "accession": "CP034250.1", "fmin": "426089", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Salmonella enterica subsp. enterica serovar Derby", "NCBI_taxonomy_id": "28144", "NCBI_taxonomy_cvterm_id": "35667"}, "protein_sequence": {"accession": "AZK52946.1", "sequence": "MTNSNDSVTLRLMTEHDLAMLYECLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTREAFERTRSDA"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35920": {"category_aro_name": "fluoroquinolone antibiotic", "category_aro_cvterm_id": "35920", "category_aro_accession": "0000001", "category_aro_class_name": "Drug Class", "category_aro_description": "The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death."}, "35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}, "43328": {"category_aro_name": "AAC(6')-Ib-cr", "category_aro_cvterm_id": "43328", "category_aro_accession": "3005113", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A subfamily of aminoglycoside 6'-N-acetyltransferases, AAC(6'), which doubly confer resistance to aminoglycoside and fluoroquinolone antibiotics through fluoroquinolone-acetylating activity."}}, "ARO_name": "AAC(6')-Ib-cr8", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43334", "model_name": "AAC(6')-Ib-cr8", "model_type_id": "40292"}, "3844": {"model_id": "3844", "ARO_accession": "3005117", "model_param": {"blastp_bit_score": {"param_value": "300", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "A fluoroquinolone-acetylating aminoglycoside acetyltransferase variant identified from Klebsiella. These proteins confer resistance to both fluoroquinolone and aminoglycoside antibiotics.", "model_sequences": {"sequence": {"6157": {"dna_sequence": {"partial": "0", "sequence": "GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGACGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGTTGCCTAA", "fmax": "11629", "accession": "JABGAB010000032.1", "fmin": "11074", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "NON98701.1", "sequence": "MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERTRSVA"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35920": {"category_aro_name": "fluoroquinolone antibiotic", "category_aro_cvterm_id": "35920", "category_aro_accession": "0000001", "category_aro_class_name": "Drug Class", "category_aro_description": "The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death."}, "35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}, "43328": {"category_aro_name": "AAC(6')-Ib-cr", "category_aro_cvterm_id": "43328", "category_aro_accession": "3005113", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A subfamily of aminoglycoside 6'-N-acetyltransferases, AAC(6'), which doubly confer resistance to aminoglycoside and fluoroquinolone antibiotics through fluoroquinolone-acetylating activity."}}, "ARO_name": "AAC(6')-Ib-cr7", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43333", "model_name": "AAC(6')-Ib-cr7", "model_type_id": "40292"}, "3847": {"model_id": "3847", "ARO_accession": "3005121", "model_param": {"blastp_bit_score": {"param_value": "900", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "lsa(D) is an ABC-F subfamily protein expressed in Lactococcus garvieae. It confers resistance to Streptogramins A, Pleuromutilins and Lincosamides.", "model_sequences": {"sequence": {"6160": {"dna_sequence": {"partial": "0", "sequence": "ATGTCGAATATTAAAATAAATAATTTAACATTTGGTTATACCGATCAGCTTATTTTTGACAATGTAAATATCAATATTGATGACCAATGGAAGCTGGGATTGGTTGGCCGTAACGGGAGAGGGAAAACTACACTTTTAAAAATCCTTCTTGGAGAAGTGGATGTACATCTTGAAATTAAAACCAATAAGAGCTTTGTGTATTTTCCTCAGACGATTAATGATAAAGACCAGTTGACCTTATTTGTCTTGCAAGAGTTAGCTGACTTTGAGCAGTGGGAACTTGAGCGTGAATTGACACTAATGGGCGTAGATTTAGATACTTTATGGCGTCCTTTCAATAGTCTTTCTGGTGGAGAGCAAACAAAGACACTCTTAGCACTTTTATTCTTGGATGAGCATAATTATCCGCTCATCGATGAGCCAACCAATCATCTTGATAAAGCTTCACGTGAGAAAGTTGCAGCCTACTTGTCAGAAAAAAAGGGATATATTTTAATCTCACATGACCGTAATTTTCTCAATAAGACGACAGATCATACACTTGCGATAGAGCGTGCGGACTTACAAGTATATGCAGGTAATTTTGCTATCTACGAGGAGGAAAAAAGATTGCGAGATCTCACGGAAAAGGCACAAGATGATAAACTCAGGAAAGAAATCGGTAGATTGAAACAAACGGCGCGTGAAAAAGAAGCGTGGTCGCGTAACTTAGAAGCAACAAAATCCCGTAAGAAACGAGGTTTTGATTCGGAAACAAAACGTGTTGATAAAGGTTTTATTGGACGAAAAGCAGCAAATATGATGCAAAAGTCTAAAAATCTCGAAAAGCGCATGAAAGAGGATATCGCTGACAAGGAACTACTTCTAAAAAATTGGGAAGAAGTACCTGGATTGGAAATGAGTGTCTTAGAGAGTCATCAAAAACGCTTACTGACAGTGGAAAATTTAGCGGCTGGATTTGAAGACTTTCTTTTTGAACCTGTGTCTTTTACACTTGAACAAGGTCAGGTGCTTGCACTAACAGGAGAAAATGGTAGAGGAAAATCTTCTCTAATGAAAGTCCTCACAGGTGAATTTACTGGCCGTTATGTTGGAACATTTGAGTTGGCCCATAACTTGGTCATTTCCGAAGTAAGACAACTTGCAGATAATAGAGGGTTTCTGAACGAGTTTGCCAAAAAAGAAAACTTAGAATTAGAACTTTTTCTCAACAATTTGCGCAAATTAGGCGTAGAGCGCAAAGTTTTTGAGCAAAAAATCGAAAATATGAGTCAGGGACAGCAGCGTAAAGTCGAACTGGCCCGCGCCTTAAGTCAGCCGGCGCATATTTATCTTTGGGATGAACCCCTCAACTATCTTGATGTTTTTAATCAAGAACAAATTATTCAAATGATAAAGAGAAGCAAGCCTAGTATGCTTGTCATTGAGCACGATCAGTATTTTGTTGATCAAGTAGCAGATGCCCAAATCGAACTCATAAAAAGCAGCGTTTAA", "fmax": "1494", "accession": "MH473150.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Lactococcus garvieae", "NCBI_taxonomy_id": "1363", "NCBI_taxonomy_cvterm_id": "43338"}, "protein_sequence": {"accession": "AXF35727.1", "sequence": "MSNIKINNLTFGYTDQLIFDNVNINIDDQWKLGLVGRNGRGKTTLLKILLGEVDVHLEIKTNKSFVYFPQTINDKDQLTLFVLQELADFEQWELERELTLMGVDLDTLWRPFNSLSGGEQTKTLLALLFLDEHNYPLIDEPTNHLDKASREKVAAYLSEKKGYILISHDRNFLNKTTDHTLAIERADLQVYAGNFAIYEEEKRLRDLTEKAQDDKLRKEIGRLKQTAREKEAWSRNLEATKSRKKRGFDSETKRVDKGFIGRKAANMMQKSKNLEKRMKEDIADKELLLKNWEEVPGLEMSVLESHQKRLLTVENLAAGFEDFLFEPVSFTLEQGQVLALTGENGRGKSSLMKVLTGEFTGRYVGTFELAHNLVISEVRQLADNRGFLNEFAKKENLELELFLNNLRKLGVERKVFEQKIENMSQGQQRKVELARALSQPAHIYLWDEPLNYLDVFNQEQIIQMIKRSKPSMLVIEHDQYFVDQVADAQIELIKSSV"}}}}, "ARO_category": {"37014": {"category_aro_name": "pleuromutilin antibiotic", "category_aro_cvterm_id": "37014", "category_aro_accession": "3000670", "category_aro_class_name": "Drug Class", "category_aro_description": "Pleuromutilins are natural fungal products that target bacterial protein translation by binding the the 23S rRNA, blocking the ribosome P site at the 50S subunit. They are mostly used for agriculture and veterinary purposes."}, "35919": {"category_aro_name": "macrolide antibiotic", "category_aro_cvterm_id": "35919", "category_aro_accession": "0000000", "category_aro_class_name": "Drug Class", "category_aro_description": "Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins."}, "41687": {"category_aro_name": "ABC-F ATP-binding cassette ribosomal protection protein", "category_aro_cvterm_id": "41687", "category_aro_accession": "3004469", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A subfamily of the ATP-binding cassette protein superfamily. Unlike other ABC proteins, ABC-F genes are not fused to a transmembrane domain nor associated with transport. It has been shown that ABC-F proteins confer antibiotic resistance via ribosomal protection and not antibiotic efflux as in other ABC proteins."}, "35999": {"category_aro_name": "antibiotic target protection", "category_aro_cvterm_id": "35999", "category_aro_accession": "0001003", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Protection of antibiotic action target from antibiotic binding, which process will result in antibiotic resistance."}, "35945": {"category_aro_name": "streptogramin antibiotic", "category_aro_cvterm_id": "35945", "category_aro_accession": "0000026", "category_aro_class_name": "Drug Class", "category_aro_description": "Streptogramin antibiotics are natural products produced by various members of the Streptomyces genus. These antibiotics bind to the P site of the 50S subunit of bacterial ribosomes to inhibit protein synthesis. The family consists of two subgroups, type A and type B, which are simultaneously produced by the same bacterial species in a ratio of roughly 70:30."}, "36189": {"category_aro_name": "tetracycline antibiotic", "category_aro_cvterm_id": "36189", "category_aro_accession": "3000050", "category_aro_class_name": "Drug Class", "category_aro_description": "These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes."}, "36218": {"category_aro_name": "oxazolidinone antibiotic", "category_aro_cvterm_id": "36218", "category_aro_accession": "3000079", "category_aro_class_name": "Drug Class", "category_aro_description": "Oxazolidinones are a class of synthetic antibiotics discovered the the 1980's.  They inhibit protein synthesis by binding to domain V of the 23S rRNA of the 50S subunit of bacterial ribosomes.  Linezolid is the only member of this class currently in clinical use."}, "36526": {"category_aro_name": "phenicol antibiotic", "category_aro_cvterm_id": "36526", "category_aro_accession": "3000387", "category_aro_class_name": "Drug Class", "category_aro_description": "Phenicols are broad spectrum bacteriostatic antibiotics acting on bacterial protein synthesis. More specifically, the phenicols block peptide elongation by binding to the peptidyltansferase centre of the 70S ribosome."}, "35936": {"category_aro_name": "lincosamide antibiotic", "category_aro_cvterm_id": "35936", "category_aro_accession": "0000017", "category_aro_class_name": "Drug Class", "category_aro_description": "Lincosamides (e.g. lincomycin, clindamycin) are a class of drugs which bind to the 23s portion of the 50S subunit of bacterial ribosomes. This interaction inhibits early elongation of peptide chains by inhibiting the transpeptidase reaction, acting similarly to macrolides."}}, "ARO_name": "lsa(D)", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43337", "model_name": "lsa(D)", "model_type_id": "40292"}, "3846": {"model_id": "3846", "ARO_accession": "3005119", "model_param": {"blastp_bit_score": {"param_value": "300", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "A fluoroquinolone-acetylating aminoglycoside acetyltransferase variant, identified from Serratia. These variants confers resistance to both aminoglycoside and fluoroquinolone antibiotics.", "model_sequences": {"sequence": {"6159": {"dna_sequence": {"partial": "0", "sequence": "ATGAAAACATTTAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGAAGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA", "fmax": "2514", "accession": "MH569711.1", "fmin": "1959", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Serratia marcescens", "NCBI_taxonomy_id": "615", "NCBI_taxonomy_cvterm_id": "36783"}, "protein_sequence": {"accession": "AYD68572.1", "sequence": "MKTFNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERTRSDA"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35920": {"category_aro_name": "fluoroquinolone antibiotic", "category_aro_cvterm_id": "35920", "category_aro_accession": "0000001", "category_aro_class_name": "Drug Class", "category_aro_description": "The fluoroquinolones are a family of synthetic broad-spectrum antibiotics that are 4-quinolone-3-carboxylates. These compounds interact with topoisomerase II (DNA gyrase) to disrupt bacterial DNA replication, damage DNA, and cause cell death."}, "35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}, "43328": {"category_aro_name": "AAC(6')-Ib-cr", "category_aro_cvterm_id": "43328", "category_aro_accession": "3005113", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "A subfamily of aminoglycoside 6'-N-acetyltransferases, AAC(6'), which doubly confer resistance to aminoglycoside and fluoroquinolone antibiotics through fluoroquinolone-acetylating activity."}}, "ARO_name": "AAC(6')-Ib-cr9", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43335", "model_name": "AAC(6')-Ib-cr9", "model_type_id": "40292"}, "3849": {"model_id": "3849", "ARO_accession": "3005123", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-70 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6169": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAAATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCAGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAACTGTTCCCAGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGATCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949085.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG20007.1", "sequence": "MRDTKFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRQVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-70", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43340", "model_name": "PDC-70", "model_type_id": "40292"}, "3848": {"model_id": "3848", "ARO_accession": "3005122", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-68 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa", "model_sequences": {"sequence": {"6161": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCGGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACTCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949083.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG20005.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIADEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDRAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-68", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43339", "model_name": "PDC-68", "model_type_id": "40292"}, "3829": {"model_id": "3829", "ARO_accession": "3005097", "model_param": {"blastp_bit_score": {"param_value": "500", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "A blaZ-like beta-lactamase found in S. Aureus", "model_sequences": {"sequence": {"6140": {"dna_sequence": {"partial": "1", "sequence": "ATGAAAATCACCATTTTAGCTGTAGGGAAACTAAAAGAGAAATATTGGAAGCAAGCCATAGCAGAATATGAAAAACGTTTAGGCCCATACACCAAGATAGACATCATAGAAGTTCCAGACGAAAAAGCACCAGAAAATATGAGCGACAAAGAAATCGAGCAAGTAAAAGAAAAAGAAGGGCAACGAATACTAGCCAAAATCAAACCACAATCAACAGTCATTACATTAGAAATACAAGGAAAGATGCTATCTTCCGAAGGATTGGCCCAAGAATTGAACCAACGCATGACCCAAGGGCAAAGCGACTTTGTATTCGTCATTGGCGGATCAAATGGCCTGCACAAGGACGTCTTACAACGCAGTAACTACGCACTATCATTCAGCAAAATGACATTTCCACATCAAATGATGCGGGTTGTGTTAATTGAGCAAGTGTATAGAGCGTTTAAGATTATGCGCGGAGAAGCGTATCACAAATGA", "fmax": "480", "accession": "FR823292", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Staphylococcus aureus", "NCBI_taxonomy_id": "1280", "NCBI_taxonomy_cvterm_id": "35508"}, "protein_sequence": {"accession": "CBZ41939", "sequence": "MKKLIILVVLALILSACNSKNSTNNDIEKIEKKYGANVGMYALNTQNGKELSFNENKRFAYASTLKTISSAMLLEQTPYNKLDKKIHINKDDIVPYSPVLEKYIGKEITLKKLIEATMLFSDNTANNKIIDELGGYGQVKTKLIDLGDTTTHPSRKEPDLNFYSPKDKRDTSTPLAYGKTLKKLIADGDLSKANKDFLLNLMFKNKSGDTLIKDGAPSNFKVMDKSGQALTYGSRNDVAFVYPDGQDKPIILVIFTNKDRKDGKPNDKIVSEVAEIVLKNINE"}}}}, "ARO_category": {"36017": {"category_aro_name": "penam", "category_aro_cvterm_id": "36017", "category_aro_accession": "3000008", "category_aro_class_name": "Drug Class", "category_aro_description": "Penams, often referred to as penicillins, are a group of antibiotics derived from Penicillium fungi. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "41361": {"category_aro_name": "blaZ beta-lactamase", "category_aro_cvterm_id": "41361", "category_aro_accession": "3004197", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "blaZ beta-lactamases are Class A beta-lactamases. These beta-lactamases are responsible for penicillin resistance in Staphylococcus aureus."}, "35971": {"category_aro_name": "penicillin", "category_aro_cvterm_id": "35971", "category_aro_accession": "0000054", "category_aro_class_name": "Antibiotic", "category_aro_description": "Penicillin (sometimes abbreviated PCN) is a beta-lactam antibiotic used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. It works by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "mecC-type BlaZ", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43312", "model_name": "mecC-type BlaZ", "model_type_id": "40292"}, "3906": {"model_id": "3906", "ARO_accession": "3005190", "model_param": {"blastp_bit_score": {"param_value": "784", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6267": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAATATTATGCCCGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_054682", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Proteus mirabilis", "NCBI_taxonomy_id": "584", "NCBI_taxonomy_cvterm_id": "36771"}, "protein_sequence": {"accession": "WP_085562396.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKYYARGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-149", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43543", "model_name": "CMY-149", "model_type_id": "40292"}, "3907": {"model_id": "3907", "ARO_accession": "3005191", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6268": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGACGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCATTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_048807", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_063859815.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLTHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPALKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-139", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43544", "model_name": "CMY-139", "model_type_id": "40292"}, "3898": {"model_id": "3898", "ARO_accession": "3005182", "model_param": {"blastp_bit_score": {"param_value": "786", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6259": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTCGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_056410", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_104009849.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVAFAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-156", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43535", "model_name": "CMY-156", "model_type_id": "40292"}, "3899": {"model_id": "3899", "ARO_accession": "3005183", "model_param": {"blastp_bit_score": {"param_value": "784", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6260": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGGAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_057614", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_109791215.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAGAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-160", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43536", "model_name": "CMY-160", "model_type_id": "40292"}, "3892": {"model_id": "3892", "ARO_accession": "3002119", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "CMY-107 is a beta-lactamase. From the Lahey list of CMY beta-lactamases.", "model_sequences": {"sequence": {"6253": {"dna_sequence": {"partial": "1", "sequence": "GATTGTGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAACTGACGATGAGGCCCAGGATATTGGGCCTCCTTTCTTTCTCTTTTTTTCCTGTTGTCATCTACACTTAACAAAAATACAGCAAGGAAAATCCCATGCGCA", "fmax": "2097", "accession": "NG_048777", "fmin": "751", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_032494240.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDCAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-107", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "38519", "model_name": "CMY-107", "model_type_id": "40292"}, "3893": {"model_id": "3893", "ARO_accession": "3005176", "model_param": {"blastp_bit_score": {"param_value": "786", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6254": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCATGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_062242", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_122630836.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAMGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-158", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43529", "model_name": "CMY-158", "model_type_id": "40292"}, "3890": {"model_id": "3890", "ARO_accession": "3003654", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From Lahey's list of beta-lactamases, no additional information available", "model_sequences": {"sequence": {"6251": {"dna_sequence": {"partial": "1", "sequence": "AACTGATTTCATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGATTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAACTGACGATGAGGCC", "fmax": "1170", "accession": "KP860987", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "AKA60779.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRFYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-134", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "40264", "model_name": "CMY-134", "model_type_id": "40292"}, "3891": {"model_id": "3891", "ARO_accession": "3005204", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6252": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGACGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_052047", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_071593223.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFDALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-143", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43560", "model_name": "CMY-143", "model_type_id": "40292"}, "3896": {"model_id": "3896", "ARO_accession": "3005180", "model_param": {"blastp_bit_score": {"param_value": "784", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6257": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGCAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_052898", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_077767289.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAAAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-147", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43533", "model_name": "CMY-147", "model_type_id": "40292"}, "3897": {"model_id": "3897", "ARO_accession": "3005181", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6258": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAACAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_052648", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_075985683.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDNKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-146", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43534", "model_name": "CMY-146", "model_type_id": "40292"}, "3894": {"model_id": "3894", "ARO_accession": "3005177", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6255": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCAGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_070783", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_190259774.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHSSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-173", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43530", "model_name": "CMY-173", "model_type_id": "40292"}, "3878": {"model_id": "3878", "ARO_accession": "3005153", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-69 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6202": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCGCCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCCTGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949084.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG20006.1", "sequence": "MRDTRFPCLCGIAASTLLFAATPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLLEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-69", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43370", "model_name": "PDC-69", "model_type_id": "40292"}, "3879": {"model_id": "3879", "ARO_accession": "3005154", "model_param": {"blastp_bit_score": {"param_value": "530", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "APH(3')-XV is an aminoglycoside O-phosphotransferase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6203": {"dna_sequence": {"partial": "0", "sequence": "ATGACAGTCGCCCTCGACGAAGTATCTGAACTAAAGAATTTGCTTTCACCCTTGTTGGATGAATGCACTTTTGAAGAAGTTGAGTATGGTCAGTCAGATGCTCGAGTGATTCGAGTTCTATTTCCTGATCGCAATACCGCGTATCTAAAGTACGCCTCCGGATCTTCTGCTCAAGAAATTCTTCAAGAGCATCAGCGCACTAGATGGCTCAGAACACGAGCTCTCGTACCGGAAGTGATCTCATATGTCTCGACTTCAACTGTCACCATCCTGTTGACAAAAGCATTGATTGGCCACAATGCCGCTGACGCCGCACATGCAGATCCAGCTATTGTTGTTGCAGAGATGGCACGAGCGTTACGCGACCTCCATTCGATCTCGCCTGACGATTGCCCATTCGACGAAAGGCTCCACCTGCGACTGAAGCTGGCTTCGGGCCGTTTGGAAGCCGGGTTAGTTGATGAGGAGGACTTTGATCACGCAAGGCAAGGCATGCTGGCGCGGGATGTTTACGAGCAACTTTTTTTACAAATGCCTGGAGCGGAGCAGCTGGTAGTCACACATGGCGACGCCTGTCCCGAGAACTTCATCTTCCAAGGTAATGCCTTCGTCGGCTTCATAGACTGCGGTCGGGTCGGGCTTGCCGATAAGTATCAAGACCTGGCGCTTGCATCGAGAAACATTGACGCGGTATTTGGACCAGAACTCACTAACCAGTTCTTTATCGAGTATGGAGAGCCAAATCCGAACATAGCTAAGATTGAGTACTACCGGATCTTGGATGAGTTCTTCTAA", "fmax": "1404", "accession": "EU165039.1", "fmin": "609", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "ABY48974.1", "sequence": "MTVALDEVSELKNLLSPLLDECTFEEVEYGQSDARVIRVLFPDRNTAYLKYASGSSAQEILQEHQRTRWLRTRALVPEVISYVSTSTVTILLTKALIGHNAADAAHADPAIVVAEMARALRDLHSISPDDCPFDERLHLRLKLASGRLEAGLVDEEDFDHARQGMLARDVYEQLFLQMPGAEQLVVTHGDACPENFIFQGNAFVGFIDCGRVGLADKYQDLALASRNIDAVFGPELTNQFFIEYGEPNPNIAKIEYYRILDEFF"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36265": {"category_aro_name": "APH(3')", "category_aro_cvterm_id": "36265", "category_aro_accession": "3000126", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'"}, "35935": {"category_aro_name": "aminoglycoside antibiotic", "category_aro_cvterm_id": "35935", "category_aro_accession": "0000016", "category_aro_class_name": "Drug Class", "category_aro_description": "Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth."}, "36997": {"category_aro_name": "G418", "category_aro_cvterm_id": "36997", "category_aro_accession": "3000653", "category_aro_class_name": "Antibiotic", "category_aro_description": "A gentamicin class aminoglycoside antibiotic often used in mammalian cell culture work as a selectable marker for the neo cassette (APH3')."}, "35924": {"category_aro_name": "neomycin", "category_aro_cvterm_id": "35924", "category_aro_accession": "0000005", "category_aro_class_name": "Antibiotic", "category_aro_description": "Neomycin is an aminoglycoside antibiotic used to treat different types of bacterial infections. Neomycin works by binding to the bacterial 30S ribosomal subunit, causing misreading of mRNA and leaving the bacterium unable to synthesize proteins vital to its growth."}}, "ARO_name": "APH(3')-XV", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43371", "model_name": "APH(3')-XV", "model_type_id": "40292"}, "3870": {"model_id": "3870", "ARO_accession": "3005144", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-61 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6194": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCTCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGACCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGTTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCACTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGACGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949076.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19998.1", "sequence": "MRDTRFPCLCGIAASTLLFATTSAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQTLEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-61", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43361", "model_name": "PDC-61", "model_type_id": "40292"}, "3871": {"model_id": "3871", "ARO_accession": "3005145", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-45 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6195": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCAGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949060.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19982.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRQVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-45", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43362", "model_name": "PDC-45", "model_type_id": "40292"}, "3872": {"model_id": "3872", "ARO_accession": "3005146", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-49 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6196": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCACGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCTACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGCCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCACTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949064.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19986.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTYLDVPEAALAQYAQGYGKDDRPLRAGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-49", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43363", "model_name": "PDC-49", "model_type_id": "40292"}, "3873": {"model_id": "3873", "ARO_accession": "3005147", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-50 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6197": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCAATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCACGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGCCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCACTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949065.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19987.1", "sequence": "MRNTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRAGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-50", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43364", "model_name": "PDC-50", "model_type_id": "40292"}, "3874": {"model_id": "3874", "ARO_accession": "3005148", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-48 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6198": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCAGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGTCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCATTGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949063.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19985.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPIAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-48", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43365", "model_name": "PDC-48", "model_type_id": "40292"}, "3875": {"model_id": "3875", "ARO_accession": "3005150", "model_param": {"blastp_bit_score": {"param_value": "750", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PAC-1 is an ambler class C beta-lactamase from the PAC beta-lactamase family. It is found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6199": {"dna_sequence": {"partial": "0", "sequence": "ATGCGGTGTAACAAGAATGTTTTATCTGTGGTTCTGTTGGGCGCGCTGAGCCTCTCGGCGGGCAACGCCTTCGGTCAAGTATCACAAGCCGATGTCGATGCCGTCATCCGCCCCCTGATGAGCAAATATAAGATACCGGGAATGGCCGTGGCCCTCTCGGTGGATGGCCAACACACCTTTTACAACTACGGCGTGGCCTCCAAGGCGACAGGCCAGGCTGTCACCCCCACCACGCTCTTTGAGATCGGCTCCCTGAGCAAGACCTTCACCGCCACTCTGGCCAGCTATGCCCAGGGCCAGGGCAAATTGCAGTGGAGCGACCAGGCCAGCCACTATCTCCCCAGCCTCAAGGGGAGCGCCTTCGATCGGGTCACACTGCTCAATCTGGCCACCCACACCTCGGGCATGCCCCTCTTCGTCCCCGATGAAGTGACCAACCAGGAGCAGCTGATGGCCTGGTACCAGGCTTGGCAGCCGACAGCCCCCATAGGCAGCCAGCGGGTCTACTCCAACCTGGGGATCGGCATGCTGGGGTTGATCACGGCACAGAGCTTACAGAAACCCTTCAGTGAGGCGATGGAGCAGGATCTGCTCGCACCACTGGGCATGAAACACTCCTGGGTCAAGGTGCCGGAAAACCAGATGGCCGAGTATGCCCAGGGCTACAACAAACTGGATGAGCCGGTGCGCGTCACGCCGGGCCCTCCGGATGCAGAAGCCTATGGTTTGAAGTCCAGCAGTGCCGACCTGCTGCGCTGGCTCGATCTCAACATGGCCATCACGCCCCCGTCGCCCGCTTGGCAGCAGGCCATAACGGAGACCCACAAAGGGTATTACCAGACCGGGGAGTTTACCCAAGCCCTGATATGGGAGTACTACCCCTGGCCCACGACCAAAGAAACGTTGCTGGCGGGCAACAGCAGCGAGCGGATCATGAAGGGCCTGGGCGCCAAGCCCCTCACCCCACCCCAAGCAGGGCCAGAGCAGGCCTGGTATAACAAGACCGGCTCCACCAACGGCTTCTCCACCTATGCCGTGTTTATCCCGGGGCAAAAAACCGCACTCATACTGCTGGCCAACAAATGGTATCCGAACGATGCCCGTATCGAAGCGGCATATGAGCTGGTACAACGACTGAAAAAATAG", "fmax": "1491", "accession": "KY285014.1", "fmin": "345", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "APM84516.1", "sequence": "MRCNKNVLSVVLLGALSLSAGNAFGQVSQADVDAVIRPLMSKYKIPGMAVALSVDGQHTFYNYGVASKATGQAVTPTTLFEIGSLSKTFTATLASYAQGQGKLQWSDQASHYLPSLKGSAFDRVTLLNLATHTSGMPLFVPDEVTNQEQLMAWYQAWQPTAPIGSQRVYSNLGIGMLGLITAQSLQKPFSEAMEQDLLAPLGMKHSWVKVPENQMAEYAQGYNKLDEPVRVTPGPPDAEAYGLKSSSADLLRWLDLNMAITPPSPAWQQAITETHKGYYQTGEFTQALIWEYYPWPTTKETLLAGNSSERIMKGLGAKPLTPPQAGPEQAWYNKTGSTNGFSTYAVFIPGQKTALILLANKWYPNDARIEAAYELVQRLKK"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "43366": {"category_aro_name": "PAC beta-lactamase", "category_aro_cvterm_id": "43366", "category_aro_accession": "3005149", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PAC beta-lactamase is an inhibitior-resistant cephalosporin-hydrolyzing class C beta-lactamase."}}, "ARO_name": "PAC-1", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43367", "model_name": "PAC-1", "model_type_id": "40292"}, "3876": {"model_id": "3876", "ARO_accession": "3005151", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-53 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6200": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCAGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAACGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949068.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19990.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRQVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTNAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-53", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43368", "model_name": "PDC-53", "model_type_id": "40292"}, "3877": {"model_id": "3877", "ARO_accession": "3005152", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-72 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6201": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCAGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCGACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949087.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG20009.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRQVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPRRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-72", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43369", "model_name": "PDC-72", "model_type_id": "40292"}, "3727": {"model_id": "3727", "ARO_accession": "3004925", "model_param": {"43012": {"param_value": {"9562": "N111S"}, "param_type_id": "43012", "param_type": "no association with resistance TB", "param_description": "This parameter is part of a confidence model for AMR developed by the Relational Sequencing Tuberculosis Data platform (ReSeqTB, https://platform.reseqtb.org). The confidence model is based on the likelihood ratio test (LR+) statistic that is used to evaluate whether mutations are positively or negatively associated with phenotypic resistance. The LR+ is derived from a drug susceptibility test, testing sensitivity and specificity. Under the null hypothesis of no association, the LR value is expected to be 1, but deviations from this can be due to an association with resistance or a low number of available isolate samples.  The LR+ measures the strength of association between the presence of a mutation and the drug resistance phenotype. A mutation graded as no association has no association of the mutation with phenotypic drug resistance. There is no evidence of an association between the mutation and drug resistance. LR is less than 1. These data are not visible on the CARD website, included in RGI analyses, nor available in CARD download files."}, "43013": {"param_value": {"9561": "T334A", "9564": "L306R"}, "param_type_id": "43013", "param_type": "indeterminate confidence TB", "param_description": "This parameter is part of a confidence model for AMR developed by the Relational Sequencing Tuberculosis Data platform (ReSeqTB, https://platform.reseqtb.org). The confidence model is based on the likelihood ratio test (LR+) statistic that is used to evaluate whether mutations are positively or negatively associated with phenotypic resistance. The LR+ is derived from a drug susceptibility test, testing sensitivity and specificity. Under the null hypothesis of no association, the LR value is expected to be 1, but deviations from this can be due to an association with resistance or a low number of available isolate samples.  The LR+ measures the strength of association between the presence of a mutation and the drug resistance phenotype. A mutation graded as indeterminate means that there is no statistically significant threshold reached and additional data is required. LR is indeterminate."}, "blastp_bit_score": {"param_value": "875", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}, "snp": {"param_type": "single resistance variant", "param_value": {"10059": "F355S"}, "clinical": {"10059": "F355S"}, "param_type_id": "36301", "param_description": "A nucleotide or amino acid substitution that confers elevated resistance to antibiotic(s) relative to wild type. The most common type encoded in the CARD is an amino acid substitution gleaned from the literature with format [wild-type][position][mutation], e.g. R184Q. When present in the associated gene or protein, a single resistance variant confers resistance to an antibiotic drug or drug class. Single resistance variants are used by the protein variant and rRNA mutation models to detect antibiotic resistance from submitted sequences."}, "43011": {"param_value": {"9563": "A187V"}, "param_type_id": "43011", "param_type": "minimal confidence TB", "param_description": "This parameter is part of a confidence model for AMR developed by the Relational Sequencing Tuberculosis Data platform (ReSeqTB, https://platform.reseqtb.org). The confidence model is based on the likelihood ratio test (LR+) statistic that is used to evaluate whether mutations are positively or negatively associated with phenotypic resistance. The LR+ is derived from a drug susceptibility test, testing sensitivity and specificity. Under the null hypothesis of no association, the LR value is expected to be 1, but deviations from this can be due to an association with resistance or a low number of available isolate samples.  The LR+ measures the strength of association between the presence of a mutation and the drug resistance phenotype. A mutation graded as minimal confidence has a minimal association of the mutation with phenotypic drug resistance. There is inconclusive evidence that the mutation confers or is strongly associated with drug resistance. LR value is greater than 1 but less or equal to 5."}}, "ARO_description": "Mutations that occur in Mycobacterium tuberculosis mshA that result in or contribute to antibiotic resistance to isoniazid.", "model_sequences": {"sequence": {"6003": {"dna_sequence": {"partial": "0", "sequence": "ATGGCAGGTGTGCGGCACGATGACGGTTCAGGGTTGATCGCCCAGCGCCGTCCGGTCCGCGGCGAGGGTGCCACCCGCTCGCGCGGCCCATCCGGGCCATCCAATCGGAATGTTTCGGCAGCAGACGACCCGCGCCGGGTTGCGCTGCTGGCGGTGCACACCTCACCGCTGGCACAGCCGGGCACCGGTGACGCCGGCGGCATGAACGTCTACATGCTGCAAAGTGCGCTGCACCTGGCCCGTCGGGGCATCGAGGTGGAGATCTTCACCCGGGCCACCGCATCGGCAGATCCACCGGTGGTGCGGGTGGCACCCGGGGTGCTGGTGCGCAACGTGGTGGCGGGGCCCTTCGAGGGTTTGGACAAGTACGACCTGCCCACCCAGCTTTGTGCGTTCGCCGCCGGGGTGCTGCGCGCCGAGGCGGTCCACGAACCGGGTTACTACGACATCGTGCACTCGCACTACTGGCTGTCGGGTCAGGTCGGCTGGCTGGCGCGCGACCGCTGGGCGGTGCCGTTGGTGCACACCGCACACACGCTGGCCGCCGTGAAGAACGCGGCACTGGCCGACGGCGACGGACCCGAGCCGCCGCTGCGTACGGTCGGGGAGCAGCAGGTCGTCGACGAGGCGGATCGGTTGATCGTCAACACCGACGATGAAGCCAGGCAAGTGATTTCGCTTCATGGTGCCGATCCGGCACGAATCGACGTGGTCCATCCCGGTGTCGATCTGGACGTGTTCCGCCCGGGTGATCGGCGCGCGGCCCGGGCCGCGCTAGGACTACCAGTTGACGAGCGCGTGGTGGCCTTCGTCGGACGCATCCAGCCGCTGAAGGCACCCGACATTGTGCTGCGTGCGGCCGCCAAGTTGCCCGGGGTGCGCATCATCGTGGCCGGCGGACCGTCGGGCAGCGGTCTGGCTTCACCGGACGGACTGGTCCGGCTCGCCGACGAACTGGGCATCTCTGCACGGGTGACGTTTCTGCCGCCGCAGTCCCACACGGATCTGGCCACCTTGTTTCGGGCGGCGGACCTGGTTGCGGTGCCGAGCTACTCCGAGTCGTTCGGCCTGGTTGCTGTGGAGGCCCAAGCGTGCGGCACACCGGTGGTGGCCGCGGCGGTGGGCGGGCTGCCCGTCGCGGTGCGCGACGGGATCACCGGCACCCTGGTGTCCGGGCACGAGGTCGGTCAGTGGGCCGACGCCATCGATCACCTGCTGCGGTTGTGTGCCGGGCCACGGGGACGGGTGATGAGCCGGGCGGCGGCACGGCACGCCGCCACGTTCTCGTGGGAGAACACCACCGACGCGCTGTTGGCCAGTTATCGGCGTGCGATCGGCGAGTACAACGCCGAGCGCCAGCGCCGGGGCGGCGAGGTGATATCGGACCTGGTAGCGGTGGGCAAGCCCCGCCACTGGACGCCGCGTCGCGGGGTGGGCGCGTGA", "fmax": "576790", "accession": "AL123456.3", "fmin": "575347", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Mycobacterium tuberculosis H37Rv", "NCBI_taxonomy_id": "83332", "NCBI_taxonomy_cvterm_id": "39507"}, "protein_sequence": {"accession": "CCP43220.1", "sequence": "MAGVRHDDGSGLIAQRRPVRGEGATRSRGPSGPSNRNVSAADDPRRVALLAVHTSPLAQPGTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPVVRVAPGVLVRNVVAGPFEGLDKYDLPTQLCAFAAGVLRAEAVHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTLAAVKNAALADGDGPEPPLRTVGEQQVVDEADRLIVNTDDEARQVISLHGADPARIDVVHPGVDLDVFRPGDRRAARAALGLPVDERVVAFVGRIQPLKAPDIVLRAAAKLPGVRIIVAGGPSGSGLASPDGLVRLADELGISARVTFLPPQSHTDLATLFRAADLVAVPSYSESFGLVAVEAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWADAIDHLLRLCAGPRGRVMSRAAARHAATFSWENTTDALLASYRRAIGEYNAERQRRGGEVISDLVAVGKPRHWTPRRGVGA"}}}}, "ARO_category": {"36659": {"category_aro_name": "isoniazid", "category_aro_cvterm_id": "36659", "category_aro_accession": "3000520", "category_aro_class_name": "Drug Class", "category_aro_description": "Isoniazid is an organic compound that is the first-line anti tuberculosis medication in prevention and treatment. As a prodrug, it is activated by mycobacterial catalase-peroxidases such as M. tuberculosis KatG. Isoniazid inhibits mycolic acid synthesis, which prevents cell wall synthesis in mycobacteria."}, "35997": {"category_aro_name": "antibiotic target alteration", "category_aro_cvterm_id": "35997", "category_aro_accession": "0001001", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Mutational alteration or enzymatic modification of antibiotic target which results in antibiotic resistance."}, "43087": {"category_aro_name": "isoniazid resistant mshA", "category_aro_cvterm_id": "43087", "category_aro_accession": "3004901", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "mshA is a glycosyltransferase and is involved in the first step of mycothiol biosynthesis. This is a step that is required for growth in mycobacterium tuberculosis. Resistance has been shown in the gene to isoniazid."}}, "ARO_name": "Mycobacterium tuberculosis mshA mutations conferring resistance to isoniazid", "model_type": "protein variant model", "model_description": "The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.", "ARO_id": "43111", "model_name": "Mycobacterium tuberculosis mshA mutations conferring resistance to isoniazid", "model_type_id": "40293"}, "3885": {"model_id": "3885", "ARO_accession": "3005160", "model_param": {"blastp_bit_score": {"param_value": "560", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "OXA-812 is a class D beta-lactamase from the OXA-23 family of OXA beta-lactamases.", "model_sequences": {"sequence": {"6211": {"dna_sequence": {"partial": "0", "sequence": "ATGAATAAATATTTTACTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCAGAGTGAGATTGTTCAAGGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAATTAATCTGTATGGTAATGCTCTAAGCCGTGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCGGATTGGAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTATCGCTTGGGAAAAAGACATGACACTAGGAGAAGCCATGAAGCTTTCCGCAGTCCCAGTCTATCAAGAACTTGCAAGACGTATTGGTCTTGATCTCATGCAAAAAGAAGTAGAACGTATTGATTTCGGTAATACTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGGCCATTAAAGGTTACGCCTATTCAAGAGGTAGAGTTTGTTTCTCAATTGGCGCATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAAAAAATATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCACAAGTGGGCTGGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGAAATGCCGGCATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAA", "fmax": "822", "accession": "MK645924.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter radioresistens", "NCBI_taxonomy_id": "40216", "NCBI_taxonomy_cvterm_id": "39672"}, "protein_sequence": {"accession": "QBQ03037.1", "sequence": "MNKYFTCYVVASLFLSGCTVQHNLINETQSEIVQGHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTFKMLNALIGLENQKTDINEIFKWKGEKRSFIAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVERIDFGNTEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKIFGKTGWAMDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQLNII"}}}}, "ARO_category": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36017": {"category_aro_name": "penam", "category_aro_cvterm_id": "36017", "category_aro_accession": "3000008", "category_aro_class_name": "Drug Class", "category_aro_description": "Penams, often referred to as penicillins, are a group of antibiotics derived from Penicillium fungi. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36026": {"category_aro_name": "OXA beta-lactamase", "category_aro_cvterm_id": "36026", "category_aro_accession": "3000017", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "OXA beta-lactamases were long recognized as a less common but also plasmid-mediated beta-lactamase variety that could hydrolyze oxacillin and related anti-staphylococcal penicillins. These beta-lactamases differ from the TEM and SHV enzymes in that they belong to molecular class D and functional group 2d. The OXA-type beta-lactamases confer resistance to ampicillin and cephalothin and are characterized by their high hydrolytic activity against oxacillin and cloxacillin and the fact that they are poorly inhibited by clavulanic acid. Amino acid substitutions in OXA enzymes can also give the ESBL phenotype. The OXA beta-lactamase family was originally created as a phenotypic rather than a genotypic group for a few beta-lactamases that had a specific hydrolysis profile. Therefore, there is as little as 20% sequence homology among some of the members of this family. However, recent additions to this family show some degree of homology to one or more of the existing members of the OXA beta-lactamase family. Some confer resistance predominantly to ceftazidime, but OXA-17 confers greater resistance to cefotaxime and cefepime than it does resistance to ceftazidime."}}, "ARO_name": "OXA-812", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43378", "model_name": "OXA-812", "model_type_id": "40292"}, "3884": {"model_id": "3884", "ARO_accession": "3005159", "model_param": {"blastp_bit_score": {"param_value": "560", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "OXA-818 is a class D beta-lactamase from the OXA-23 family of OXA beta-lactamases.", "model_sequences": {"sequence": {"6210": {"dna_sequence": {"partial": "0", "sequence": "ATGAATAAATATTTTACTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCAGAGTCAGATTGTTCAAGGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAGCAGATAAAAAAATTAATCTGTATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCGGATTGGAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGGTTGGGAAAAAGACATGACACTAGGAGAAGCCATGAAGCTTTCCGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATGCAAAAAGAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGGCCATTAAAGGTTACGCCTATTCAAGAGGTAGAGTTTGTTTCTCAATTGGCGCATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAAAAAATATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACCGGTTGGGCAATGGATATAAAACCACAAGTGGGCTGGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGAAATGCCTGCATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAA", "fmax": "822", "accession": "MK645930.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter radioresistens", "NCBI_taxonomy_id": "40216", "NCBI_taxonomy_cvterm_id": "39672"}, "protein_sequence": {"accession": "QBQ03043.1", "sequence": "MNKYFTCYVVASLFLSGCTVQHNLINETQSQIVQGHNQVIHQYFDEKNTSGVLVIQADKKINLYGNALSRANTEYVPASTFKMLNALIGLENQKTDINEIFKWKGEKRSFTGWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFGNAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKIFGKTGWAMDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQLNII"}}}}, "ARO_category": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36017": {"category_aro_name": "penam", "category_aro_cvterm_id": "36017", "category_aro_accession": "3000008", "category_aro_class_name": "Drug Class", "category_aro_description": "Penams, often referred to as penicillins, are a group of antibiotics derived from Penicillium fungi. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36026": {"category_aro_name": "OXA beta-lactamase", "category_aro_cvterm_id": "36026", "category_aro_accession": "3000017", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "OXA beta-lactamases were long recognized as a less common but also plasmid-mediated beta-lactamase variety that could hydrolyze oxacillin and related anti-staphylococcal penicillins. These beta-lactamases differ from the TEM and SHV enzymes in that they belong to molecular class D and functional group 2d. The OXA-type beta-lactamases confer resistance to ampicillin and cephalothin and are characterized by their high hydrolytic activity against oxacillin and cloxacillin and the fact that they are poorly inhibited by clavulanic acid. Amino acid substitutions in OXA enzymes can also give the ESBL phenotype. The OXA beta-lactamase family was originally created as a phenotypic rather than a genotypic group for a few beta-lactamases that had a specific hydrolysis profile. Therefore, there is as little as 20% sequence homology among some of the members of this family. However, recent additions to this family show some degree of homology to one or more of the existing members of the OXA beta-lactamase family. Some confer resistance predominantly to ceftazidime, but OXA-17 confers greater resistance to cefotaxime and cefepime than it does resistance to ceftazidime."}}, "ARO_name": "OXA-818", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43377", "model_name": "OXA-818", "model_type_id": "40292"}, "3887": {"model_id": "3887", "ARO_accession": "3005164", "model_param": {"blastp_bit_score": {"param_value": "300", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "dfrA35 is a trimethoprim resistant dihydrofolate reductase gene found in the lncC plasmid pEc158 from E.coli.", "model_sequences": {"sequence": {"6214": {"dna_sequence": {"partial": "0", "sequence": "ATGATTTCAATCGTCGTAGCCAAATCCGCCAATCACGTCATCGGGGTAGACAATCAATTACCGTGGCGATTGCCGTCCGATCTGAAGTGGTTTAAAGAAACGACCACTGGTGGGGTAGTTGTTATGGGACGCAAGACATTTGAATCCATCGGTAAGCCATTGCCGGATCGAATCAATGTGATCATTTCTAAACAACCAGTGCCGATCGAATGGGCAAGTAAGGTAGTTTGGGTTAACTCGATCCAGCAAGCGATGGACTATGTTCGCGGTCTGGATGGGATGATCAAAACATTTATTATTGGCGGGAGTGAGATTTATCGCCAATTTATCTCATTGGTCGATCAGGTGTATCTTACCGAAGTAGGTGCCGAAATAGAAGGCGACGCGACGTTTCAGCCGTTAGACGAACATGAATGGACGCTCAAAACTTGGTGGGTGGTTCCAGACCAATCATCCAAAGATCAATTCCGTTACCAACGTAAGCTCTACGTGAGGAAGGTGTTAGATGAATGA", "fmax": "137647", "accession": "KY887596.1", "fmin": "137134", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "ASF80997.1", "sequence": "MISIVVAKSANHVIGVDNQLPWRLPSDLKWFKETTTGGVVVMGRKTFESIGKPLPDRINVIISKQPVPIEWASKVVWVNSIQQAMDYVRGLDGMIKTFIIGGSEIYRQFISLVDQVYLTEVGAEIEGDATFQPLDEHEWTLKTWWVVPDQSSKDQFRYQRKLYVRKVLDE"}}}}, "ARO_category": {"36327": {"category_aro_name": "trimethoprim", "category_aro_cvterm_id": "36327", "category_aro_accession": "3000188", "category_aro_class_name": "Antibiotic", "category_aro_description": "Trimethoprim is a synthetic 5-(3,4,5- trimethoxybenzyl) pyrimidine inhibitor of dihydrofolate reductase, inhibiting synthesis of tetrahydrofolic acid. Tetrahydrofolic acid is an essential precursor in the de novo synthesis of the DNA nucleotide thymidine. Trimethoprim is a bacteriostatic antibiotic mainly used in the prophylaxis and treatment of urinary tract infections in combination with sulfamethoxazole, a sulfonamide antibiotic."}, "36310": {"category_aro_name": "diaminopyrimidine antibiotic", "category_aro_cvterm_id": "36310", "category_aro_accession": "3000171", "category_aro_class_name": "Drug Class", "category_aro_description": "Diaminopyrimidines are a class of organic compounds containing a pyrimidine ring substituted by two amine groups.  They are inhibitors of dihydrofolate reductase, an enzyme critical for DNA synthesis."}, "37617": {"category_aro_name": "trimethoprim resistant dihydrofolate reductase dfr", "category_aro_cvterm_id": "37617", "category_aro_accession": "3001218", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Alternative dihydropteroate synthase dfr present on plasmids produces alternate proteins that are less sensitive to trimethoprim from inhibiting its role in folate synthesis, thus conferring trimethoprim resistance."}, "35998": {"category_aro_name": "antibiotic target replacement", "category_aro_cvterm_id": "35998", "category_aro_accession": "0001002", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Replacement or substitution of antibiotic action target, which process will result in antibiotic resistance."}}, "ARO_name": "dfrA35", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43516", "model_name": "dfrA35", "model_type_id": "40292"}, "3886": {"model_id": "3886", "ARO_accession": "3005162", "model_param": {"blastp_bit_score": {"param_value": "280", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "FosA7.5 is a variant of the FosA7 gene. This gene is unique from FosA7 in that it is found in Escherichia coli as opposed to Salmonella enterica. It confers resistance to fosfomycin.", "model_sequences": {"sequence": {"6213": {"dna_sequence": {"partial": "0", "sequence": "ATGCTTCAATCTCTGAACCACTTAACGCTTGCTGTCAGTAATTTGCAAAGTAGCCTGACATTCTGGCGCGATTTGCTGGGGTTGCAGTTACATGCTGAGTGGGGTACAGGTGCTTACCTTACCTGTGGTGACCTTTGGCTCTGTCTTTCTTATGACGTATCCCGTAGCTACGTGGCCCCACAGAAAAGTGACTATACCCATTACGCATTCAGCATTGCGCCAGAAGATTTTGAGCCGTTCTCATATAAGCTGAAACAGTCGGGAGTGACGGTCTGGAAAGACAATAAAAGCGAAGGGCAATCTTTCTATTTTCTTGACCCGGATGGCCACAAGCTGGAGCTGCATGTGGGAGATTTAGCATCTCGACTGGCGCAGTGCCGGGAGAGGCCTTACTCTGGAATGCGTTTTGGTCCTGGTAAATAA", "fmax": "3480595", "accession": "CP015912.1", "fmin": "3480172", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "ANQ03635.1", "sequence": "MLQSLNHLTLAVSNLQSSLTFWRDLLGLQLHAEWGTGAYLTCGDLWLCLSYDVSRSYVAPQKSDYTHYAFSIAPEDFEPFSYKLKQSGVTVWKDNKSEGQSFYFLDPDGHKLELHVGDLASRLAQCRERPYSGMRFGPGK"}}}}, "ARO_category": {"35944": {"category_aro_name": "fosfomycin", "category_aro_cvterm_id": "35944", "category_aro_accession": "0000025", "category_aro_class_name": "Drug Class", "category_aro_description": "Fosfomycin (also known as phosphomycin and phosphonomycin) is a broad-spectrum antibiotic produced by certain Streptomyces species. It is effective on gram positive and negative bacteria as it targets the cell wall, an essential feature shared by both bacteria. Its specific target is MurA (MurZ in E.coli), which attaches phosphoenolpyruvate (PEP) to UDP-N-acetylglucosamine, a step of commitment to cell wall synthesis. In the active site of MurA, the active cysteine molecule is alkylated which stops the catalytic reaction."}, "36272": {"category_aro_name": "fosfomycin thiol transferase", "category_aro_cvterm_id": "36272", "category_aro_accession": "3000133", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Catalyzes the addition of a thiol group from a nucleophilic molecule to fosfomycin."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}}, "ARO_name": "FosA7.5", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43514", "model_name": "FosA7.5", "model_type_id": "40292"}, "3881": {"model_id": "3881", "ARO_accession": "3005156", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-28 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6206": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGCTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCAGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "JF326298.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AEM44533.1", "sequence": "MRDTRFPCLCGIAASTLLLATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRQVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-28", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43373", "model_name": "PDC-28", "model_type_id": "40292"}, "3880": {"model_id": "3880", "ARO_accession": "3005155", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-23 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6204": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCGGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCCGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCACCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "FR822747.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "CBZ41773.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIADEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDRAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPITLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-23", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43372", "model_name": "PDC-23", "model_type_id": "40292"}, "3883": {"model_id": "3883", "ARO_accession": "3005158", "model_param": {"blastp_bit_score": {"param_value": "580", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "OXA-668 is a class D beta-lactamase from the OXA-274 family of OXA beta-lactamases.", "model_sequences": {"sequence": {"6209": {"dna_sequence": {"partial": "0", "sequence": "ATGAGTAATTACCGATTTAAATCTAAAATAAAAAGCAGTGTATTGATCATTCTGAGTAGTGTGGCATTTTCAGGTTGTGTTTCTAATGCCAATTTGCATGATCCAGCGTCATCACAAAGAACAAGTGAAATCCCGTTGTTGTTTAATTATGCGCAAACTCAAGCCGTCTTTGTGACTTATGATGGAACTCAATTTAAACGTTATGGGAATGATTTAAATAGAGCCAAGACTGCCTATATTCCAGCCTCTACTTTTAAAATGTTGAATGCCTTAATTGGTTTGCAACATGCGAAAGCGACGAATACAGAAGTATTTAAGTGGAATGGAGAAAAAAGATCTTTTCCTGCATGGGAAAAAGATATGACCTTGGCACAAGCAATGCAGGCTTCAGCCGTACCTGTATATCAGGAGTTGGCACGACGTATTGGCTTGGATTTGATGAGTAAAGAAGTCAAGCGTGTTGGTTTTGGCAATACACAAATTGGTCAACAGGTAGATAATTTCTGGCTAGTCGGCCCATTGAAAATTACCCCAGAGCAAGAAGCTAAATTTGCTTATCAATTGGCAAAGAAAACATTGCCTTTTGATGATGCTGTACAGCAACAAGTTAAAGATATGCTCTATGTCGAAAGACGGGGTGATTCCAAGCTTTATGCCAAAAGTGGATGGGGAATGGATGTGGAGCCACAAGTGGGTTGGTATACGGGATGGGTGGAACAGCCGAATGGTCAGATCACCGCTTTTGCTTTAAATATGCACATGCAGACAGGGGATGATCCTGCTGAACGCAAGCAACTGACATTAAGTATCTTGGATAAATTAGGCTTATTCTTTTATTTGAGATAA", "fmax": "61658", "accession": "JICM01000013.1", "fmin": "60812", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter sp. ETR1", "NCBI_taxonomy_id": "1485002", "NCBI_taxonomy_cvterm_id": "43376"}, "protein_sequence": {"accession": "KEC85091.1", "sequence": "MSNYRFKSKIKSSVLIILSSVAFSGCVSNANLHDPASSQRTSEIPLLFNYAQTQAVFVTYDGTQFKRYGNDLNRAKTAYIPASTFKMLNALIGLQHAKATNTEVFKWNGEKRSFPAWEKDMTLAQAMQASAVPVYQELARRIGLDLMSKEVKRVGFGNTQIGQQVDNFWLVGPLKITPEQEAKFAYQLAKKTLPFDDAVQQQVKDMLYVERRGDSKLYAKSGWGMDVEPQVGWYTGWVEQPNGQITAFALNMHMQTGDDPAERKQLTLSILDKLGLFFYLR"}}}}, "ARO_category": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36017": {"category_aro_name": "penam", "category_aro_cvterm_id": "36017", "category_aro_accession": "3000008", "category_aro_class_name": "Drug Class", "category_aro_description": "Penams, often referred to as penicillins, are a group of antibiotics derived from Penicillium fungi. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36026": {"category_aro_name": "OXA beta-lactamase", "category_aro_cvterm_id": "36026", "category_aro_accession": "3000017", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "OXA beta-lactamases were long recognized as a less common but also plasmid-mediated beta-lactamase variety that could hydrolyze oxacillin and related anti-staphylococcal penicillins. These beta-lactamases differ from the TEM and SHV enzymes in that they belong to molecular class D and functional group 2d. The OXA-type beta-lactamases confer resistance to ampicillin and cephalothin and are characterized by their high hydrolytic activity against oxacillin and cloxacillin and the fact that they are poorly inhibited by clavulanic acid. Amino acid substitutions in OXA enzymes can also give the ESBL phenotype. The OXA beta-lactamase family was originally created as a phenotypic rather than a genotypic group for a few beta-lactamases that had a specific hydrolysis profile. Therefore, there is as little as 20% sequence homology among some of the members of this family. However, recent additions to this family show some degree of homology to one or more of the existing members of the OXA beta-lactamase family. Some confer resistance predominantly to ceftazidime, but OXA-17 confers greater resistance to cefotaxime and cefepime than it does resistance to ceftazidime."}}, "ARO_name": "OXA-668", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43375", "model_name": "OXA-668", "model_type_id": "40292"}, "3882": {"model_id": "3882", "ARO_accession": "3005157", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-41 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6207": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCCATGCGACAATCCTCAACCTGTGCGGCCTCGCCGCTTCCACCCTGTTCTTCGCGACAACATCGGCCTTCGCCACGGAGGCGCCGGCGGAGCGCCTGAAGGCTCTGGTGGACGCCGCCGTGCAACCGGTCATGAAGGCCAATGATATCCCGGGACTGGCCGTCGCCATCACTCTCAAGGGCGAACCGCATTACTTCAGTTATGGGGTGGCCTCGAAGGAGGACGCCCGCAAGGTGACCCCCGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTACGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCGGCACTGGCCCGCCCTGCAGGGCAGCCGCTTCGACGGTATCAGCCTGCTCGACCTCGGCACCTACACCGCTGGCGGCCTGCCGCTACAGTTCCCCGATGCGGTGCAGAAGGATCCGGCGCAGATCCGCGACTATTACCGCCAGTGGCAACCGACCTACGCCCCGGGCAGCCACCGCCAGTACTCCAACCCGAGCATCGGTCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCATTCGAGCGCAGCATGGAACGGCAGCTGTTCCCGGCGCTCGGCCTGGAGCACACCTTTATCCGGGTGCCCGCCGCGCAGCAGGGGCTGTACGCCCAGGGCTACGGCAAGGACGACCACCCGCTGCGGGTCGGACCCGGTCCGCTGGACGCCGAGGCCTACGGGCTGAAGTCCAGCGCTGCGGACCTGCTGCGCTTCGTCGAGGCCAACCTGCACCCCGAGCGCCTGGAGAAGCCCTGGGCGCAGGCCCTCGACGCCACCCATCGCGGCTACTACAAGGTGGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGATTGGCCGATCGACCTGAAGCGCCTGCAGGCGGGCAACTCGGCGCCGATGGCGCTGCAGGCGCACAAGGTCGCCAGGTTGCCGGCGCCGCAAGCCCTGGACGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGTTTCGGCGCCTACCTGGCGTTCATCCCGGGACGCGACGTCGGCCTGGTGATCCTGGCCAATCGCAACTACCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAACAGCAGGCCAAGGTACCGCTGGTGCGTTGA", "fmax": "1194", "accession": "KJ949056.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19978.1", "sequence": "MRHATILNLCGLAASTLFFATTSAFATEAPAERLKALVDAAVQPVMKANDIPGLAVAITLKGEPHYFSYGVASKEDARKVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASRHWPALQGSRFDGISLLDLGTYTAGGLPLQFPDAVQKDPAQIRDYYRQWQPTYAPGSHRQYSNPSIGLFGYLAARSLGQPFERSMERQLFPALGLEHTFIRVPAAQQGLYAQGYGKDDHPLRVGPGPLDAEAYGLKSSAADLLRFVEANLHPERLEKPWAQALDATHRGYYKVGDMTQGLGWEAYDWPIDLKRLQAGNSAPMALQAHKVARLPAPQALDGQRLLNKTGSTNGFGAYLAFIPGRDVGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLVR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-41", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43374", "model_name": "PDC-41", "model_type_id": "40292"}, "3888": {"model_id": "3888", "ARO_accession": "3005166", "model_param": {"blastp_bit_score": {"param_value": "650", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "Tetracycline resistance gene tetX ortholog described by Fang et al. 2020.", "model_sequences": {"sequence": {"6215": {"dna_sequence": {"partial": "0", "sequence": "ATGGCAAACTTGTTACAACAAAACGGTATTGACATTACCGTTTACGAAAGAGATGAAAACCCAAAAGCACGAGTTTGGGGCGGAACGCTTGACCTTCACAAAAATTCAGGACAAGAAGCAATGAAAAAAGTAGGATTGTTGCAAACCTACTATGATTTGGCGCTACCTATGGGCGTAAACTTTGCTGATGAGAAGGGTAACATTATAGCAACAAGAAACCCGACACTCGAAAATAAGTTTGACAACCCCGAAATAAATAGAAACGCGTTGCGAAAAATGTTGCTTGGCAGCTTGAAAAATGACACAGTTGTTTGGGATAGAAAATCTATTGGGCTTGAACAAGAAAACGGAAAATGGCTGCTACATTTTGAAAATAAGCCAACTGCATTGGCCGACTTTATTATTGTTTCCAATGGTGGAATGTCTAAAATAAGAAATTTTGTTTCAGATAATGAAGTCGAAGAAACAGGTACTTTTATTATTCAGGGCGACATTCCTGAACCAGAAACGAACTGCCCTGAATTTTATAAGTTGTGCAACAACAATAGACTAATGACCGCACATCAAGGGAATTTATTAGTTGCGAATCCATTTAACAACGGAATGTTAACTTACGGTGTCATTTTCAAAAAGCCTGAAGAATGGAATAATGGAAAAGGATTAGATTTTAAGCCCACAAAAAGCGTTTCCGAGTTCTTGACAAACAGGTTTTCAAATTGGAGCAATGAATACAAGGAGTTAATTCGTTCAACAACTTTTTTCGTTGGTTTAACAATAAAAATATTTCCGCTAGACAAAAAGCCTTGGAAGAGTAATCGTCCGTTACCCATAACTTTAATTGGCGACACAGCTCACCTAATGCCACCTTTTGCAGGGCAGGGCGTAAACATTGGACTAATGGACGCTTTGATTTTGTCAGAAAATCTTACAAACGGGAAATTTGGAACGATACAAAGTGCTATTGATGACTATGAACAACGAATGTTTGTTTACGCAACAGAAGCACAAGCGGACTCGACAAAGAATGAAATAGAAATGCGAAATCCGAGCTTTACTTTTCAACAGCTAATGAATGTATAA", "fmax": "13189", "accession": "AJ311171", "fmin": "12109", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Bacteroides thetaiotaomicron", "NCBI_taxonomy_id": "818", "NCBI_taxonomy_cvterm_id": "39568"}, "protein_sequence": {"accession": "CAC47933.1", "sequence": "MANLLQQNGIDITVYERDENPKARVWGGTLDLHKNSGQEAMKKVGLLQTYYDLALPMGVNFADEKGNIIATRNPTLENKFDNPEINRNALRKMLLGSLKNDTVVWDRKSIGLEQENGKWLLHFENKPTALADFIIVSNGGMSKIRNFVSDNEVEETGTFIIQGDIPEPETNCPEFYKLCNNNRLMTAHQGNLLVANPFNNGMLTYGVIFKKPEEWNNGKGLDFKPTKSVSEFLTNRFSNWSNEYKELIRSTTFFVGLTIKIFPLDKKPWKSNRPLPITLIGDTAHLMPPFAGQGVNIGLMDALILSENLTNGKFGTIQSAIDDYEQRMFVYATEAQADSTKNEIEMRNPSFTFQQLMNV"}}}}, "ARO_category": {"36189": {"category_aro_name": "tetracycline antibiotic", "category_aro_cvterm_id": "36189", "category_aro_accession": "3000050", "category_aro_class_name": "Drug Class", "category_aro_description": "These antibiotics are derived from tetracycline, a polyketide antibiotic that inhibits the 30S subunit of bacterial ribosomes."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36176": {"category_aro_name": "tetracycline inactivation enzyme", "category_aro_cvterm_id": "36176", "category_aro_accession": "3000036", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "Enzymes or other gene products which hydroxylate tetracycline and other tetracycline derivatives. Hydroxylation inactivates tetracycline-like antibiotics, thus conferring resistance to these compounds."}}, "ARO_name": "Tet(X1)", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43518", "model_name": "Tet(X1)", "model_type_id": "40292"}, "3904": {"model_id": "3904", "ARO_accession": "3005188", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6265": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGAGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_065862", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_148044406.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKEALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-165", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43541", "model_name": "CMY-165", "model_type_id": "40292"}, "3905": {"model_id": "3905", "ARO_accession": "3005189", "model_param": {"blastp_bit_score": {"param_value": "784", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6266": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAACTATCCTATCCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_065863", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_148044407.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKNYPIPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-166", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43542", "model_name": "CMY-166", "model_type_id": "40292"}, "3869": {"model_id": "3869", "ARO_accession": "3005143", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-240 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6193": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGTCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCGCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGCCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "MG696099.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AUT06977.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRRYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRAGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-240", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43360", "model_name": "PDC-240", "model_type_id": "40292"}, "3868": {"model_id": "3868", "ARO_accession": "3005142", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-44 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6192": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGTCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCATGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCCGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949059.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19981.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMAPQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-44", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43359", "model_name": "PDC-44", "model_type_id": "40292"}, "3900": {"model_id": "3900", "ARO_accession": "3005184", "model_param": {"blastp_bit_score": {"param_value": "786", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6261": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAAATTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_060523", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_111273851.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQIDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-162", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43537", "model_name": "CMY-162", "model_type_id": "40292"}, "3901": {"model_id": "3901", "ARO_accession": "3005185", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6262": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAACAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_050943", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_065102238.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDNKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-140", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43538", "model_name": "CMY-140", "model_type_id": "40292"}, "3902": {"model_id": "3902", "ARO_accession": "3005186", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results", "model_sequences": {"sequence": {"6263": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1149", "accession": "NG_065422", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_140423307.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-164", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43539", "model_name": "CMY-164", "model_type_id": "40292"}, "3903": {"model_id": "3903", "ARO_accession": "3005187", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6264": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTTTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_057479", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_109545065.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRFEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-161", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43540", "model_name": "CMY-161", "model_type_id": "40292"}, "3863": {"model_id": "3863", "ARO_accession": "3005137", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-59 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6186": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTTATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCCGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCACCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949074.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19996.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIADEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPITLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-59", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43354", "model_name": "PDC-59", "model_type_id": "40292"}, "3862": {"model_id": "3862", "ARO_accession": "3005136", "model_param": {"blastp_bit_score": {"param_value": "530", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "OXA-906 is a class D beta-lactamase from the OXA-50 family found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6185": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCCCTCTCCTCTTCAGCGCCCTTCTCCTGCTCTCCGGGCATGCCCAGGCCAGCGAATGGAACGACAGCCACGCCGTGGACAAGCTATTCGGCGCGGCCGGGGTGAAAGGCACCTTCGTCCTCTACGATGTGCAGCGGCAGCGCTATGTCGGCCATGACCGGGAGCGCGCGGAAACTCGCTTCGTTCCTGCCTCCACCTACAAGGTGGCGAACAGCCTGATTGGCTTATCCACAGGGGCGGTTAGATCCGCCGACGAGGTTCTTCCCTATGGCGGCAAGCCCCAGCGCTTCAAGGCCTGGGAGCACGACATGAGCCTGCGCGACGCGATCAAGGCATCGAACGTACCGGTCTACCAGGAACTGGCGCGGCGCATCGGCCTGGAGCGGATGCGCGCCAATGTCTCGCACCTGGGTTATGGCAACGCGGAAATCGGCCAGGTTGTGGATAACTTCTGGTTGGTGGGACCGCTGAAGATCAGCGCGATGGAACAGACCCGCTTTCTGCTCCGACTGGCGCAGGGAGAATTGCCATTCCCCGCCCCGGTGCAGTCCACCGTGCGCGCCATGACCCTGCTGGAAAGCGGCCCGGGCTGGGAGCTGCACGGCAAGACCGGCTGGTGCTTCGACTGCACGCCGGAACTCGGCTGGTGGGTGGGCTGGGTGAAGCGCAACGAGCGGCTCTACGGCTTCGCCCTGAACATCGACATGCCCGGCGGCGAGGCCGACATCGGCAAGCGCGTCGAACTGGGCAAGGCCAGTCTCAAGGCTCTCGGGATACTGCCCTGA", "fmax": "789", "accession": "MT040744.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "QIC04089.1", "sequence": "MRPLLFSALLLLSGHAQASEWNDSHAVDKLFGAAGVKGTFVLYDVQRQRYVGHDRERAETRFVPASTYKVANSLIGLSTGAVRSADEVLPYGGKPQRFKAWEHDMSLRDAIKASNVPVYQELARRIGLERMRANVSHLGYGNAEIGQVVDNFWLVGPLKISAMEQTRFLLRLAQGELPFPAPVQSTVRAMTLLESGPGWELHGKTGWCFDCTPELGWWVGWVKRNERLYGFALNIDMPGGEADIGKRVELGKASLKALGILP"}}}}, "ARO_category": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36017": {"category_aro_name": "penam", "category_aro_cvterm_id": "36017", "category_aro_accession": "3000008", "category_aro_class_name": "Drug Class", "category_aro_description": "Penams, often referred to as penicillins, are a group of antibiotics derived from Penicillium fungi. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36026": {"category_aro_name": "OXA beta-lactamase", "category_aro_cvterm_id": "36026", "category_aro_accession": "3000017", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "OXA beta-lactamases were long recognized as a less common but also plasmid-mediated beta-lactamase variety that could hydrolyze oxacillin and related anti-staphylococcal penicillins. These beta-lactamases differ from the TEM and SHV enzymes in that they belong to molecular class D and functional group 2d. The OXA-type beta-lactamases confer resistance to ampicillin and cephalothin and are characterized by their high hydrolytic activity against oxacillin and cloxacillin and the fact that they are poorly inhibited by clavulanic acid. Amino acid substitutions in OXA enzymes can also give the ESBL phenotype. The OXA beta-lactamase family was originally created as a phenotypic rather than a genotypic group for a few beta-lactamases that had a specific hydrolysis profile. Therefore, there is as little as 20% sequence homology among some of the members of this family. However, recent additions to this family show some degree of homology to one or more of the existing members of the OXA beta-lactamase family. Some confer resistance predominantly to ceftazidime, but OXA-17 confers greater resistance to cefotaxime and cefepime than it does resistance to ceftazidime."}}, "ARO_name": "OXA-906", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43353", "model_name": "OXA-906", "model_type_id": "40292"}, "3861": {"model_id": "3861", "ARO_accession": "3005135", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-54 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6184": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGACCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGTCCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCCCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949069.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19991.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPSYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-54", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43352", "model_name": "PDC-54", "model_type_id": "40292"}, "3860": {"model_id": "3860", "ARO_accession": "3005134", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-43 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6183": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGTGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949058.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19980.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPVPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-43", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43351", "model_name": "PDC-43", "model_type_id": "40292"}, "3908": {"model_id": "3908", "ARO_accession": "3005192", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6269": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGACGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_054681", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_085562395.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLTHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-148", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43545", "model_name": "CMY-148", "model_type_id": "40292"}, "3909": {"model_id": "3909", "ARO_accession": "3005193", "model_param": {"blastp_bit_score": {"param_value": "784", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6270": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGACGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGAGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_060564", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_111672906.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLTHTWITVPQNEQKDYAWGYREGKPVHSSPRQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-163", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43546", "model_name": "CMY-163", "model_type_id": "40292"}, "3865": {"model_id": "3865", "ARO_accession": "3005139", "model_param": {"blastp_bit_score": {"param_value": "795", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-67 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa strain 5065", "model_sequences": {"sequence": {"6189": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGGTGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCATTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949082.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG20004.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKVRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-67", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43356", "model_name": "PDC-67", "model_type_id": "40292"}, "3864": {"model_id": "3864", "ARO_accession": "3005138", "model_param": {"blastp_bit_score": {"param_value": "527", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "Pseudomonas aeruginosa strain OXA-50 family oxacillin-hydrolyzing class D beta-lactamase", "model_sequences": {"sequence": {"6188": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCCCTCTCCTCTTCAGTGCCCTTCTCCTGCTTTCCGGGCATACCCAGGCCAGCGAATGGAACGACAGCCAGGCCGTGGACAAGCTATTCGGCGCGGCCGGGGTGAAAGGCACCTTCGTCCTCTACGATGTGCAGCGGCAGCGCTATGTCGGCCATGACCGGGAGCGCGCGGAAACCCGCTTCGTTCCCGCTTCCACCTACAAGGTGGCGAACAGCCTGATAGGCTTATCCACAGGGGCGGTTAGATCCGCCGACGAGGTTCTTCCCTATGGCGGCAAGCCCCAGCGCTTCAAGGCCTGGGAGCACGACATGAGCCTGCGCGACGCGATCAAGGCATCGAACGTACCGGTCTACCAGGAACTGGCGCGGCGCATCGGCCTGGAGCGGATGCGCGCCAATGTCTCGCGCCTGGGTTACGGCAACGCGGAAATCGGCCAGGTTGTGGATAACTTCTGGTTGGTGGGACCGCTGAAGATCAGCGCGATGGAACAGACCCACTTTCTGCTCCGACTGGCGCAGGGAGAATTGCCATTCCCCGCCCCGGTGCAGTCCACCGTGCGCGCCATGACCCTGCTGGAAAGCGGCCCGGGCTGGGAGCTGCACGGCAAGACCGGCTGGTGCTTCGACTGCACGCCGGAACTCGGCTGGTGGGTGGGCTGGGTGAAGCGCAACGAGCGGCTCTACGGCTTCGCCCTGAACATCGACATGCCCGGCGGCGAGGCCGACATCGGCAAGCGCGTCGAACTGGGCAAGGCCAGTCTCAAGGCTCTCGGGATACTGCCCTGA", "fmax": "789", "accession": "MN370858", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "QEJ80887", "sequence": "MRPLLFSALLLLSGHTQASEWNDSQAVDKLFGAAGVKGTFVLYDVQRQRYVGHDRERAETRFVPASTYKVANSLIGLSTGAVRSADEVLPYGGKPQRFKAWEHDMSLRDAIKASNVPVYQELARRIGLERMRANVSRLGYGNAEIGQVVDNFWLVGPLKISAMEQTHFLLRLAQGELPFPAPVQSTVRAMTLLESGPGWELHGKTGWCFDCTPELGWWVGWVKRNERLYGFALNIDMPGGEADIGKRVELGKASLKALGILP"}}}}, "ARO_category": {"35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36017": {"category_aro_name": "penam", "category_aro_cvterm_id": "36017", "category_aro_accession": "3000008", "category_aro_class_name": "Drug Class", "category_aro_description": "Penams, often referred to as penicillins, are a group of antibiotics derived from Penicillium fungi. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36026": {"category_aro_name": "OXA beta-lactamase", "category_aro_cvterm_id": "36026", "category_aro_accession": "3000017", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "OXA beta-lactamases were long recognized as a less common but also plasmid-mediated beta-lactamase variety that could hydrolyze oxacillin and related anti-staphylococcal penicillins. These beta-lactamases differ from the TEM and SHV enzymes in that they belong to molecular class D and functional group 2d. The OXA-type beta-lactamases confer resistance to ampicillin and cephalothin and are characterized by their high hydrolytic activity against oxacillin and cloxacillin and the fact that they are poorly inhibited by clavulanic acid. Amino acid substitutions in OXA enzymes can also give the ESBL phenotype. The OXA beta-lactamase family was originally created as a phenotypic rather than a genotypic group for a few beta-lactamases that had a specific hydrolysis profile. Therefore, there is as little as 20% sequence homology among some of the members of this family. However, recent additions to this family show some degree of homology to one or more of the existing members of the OXA beta-lactamase family. Some confer resistance predominantly to ceftazidime, but OXA-17 confers greater resistance to cefotaxime and cefepime than it does resistance to ceftazidime."}}, "ARO_name": "OXA-850", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43355", "model_name": "OXA-850", "model_type_id": "40292"}, "3917": {"model_id": "3917", "ARO_accession": "3005198", "model_param": {"blastp_bit_score": {"param_value": "775", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lacta NG_055587 mase.", "model_sequences": {"sequence": {"6278": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCACTACTGCTGACAGCCTCTTTCTCAACGTTTGCCGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCGGTTATCTACCAGGGAAAACCGTATTACTTTACCTGGGGTAAAGCTGATATCGCCAATAATCGTCCGATTACACAGAACACACTGTTCGAACTCGGTTCAGTCAGTAAGACCTTCAATGGCGTGCTGGGCGGCGATGCTATCGCCCGCGGCGAAATCAAACTCAGCGATCCGGTCACCCGGTACTGGCCGGAACTCACAGGCAAACAGTGGCAGAACATTAGTCTGCTGCACTTAGCCACATACACGGCAGGTGGCCTGCCGCTTCAGATCCCCGACGAGGTGACGGATAAAACCGCATTGCTGCGCTTTTATCAAAACTGGCAACCCCAGTGGGCCCCGGGCGCTAAACGTCTCTATGCTAACTCCAGCATTGGTCTGTTTGGCGCACTGGCGGTGAAACCCTCTGGAATGAGCTACGAAGGGGCGATGATCAGACGCGTCCTGCAGCCATTAAAACTCACTCACACCTGGATTACCGTTCCGCAGAACGAGCAACGAGATTATGCCTGGGGCTATCGCGATGGCAAGCCCGTACATGTTTCGCCGGGCCAGCTTGATGCCGAAGCGTATGGTGTGAAATCCAGCATTATGGATATGGCTCGCTGGGTTCAGGTCAATATGGACGCCAGCCACGTGCAGGAGAAAACCCTGCAGCAGGGCATCGGGCTCGCACAGTCACGTTACTGGCGCATTGGTGAGATGTACCAGGGCTTAGGCTGGGAAATGCTTAACTGGCCGGTAAAAGCAGACACTATTATCAACGGCAGCGACAGTAAAATCGCTCTGGCGGCGCTTCCGGCCGTTGAGGTAAACCCACCTGCCCCCGCAGTAAAAGCCTCCTGGGTACATAAAACAGGTTCGACTGGCGGATTTGGTAGTTATGTGGCTTTTATTCCGGAGAAAAATCTTGGCATCGTGATGCTGGCCAATAAAAGCTACCCGAATCCTGCTCGCGTCGACGCGGCATGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_055587", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Citrobacter sp.", "NCBI_taxonomy_id": "1896336", "NCBI_taxonomy_cvterm_id": "43553"}, "protein_sequence": {"accession": "WP_096807446.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNRPITQNTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTRYWPELTGKQWQNISLLHLATYTAGGLPLQIPDEVTDKTALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEGAMIRRVLQPLKLTHTWITVPQNEQRDYAWGYRDGKPVHVSPGQLDAEAYGVKSSIMDMARWVQVNMDASHVQEKTLQQGIGLAQSRYWRIGEMYQGLGWEMLNWPVKADTIINGSDSKIALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFIPEKNLGIVMLANKSYPNPARVDAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-157", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43552", "model_name": "CMY-157", "model_type_id": "40292"}, "3916": {"model_id": "3916", "ARO_accession": "3003130", "model_param": {"blastp_bit_score": {"param_value": "775", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From the Lahey list of beta-lactamases. Not yet released.", "model_sequences": {"sequence": {"6277": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCATTCTCCACGTTTGCCGCCGCCAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACTCAGTCACGCAGCAAACTCTGTTTGAGCTAGGGTCGGTCAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCAGCCTGCTGCACTTAGCCACCTACACGGCAGGCGGCCTGCCGCTGCAGATCCCCGATGACGTTACGGATAAAGCCGCATTACTGCGTTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGTCTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGTATGAGCTACGAAGAGGCAATGACCAAACGCGTCCTGCAGCCATTAAAACTGGCGCATACCTGGATTACGATTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAATGGAAGCCCGTACACGTTACTCCTGGACAACTTGATGCCGAAGCCTATGGCGTGAAATCCAGCGTTACCGATATGGCACGCTGGGTTCAGGTCAACATGGACGCCAGCCGCGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAATCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAGGCTGATTCGATCATCAACGGCAGTGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCGGCAGTGAAAGCCTCATGGGTGCATAAAACGGGATCCACTGGTGGATTTGGCAGCTACGTTGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_048793", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Citrobacter", "NCBI_taxonomy_id": "544", "NCBI_taxonomy_cvterm_id": "37053"}, "protein_sequence": {"accession": "WP_063859757.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHSVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTKRVLQPLKLAHTWITIPQNEQKDYAWGYREWKPVHVTPGQLDAEAYGVKSSVTDMARWVQVNMDASRVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-122", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "39707", "model_name": "CMY-122", "model_type_id": "40292"}, "3915": {"model_id": "3915", "ARO_accession": "3005197", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6276": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTACCGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_052649", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_075985684.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-145", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43551", "model_name": "CMY-145", "model_type_id": "40292"}, "3914": {"model_id": "3914", "ARO_accession": "3003133", "model_param": {"blastp_bit_score": {"param_value": "783", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From the Lahey list of beta-lactamases. Not yet released.", "model_sequences": {"sequence": {"6275": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCAGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCAGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTACGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAGCGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_048795", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Citrobacter freundii", "NCBI_taxonomy_id": "546", "NCBI_taxonomy_cvterm_id": "36915"}, "protein_sequence": {"accession": "WP_063859768.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARSEIKLSDPVTKYWPELTGKQWQGISLLHLATYTAGGLPLQIPDDVTDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIISGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-125", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "39710", "model_name": "CMY-125", "model_type_id": "40292"}, "3913": {"model_id": "3913", "ARO_accession": "3003132", "model_param": {"blastp_bit_score": {"param_value": "786", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From the Lahey list of beta-lactamases. Not yet released.", "model_sequences": {"sequence": {"6274": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCATTCTCCACGTTTGCCGCCGCCAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGGTCGGTCAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCAGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTACAGATAAAGCCGCATTACTGCGTTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGTCTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACAGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTACTCCTGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAACGTTACCGATATGGCCCGTTGGATTCAGGTCAACATGGACGCCAGCCGCGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGTGACAGCAAAGTGGCATTGGCAGCGCTTCACACCGTTGAGGTAAACCCGCCCGCCCCGGCAGTGAAAGCCTCATGGGTGCATAAAACGGGATCCACTGGTGGATTTGGCAGCTACGTTGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_048794", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Citrobacter freundii complex", "NCBI_taxonomy_id": "1344959", "NCBI_taxonomy_cvterm_id": "43550"}, "protein_sequence": {"accession": "WP_063859763.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVTPGQLDAEAYGVKSNVTDMARWIQVNMDASRVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALHTVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-124", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "39709", "model_name": "CMY-124", "model_type_id": "40292"}, "3912": {"model_id": "3912", "ARO_accession": "3005196", "model_param": {"blastp_bit_score": {"param_value": "786", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6273": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGCTCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_051215", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_065644637.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQLPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-141", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43549", "model_name": "CMY-141", "model_type_id": "40292"}, "3911": {"model_id": "3911", "ARO_accession": "3005195", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6272": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTAGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_051753", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_070064537.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSISLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-142", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43548", "model_name": "CMY-142", "model_type_id": "40292"}, "3910": {"model_id": "3910", "ARO_accession": "3005194", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NBCI facompare results. It is a beta-lactamase.", "model_sequences": {"sequence": {"6271": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGAGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACAGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_055270", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_088245213.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGELAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHSSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-154", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43547", "model_name": "CMY-154", "model_type_id": "40292"}, "3919": {"model_id": "3919", "ARO_accession": "3005200", "model_param": {"blastp_bit_score": {"param_value": "775", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. Beta-lactamase.", "model_sequences": {"sequence": {"6280": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTATCCACGTTTGCCGCCGCCAAAACAGAACCACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCTGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCACCAATAACCACCCAGTCACGCAGCAAACTCTGTTTGAGCTAGGGTCGGTCAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCAGCCTGCTGCACTTAGCCACCTACACGGCAGGCGGCCTGCCGCTGCAGATCCCCGATGACGTTACGGATAAAGCCGCATTACTGCGTTTTTATCAAAACTGGCAGCCGCAATGGGCCCCGGGCGCTAAGCGTCTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACAGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGGCTGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGTCAACATGGACGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCAATCATCAACGGTAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGATCCACTGGAGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCTTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_055473", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella sp. KF07", "NCBI_taxonomy_id": "1727153", "NCBI_taxonomy_cvterm_id": "43556"}, "protein_sequence": {"accession": "WP_094009802.1", "sequence": "MMKKSLCCALLLTASLSTFAAAKTEPQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADITNNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKAVHVSPGQLDAEAYGVKSSVIDMARWVQVNMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNLVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-155", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43555", "model_name": "CMY-155", "model_type_id": "40292"}, "3918": {"model_id": "3918", "ARO_accession": "3005199", "model_param": {"blastp_bit_score": {"param_value": "785", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "From NCBI facompare results. Beta-lactamase.", "model_sequences": {"sequence": {"6279": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGAGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "1146", "accession": "NG_068165", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "WP_168247875.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPSMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}, "ARO_category": {"36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "36208": {"category_aro_name": "CMY beta-lactamase", "category_aro_cvterm_id": "36208", "category_aro_accession": "3000069", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "CMY beta-lactamases are plasmid-mediated class C beta-lactamases that encodes for resistance to cephamycins."}, "35962": {"category_aro_name": "cephamycin", "category_aro_cvterm_id": "35962", "category_aro_accession": "0000044", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephamycins are a group of beta-lactam antibiotics, very similar to cephalosporins. Together with cephalosporins, they form a sub-group of antibiotics known as cephems. Cephamycins are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. The 7-alpha-methoxy group increases resistance to beta-lactamases."}}, "ARO_name": "CMY-171", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43554", "model_name": "CMY-171", "model_type_id": "40292"}, "3867": {"model_id": "3867", "ARO_accession": "3005141", "model_param": {"blastp_bit_score": {"param_value": "800", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-52 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"sequence": {"6191": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAGCGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949067.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19989.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTSGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-52", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43358", "model_name": "PDC-52", "model_type_id": "40292"}, "3866": {"model_id": "3866", "ARO_accession": "3005140", "model_param": {"blastp_bit_score": {"param_value": "795", "param_type_id": "40725", "param_type": "BLASTP bit-score", "param_description": "A score is a numerical value that describes the overall quality of an alignment with higher numbers correspond to higher similarity. The bit-score (S) is determined by the following formula: S = (\u03bb \u00d7 S \u2212 lnK)/ ln2 where \u03bb is the Gumble distribution constant, S is the raw alignment score, and K is a constant associated with the scoring matrix. Many AMR detection models use this parameter, including the protein homolog and protein variant models. The BLASTP bit-score parameter is a curated value determined from BLASTP analysis of the canonical reference sequence of a specific AMR-associated protein against the database of CARD reference sequence. This value establishes a threshold for computational prediction of a specific protein amongst a batch of submitted sequences."}}, "ARO_description": "PDC-56 is an ambler class C beta-lactamase found in Pseudomonas aeruginosa strain 4883", "model_sequences": {"sequence": {"6190": {"dna_sequence": {"partial": "0", "sequence": "ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATTGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCAGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTACCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA", "fmax": "1194", "accession": "KJ949071.1", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AIG19993.1", "sequence": "MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRQVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR"}}}}, "ARO_category": {"36237": {"category_aro_name": "PDC beta-lactamase", "category_aro_cvterm_id": "36237", "category_aro_accession": "3000098", "category_aro_class_name": "AMR Gene Family", "category_aro_description": "PDC beta-lactamases are class C beta-lactamases that are found in Pseudomonas aeruginosa."}, "35923": {"category_aro_name": "monobactam", "category_aro_cvterm_id": "35923", "category_aro_accession": "0000004", "category_aro_class_name": "Drug Class", "category_aro_description": "Monobactams are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Unlike penams and cephems, monobactams do not have any ring fused to its four-member lactam structure. Monobactam antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "35951": {"category_aro_name": "cephalosporin", "category_aro_cvterm_id": "35951", "category_aro_accession": "0000032", "category_aro_class_name": "Drug Class", "category_aro_description": "Cephalosporins are a class of beta-lactam antibiotics, containing the beta-lactam ring fused with a dihydrothiazolidine ring. Together with cephamycins they belong to a sub-group called cephems. Cephalosporin are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}, "36000": {"category_aro_name": "antibiotic inactivation", "category_aro_cvterm_id": "36000", "category_aro_accession": "0001004", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Enzymatic inactivation of antibiotic to confer drug resistance."}, "35939": {"category_aro_name": "carbapenem", "category_aro_cvterm_id": "35939", "category_aro_accession": "0000020", "category_aro_class_name": "Drug Class", "category_aro_description": "Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms."}}, "ARO_name": "PDC-56", "model_type": "protein homolog model", "model_description": "The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.", "ARO_id": "43357", "model_name": "PDC-56", "model_type_id": "40292"}}}