Model_id Action ARO_name ARO_category Changes To Summary 2852 UPDATE PDC-73 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCTGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057742.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18013.1 UPDATED sequence with GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNLSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR " 343 UPDATE OXA-31 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 813 UPDATE OXA-216 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3494 UPDATE OXA-409 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 816 UPDATE OXA-3 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2910 UPDATE OXA-665 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2858 UPDATE PDC-79 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGACCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTTCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCAAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057748.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18019.1 UPDATED sequence with GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAKGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR " 2912 UPDATE OXA-274 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2913 UPDATE OXA-286 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3428 UPDATE OXA-261 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 714 UPDATE dfrB1 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGGAACGAAGTAGCAATGAAGTCAGTAATCCAGTTGCTGGCAATTTTGTATTCCCATCGAACGCCACGTTTGGTATGGGAGATCGCGTGCGCAAGAAATCCGGCGCCGCCTGGCAAGGTCAGATTGTCGGGTGGTACTGCACAAATTTGACCCCCGAAGGCTACGCCGTCGAGTCTGAGGCTCACCCAGGCTCAGTACAGATTTATCCTGTTGCGGCGCTTGAACGCATCAACTGA UPDATED fmax with 953 UPDATED accession with U36276.1 UPDATED fmin with 716 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with AAA82255.1 UPDATED sequence with MERSSNEVSNPVAGNFVFPSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN " 2855 UPDATE PDC-76 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGTCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCCCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCATTGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057745.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18016.1 UPDATED sequence with GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPIAERVKIAYAILSGLEQQGKVPLKR " 2854 UPDATE PDC-75 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTATGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGACTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCCCTACGGGTCGGTCCCCGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCATGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057744.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18015.1 UPDATED sequence with GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPRPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR " 2857 UPDATE PDC-78 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGACCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCACTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTTCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCCGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057747.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18018.1 UPDATED sequence with GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSHFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPRPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR " 2856 UPDATE PDC-77 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGACCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTTCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCCGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGACTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGGCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057746.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18017.1 UPDATED sequence with GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPRPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR " 1496 UPDATE OXA-224 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3334 UPDATE AAC(6')-Il AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3338 UPDATE AAC(6')-Iag antibiotic inactivation; kanamycin A; aminoglycoside antibiotic; AAC(6'); isepamicin; sisomicin; arbekacin; amikacin; dibekacin; tobramycin; ARO_category "DELETED 36999 " 1068 UPDATE AAC(6')-Ib3 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1394 UPDATE OXA-257 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1706 UPDATE OXA-142 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1065 UPDATE OXA-384 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 295 UPDATE OXA-145 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1660 UPDATE OXA-375 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1128 UPDATE OXA-23 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1083 UPDATE OXA-323 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1122 UPDATE OXA-180 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 191 UPDATE OXA-199 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 190 UPDATE OXA-195 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1126 UPDATE OXA-184 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 274 UPDATE OXA-174 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 18 UPDATE OXA-212 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 521 UPDATE OXA-386 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 523 UPDATE OXA-75 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1403 UPDATE OXA-388 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1402 UPDATE OXA-390 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1016 UPDATE OXA-255 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1406 UPDATE OXA-121 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1235 UPDATE AAC(6')-Ib' AAC(6'); antibiotic inactivation; amikacin; aminoglycoside antibiotic; tobramycin; ARO_category "DELETED 35953 " 441 UPDATE OXA-54 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1238 UPDATE OXA-397 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 444 UPDATE AAC(6')-Ib-Suzhou AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 104 UPDATE OXA-61 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 902 UPDATE OXA-92 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2047 UPDATE OXA-322 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2041 UPDATE OXA-424 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1841 UPDATE OXA-76 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1840 UPDATE CMY-59 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED partial with 1 UPDATED sequence with GGGCCCGGACACCTTTTTGCTTTTAATTACGGAACTGATTTCATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGCTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA UPDATED fmax with 1188 UPDATED accession with AB587082 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with BAJ17544.1 UPDATED sequence with GPGHLFAFNYGTDFMMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHASPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ " 2048 UPDATE OXA-57 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1844 UPDATE OXA-128 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1536 UPDATE OXA-421 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1532 UPDATE OXA-249 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 439 UPDATE SHV-83 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences "UPDATED partial with 1 UPDATED sequence with AAGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGGATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 861 UPDATED accession with AM176558 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAJ47138.2 UPDATED sequence with KRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR " 649 UPDATE OXA-115 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 430 UPDATE OXA-87 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 339 UPDATE ANT(3'')-Ii-AAC(6')-IId fusion protein AAC(6'); antibiotic inactivation; ANT(3''); aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3800 UPDATE OXA-837 antibiotic inactivation; penam; carbapenem; cephalosporin; ampicillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1909 UPDATE AAC(6')-Iak AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1902 UPDATE OXA-246 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3452 UPDATE OXA-288 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3450 UPDATE OXA-285 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3451 UPDATE OXA-287 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 850 UPDATE OXA-26 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3457 UPDATE OXA-294 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3454 UPDATE OXA-291 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 853 UPDATE OXA-160 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3513 UPDATE OXA-443 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3512 UPDATE OXA-442 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3511 UPDATE OXA-441 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3459 UPDATE OXA-297 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3517 UPDATE OXA-448 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3516 UPDATE OXA-447 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3515 UPDATE OXA-446 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3514 UPDATE OXA-444 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 555 UPDATE OXA-133 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 554 UPDATE OXA-163 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3508 UPDATE OXA-438 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3509 UPDATE OXA-439 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3441 UPDATE OXA-275 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 96 UPDATE OXA-426 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1995 UPDATE AAC(6')-Iz AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1625 UPDATE OXA-179 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2860 UPDATE PDC-81 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCTGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057750.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18021.1 UPDATED sequence with GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNLSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 2861 UPDATE PDC-82 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGCTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCCTGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057751.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18022.1 UPDATED sequence with GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQLPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLLEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 2862 UPDATE PDC-83 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGCGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGCCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057752.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18023.1 UPDATED sequence with GEAPADRLKALVDAAVQPAMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRAGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 2863 UPDATE PDC-84 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGCGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGCCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCATTGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057753.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18024.1 UPDATED sequence with GEAPADRLKALVDAAVQPAMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRAGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPIAERVKIAYAILSGLEQQAKVPLKR " 2864 UPDATE PDC-85 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GGCGAGGCCCCGGCGGATCGCCTGAAGGCATTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGTCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCCATGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCTAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTATGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057754.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18025.1 UPDATED sequence with GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGHGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 2866 UPDATE PDC-87 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCTTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCATTGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057756.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18027.1 UPDATED sequence with DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPIAERVKIAYAILSGLEQQAKVPLKR " 2867 UPDATE PDC-88 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCTTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGATGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1110 UPDATED accession with KR057757.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18028.1 UPDATED sequence with DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 2868 UPDATE PDC-89 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGTCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCAATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGGCGCTGCAGCCGCACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1107 UPDATED accession with KR057758.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18029.1 UPDATED sequence with DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 2869 UPDATE PDC-90 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCCGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACTCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGGCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1107 UPDATED accession with KR057759.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18030.1 UPDATED sequence with DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 3633 UPDATE OXA-724 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 239 UPDATE OXA-83 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 235 UPDATE OXA-181 penam; antibiotic inactivation; cephalosporin; carbapenem; piperacillin-tazobactam; amoxicillin; clavulanic acid; piperacillin; tazobactam; OXA beta-lactamase; amoxicillin-clavulanic acid; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3507 UPDATE OXA-437 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 230 UPDATE OXA-422 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 231 UPDATE OXA-178 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1050 UPDATE AAC(6')-Ii AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; plazomicin; ARO_category "DELETED 35953 " 1052 UPDATE OXA-206 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1365 UPDATE AAC(6')-I30 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1190 UPDATE OXA-354 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3340 UPDATE aacA43 AAC(6'); kanamycin A; antibiotic inactivation; aminoglycoside antibiotic; tobramycin; ARO_category "DELETED 35926 " 1194 UPDATE OXA-16 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1196 UPDATE OXA-71 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1694 UPDATE OXA-353 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1692 UPDATE tetM chlortetracycline; demeclocycline; oxytetracycline; tetracycline antibiotic; tetracycline; antibiotic target protection; minocycline; tetracycline-resistant ribosomal protection protein; doxycycline; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGAAAATTATTAATATTGGAGTTTTAGCTCATGTTGATGCGGGAAAAACTACCTTAACAGAAAGCTTATTATATAACAGTGGAGCGATTACAGAATTAGGAAGCGTGGACAAAGGTACAACGAGGACGGATAATACGCTTTTAGAACGTCAGAGAGGAATTACAATTCAGACAGGAATAACCTCTTTTCAGTGGGAAAATACGAAGGTGAACATCATAGACACGCCAGGACATATGGATTTCTTAGCAGAAGTATATCGTTCATTATCAGTTTTAGATGGGGCAATTCTACTGATTTCTGCAAAAGATGGCGTACAAGCACAAACTCGTATATTATTTCATGCACTTAGGAAAATGGGGATTCCCACAATCTTTTTTATCAATAAGATTGACCAAAATGGAATTGATTTATCAACGGTTTATCAGGATATTAAAGAGAAACTTTCTGCCGAAATTGTAATCAAACAGAAGGTAGAACTGTATCCTAATATGTGTGTGACGAACTTTACCGAATCTGAACAATGGGATACGGTAATAGAGGGAAACGATGACCTTTTAGAGAAATATACGTCTGGGAAATTATTGGAAGCATTAGAACTCGAACAAGAGGAAAGCATAAGATTTCATAATTGTTCCCTGTTCCCTGTTTATCACGGAAGTGCAAAAAACAATATAGGGATTGATAACCTTATAGAAGTGATTACGAATAAATTTTATTCATCAACACATCGAGGTCAGTCTGAACTTTGCGGAAAAGTTTTCAAAATTGAATATACAAAAAAAAGACAACGTCTTGCATATATACGCCTTTATAGTGGAGTACTACATTTACGAGATTCGGTTAGAGTATCAGAAAAAGAAAAAATAAAAGTTACAGAAATGTATACTTCAATAAATGGTGAATTATGTAAGATTGATAGAGCTTATTCTGGAGAAATTGTTATTTTGCAAAATGAGTTTTTGAAGTTAAATAGTGTTCTTGGAGATACAAAACTATTGCCACAGAGAAAAAAGATTGAAAATCCGCACCCTCTACTACAAACAACTGTTGAACCGAGTAAACCTGAACAGAGAGAAATGTTGCTTGATGCCCTTTTGGAAATCTCAGATAGTGATCCGCTTCTACGATATTACGTGGATTCTACGACACATGAAATTATACTTTCTTTCTTAGGGAAAGTACAAATGGAAGTGATTAGTGCACTGTTGCAAGAAAAGTATCATGTGGAGATAGAACTAAAAGAGCCTACAGTCATTTATATGGAGAGACCGTTAAAAAATGCAGAATATACCATTCACATCGAAGTGCCGCCAAATCCTTTCTGGGCTTCCATTGGTTTATCTGTATCACCGCTTCCGTTGGGAAGTGGAATGCAGTATGAGAGCTCGGTTTCTCTTGGATACTTAAATCAATCATTTCAAAATGCAGTTATGGAGGGGATACGCTATGGCTGTGAACAAGGATTGTATGGTTGGAATGTGACGGACTGTAAAATCTGTTTTAAGTATGGCTTATACTATAGCCCTGTTAGTACCCCAGCAGATTTTCGGATGCTTGCTCCTATTGTATTGGAACAAGTCTTAAAAAAAGCTGGAACAGAATTGTTAGAGCCATATCTTAGTTTTAAAATTTATGCGCCACAGGAATATCTTTCACGAGCATACAACGATGCTCCTAAATATTGTGCGAACATCGTAGACACTCAATTGAAAAATAATGAGGTCATTCTTAGTGGAGAAATCCCTGCTCGGTGTATTCAAGAATATCGTAGTGATTTAACTTTCTTTACAAATGGACGTAGTGTTTGTTTAACAGAGTTAAAAGGGTACCATGTTACTACCGGTGAACCTGTTTGCCAGCCCCGTCGTCCAAATAGTCGGATAGATAAAGTACGATATATGTTCAATAAAATAACTTAG UPDATED fmax with 1945 UPDATED accession with AB039845.1 UPDATED fmin with 25 UPDATED strand with + UPDATED NCBI_taxonomy_name with Erysipelothrix rhusiopathiae UPDATED NCBI_taxonomy_id with 1648 UPDATED NCBI_taxonomy_cvterm_id with 43311 UPDATED accession with BAB82500.1 UPDATED sequence with MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDGVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIEGNDDLLEKYTSGKLLEALELEQEESIRFHNCSLFPVYHGSAKNNIGIDNLIEVITNKFYSSTHRGQSELCGKVFKIEYTKKRQRLAYIRLYSGVLHLRDSVRVSEKEKIKVTEMYTSINGELCKIDRAYSGEIVILQNEFLKLNSVLGDTKLLPQRKKIENPHPLLQTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGKVQMEVISALLQEKYHVEIELKEPTVIYMERPLKNAEYTIHIEVPPNPFWASIGLSVSPLPLGSGMQYESSVSLGYLNQSFQNAVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYSPVSTPADFRMLAPIVLEQVLKKAGTELLEPYLSFKIYAPQEYLSRAYNDAPKYCANIVDTQLKNNEVILSGEIPARCIQEYRSDLTFFTNGRSVCLTELKGYHVTTGEPVCQPRRPNSRIDKVRYMFNKIT " 1690 UPDATE OXA-317 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1758 UPDATE OXA-326 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1750 UPDATE OXA-254 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 146 UPDATE OXA-98 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 147 UPDATE OXA-27 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 145 UPDATE OXA-229 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1172 UPDATE OXA-194 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 140 UPDATE AAC(6')-IIb AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1271 UPDATE AAC(6')-Iw AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 611 UPDATE OXA-328 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 617 UPDATE OXA-147 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1276 UPDATE OXA-210 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 615 UPDATE OXA-211 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1882 UPDATE OXA-80 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1881 UPDATE OXA-72 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1281 UPDATE OXA-110 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 947 UPDATE OXA-100 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 942 UPDATE OXA-104 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1288 UPDATE OXA-82 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 685 UPDATE OXA-239 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1572 UPDATE OXA-205 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 686 UPDATE OXA-162 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1577 UPDATE AAC(6')-32 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1576 UPDATE OXA-17 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1575 UPDATE OXA-91 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1574 UPDATE Mycobacterium tuberculosis inhA mutations conferring resistance to isoniazid isoniazid; antibiotic target alteration; isoniazid resistant inhA; model_param "UPDATED 10055 with G141E UPDATED 10055 with G141E UPDATED 10056 with G3G UPDATED param_type_id with 43012 UPDATED param_type with no association with resistance TB UPDATED param_description with This parameter is part of a confidence model for AMR developed by the Relational Sequencing Tuberculosis Data platform (ReSeqTB, https://platform.reseqtb.org). The confidence model is based on the likelihood ratio test (LR+) statistic that is used to evaluate whether mutations are positively or negatively associated with phenotypic resistance. The LR+ is derived from a drug susceptibility test, testing sensitivity and specificity. Under the null hypothesis of no association, the LR value is expected to be 1, but deviations from this can be due to an association with resistance or a low number of available isolate samples. The LR+ measures the strength of association between the presence of a mutation and the drug resistance phenotype. A mutation graded as no association has no association of the mutation with phenotypic drug resistance. There is no evidence of an association between the mutation and drug resistance. LR is less than 1. These data are not visible on the CARD website, included in RGI analyses, nor available in CARD download files. " 3416 UPDATE OXA-152 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3417 UPDATE OXA-153 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3415 UPDATE OXA-151 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3412 UPDATE OXA-126 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3413 UPDATE OXA-127 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3410 UPDATE OXA-124 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3411 UPDATE OXA-125 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 497 UPDATE OXA-79 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3418 UPDATE OXA-154 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3419 UPDATE OXA-155 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1833 UPDATE OXA-374 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1831 UPDATE AAC(6')-Iid AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1836 UPDATE OXA-201 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 21 UPDATE OXA-329 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 23 UPDATE OXA-371 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 28 UPDATE OXA-45 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3792 UPDATE CrcB aminoglycoside antibiotic; antibiotic efflux; multidrug and toxic compound extrusion (MATE) transporter; efflux pump complex or subunit conferring antibiotic resistance; ARO_category "UPDATED category_aro_name with aminoglycoside antibiotic UPDATED category_aro_cvterm_id with 35935 UPDATED category_aro_accession with 0000016 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth. " 407 UPDATE OXA-352 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1370 UPDATE AAC(6')-Ib10 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 405 UPDATE OXA-202 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 404 UPDATE OXA-217 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2019 UPDATE OXA-213 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1379 UPDATE OXA-313 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 931 UPDATE OXA-316 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2016 UPDATE OXA-370 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 937 UPDATE OXA-242 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 935 UPDATE OXA-314 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 408 UPDATE OXA-380 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1343 UPDATE OXA-166 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2960 UPDATE OXA-663 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1955 UPDATE OXA-29 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1952 UPDATE OXA-1 penam; antibiotic inactivation; cephalosporin; carbapenem; piperacillin-tazobactam; cefalotin; amoxicillin; piperacillin; tazobactam; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 457 UPDATE OXA-93 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 379 UPDATE OXA-148 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1176 UPDATE Mycobacterium tuberculosis katG mutations conferring resistance to isoniazid isoniazid; isoniazid resistant katG; antibiotic target alteration; model_param "UPDATED 10001 with A312P UPDATED 10002 with N660D UPDATED 10003 with L147P UPDATED 10018 with G33V UPDATED 10012 with G125S UPDATED 10010 with N508D UPDATED 10017 with G111S UPDATED 10016 with H417Q UPDATED 10015 with E607A UPDATED 10014 with Q461P UPDATED 10001 with A312P UPDATED 10002 with N660D UPDATED 10003 with L147P UPDATED 10018 with G33V UPDATED 10012 with G125S UPDATED 10010 with N508D UPDATED 10017 with G111S UPDATED 10016 with H417Q UPDATED 10015 with E607A UPDATED 10014 with Q461P UPDATED 10019 with W91STOP UPDATED 10007 with nt1384-1:A UPDATED 10004 with C20R, S315T UPDATED 10005 with S211G, S315T UPDATED 10006 with S315T, V581G UPDATED 10008 with S315T, G466R UPDATED 10009 with G279V, L436P UPDATED 10013 with V431A, G490S UPDATED 10011 with P92S, S315T " 2909 UPDATE OXA-664 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 397 UPDATE OXA-357 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3503 UPDATE OXA-430 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 394 UPDATE OXA-130 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 795 UPDATE OXA-324 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1717 UPDATE OXA-230 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1716 UPDATE OXA-398 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1715 UPDATE OXA-73 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1659 UPDATE OXA-258 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1653 UPDATE AAC(6')-Ip AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1651 UPDATE AAC(6')-If AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1657 UPDATE AAC(6')-IIa AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1132 UPDATE OXA-88 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 243 UPDATE OXA-9 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 418 UPDATE OXA-325 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1003 UPDATE OXA-18 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1002 UPDATE AAC(6')-Ib4 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1000 UPDATE AAC(6')-Ib-Hangzhou AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 623 UPDATE OXA-68 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1226 UPDATE adeG antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; fluoroquinolone antibiotic; tetracycline; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGTCATTTTCCCGCAAACAGTTTGCACTGTCTGCCATCTTTGTCGCTATTTTAGCAACCGGTGGCAGTTTTATGTTGTTACATGAAAATGCCGATGCAAAAGCTGCACCAACCGCTGCCCAACAAGCTGCTACTGTTGATGTAGCCCCAGTAGTAAGCAAAACCATTACCGATTGGCAAGAATATTCCGGTCGTTTAGAAGCAATTGATCAAGTTGATATTCGGCCTCAAGTTTCAGGAAAACTTATTGCCGTACATTTCAAAGATGGAAGCCTCGTTAAAAAAGGTGATTTACTTTTCACAATCGACCCTCGTCCTTTTGAAGCAGAACTGAACCGTGCAAAAGCCCAACTTGCTTCAGCTGAAGCACAGGTAACATATACCGCAAGCAATCTTTCGCGTATTCAACGTCTCATTCAGAGTAATGCTGTTTCTCGCCAAGAACTGGATTTAGCCGAAAATGATGCACGTTCAGCGAATGCTAACCTACAAGCCGCTAGAGCTGCTGTCCAATCTGCACGTTTAAATCTAGAATACACCCGTATTACAGCACCTGTCAGCGGCCGGATTTCACGAGCTGAAGTCACCGTTGGTAATGTAGTTTCTGCAGGTAACGGCGCACAGGTTTTAACAAGTTTAGTGTCTGTATCCCGCCTTTATGCATCTTTCGATGTTGATGAACAAACTTACCTGAAATATATCAGTAATCAGCGTAATTCAGCACAAGTACCTGTCTATATGGGACTTGCCAATGAAACAGGCTTTACTCGTGAAGGTACAATCAACTCAATCGATAACAATCTGAATACAACCTCAGGTACGATCCGTGTTCGCGCAACTTTTGACAATCCAAACGGTGTTTTATTACCAGGCCTATATGCACGAATTCGTTTAGGTGGAGGCCAACCTCGCCCAGCGATTCTGATTAGTCCAACCGCGGTTGGTGTCGACCAAGATAAACGTTTTGTCGTAGTAGTAGATGCGAAAAATCAAACTGCTTATCGCGAAGTAAAACTCGGTGCCCAACAAGATGGCTTGCAAATCGTAAATAGCGGATTACAAGCGGGTGATCGTATTGTAGTGAATGGTTTACAACGGATTCGTCCGGGTGACCCTGTTACACCGCATCTCGTCCCTATGCCAAATTCACAAATCACTGCTAGCGCTACTCCTCCTCAACCTCAGCCAACAGATAAAACATCAACTCCGGCAAAAGGTTAA UPDATED fmax with 1221 UPDATED accession with CT025800.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Acinetobacter baumannii AYE UPDATED NCBI_taxonomy_id with 509173 UPDATED NCBI_taxonomy_cvterm_id with 35535 UPDATED accession with CAJ77857.1 UPDATED sequence with MSFSRKQFALSAIFVAILATGGSFMLLHENADAKAAPTAAQQAATVDVAPVVSKTITDWQEYSGRLEAIDQVDIRPQVSGKLIAVHFKDGSLVKKGDLLFTIDPRPFEAELNRAKAQLASAEAQVTYTASNLSRIQRLIQSNAVSRQELDLAENDARSANANLQAARAAVQSARLNLEYTRITAPVSGRISRAEVTVGNVVSAGNGAQVLTSLVSVSRLYASFDVDEQTYLKYISNQRNSAQVPVYMGLANETGFTREGTINSIDNNLNTTSGTIRVRATFDNPNGVLLPGLYARIRLGGGQPRPAILISPTAVGVDQDKRFVVVVDAKNQTAYREVKLGAQQDGLQIVNSGLQAGDRIVVNGLQRIRPGDPVTPHLVPMPNSQITASATPPQPQPTDKTSTPAKG " 620 UPDATE OXA-320 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1221 UPDATE OXA-231 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 450 UPDATE OXA-51 penam; antibiotic inactivation; carbapenem; BAL30072; cephalosporin; monobactam; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1341 UPDATE OXA-53 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 628 UPDATE catB10 antibiotic inactivation; thiamphenicol; chloramphenicol acetyltransferase (CAT); azidamfenicol; phenicol antibiotic; chloramphenicol; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGACCAACTATTTTGAAAGTCCATTTAAAGGCAAACTGCTGGCCGACCAGGTAAAGAACCCGAACATCAAAGTCGGACGGTATAGCTATTATTCCGGCTATTACCATGGCCATTCGTTTGACGAGTGCGCTCGCTTTCTCTTGCCAGATCGCAATGACATCGACCAACTGATCGTTGGTAGCTTCTGTTCCATCGGCACGGGCGCCTCCTTCATCATGGCCGGAAATCAGGGGCACCGTTATGACTGGGCGTCTTCTTTTCCCTTCTTCTACATGAAAGAGGAGCCAGCATTCTCGGGCGCACTTGATGCATTCCAAAAAGCCGGTGACACAGTCATCGGAAGTGATGTCTGGATAGGCTCTGAGGCCATGATCATGCCCGGCATCAACGTCGGTCATGGCGCTGTGATTGGAAGCCGCGCTTTGGTCACGAAAGATGTGGAGCCGTACACTATCGTTGGCGGAAATCCCGCCAAACCGATCAAGAAACGCTTCTCCGACGAGGAGATCGCCATGCTTTTGAAAATGAATTGGTGGGATTGGCCAACTGAAAAAATTGAGGAAGCAATGCCTTTGCTATGCTCATCCAACATCGTTGGGCTGCATCGATACTGGCAAGGCTTTGCCGTCTAA UPDATED fmax with 1365 UPDATED accession with FJ495083.1 UPDATED fmin with 732 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with ACL13298.1 UPDATED sequence with MTNYFESPFKGKLLADQVKNPNIKVGRYSYYSGYYHGHSFDECARFLLPDRNDIDQLIVGSFCSIGTGASFIMAGNQGHRYDWASSFPFFYMKEEPAFSGALDAFQKAGDTVIGSDVWIGSEAMIMPGINVGHGAVIGSRALVTKDVEPYTIVGGNPAKPIKKRFSDEEIAMLLKMNWWDWPTEKIEEAMPLLCSSNIVGLHRYWQGFAV " 319 UPDATE OXA-366 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1347 UPDATE OXA-425 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1874 UPDATE OXA-196 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 318 UPDATE OXA-358 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1870 UPDATE OXA-66 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1871 UPDATE OXA-389 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 977 UPDATE OXA-112 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2050 UPDATE OXA-331 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 973 UPDATE OXA-378 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 978 UPDATE OXA-134 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 656 UPDATE OXA-219 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 655 UPDATE OXA-243 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 186 UPDATE OXA-12 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 187 UPDATE OXA-348 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 185 UPDATE OXA-232 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 659 UPDATE AAC(6')-29b AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3526 UPDATE OXA-459 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3527 UPDATE OXA-460 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3524 UPDATE OXA-457 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3525 UPDATE OXA-458 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3522 UPDATE OXA-453 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3523 UPDATE OXA-455 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3520 UPDATE OXA-451 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3521 UPDATE OXA-452 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1911 UPDATE AAC(6')-Iad AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3528 UPDATE OXA-461 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3529 UPDATE OXA-464 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3449 UPDATE OXA-284 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3448 UPDATE OXA-283 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 861 UPDATE OXA-215 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 860 UPDATE TEM-42 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences "UPDATED partial with 1 UPDATED sequence with CAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATAAGTTGGGTGTACGAGTGGGTTACATCGAGCTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACCCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCAGTAAGCGTGGATCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACATGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGC UPDATED fmax with 844 UPDATED accession with X98047 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with CAA66659.1 UPDATED sequence with QHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGVRVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIK " 3447 UPDATE OXA-282 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3446 UPDATE OXA-281 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 865 UPDATE OXA-244 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3440 UPDATE OXA-273 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 867 UPDATE OXA-175 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3442 UPDATE OXA-276 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2026 UPDATE OXA-84 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2023 UPDATE OXA-132 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2117 UPDATE AAC(6')-Ib7 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1502 UPDATE OXA-209 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1618 UPDATE OXA-362 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1967 UPDATE OXA-116 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED partial with 1 UPDATED sequence with TTACTTATAACAAGCGCTATTTTTATTTCAGCCTGCTCACCTTATATAGTGTCTGCTAATCCAAATCACAGTGCTTCAAAATCTGATGACAAAGCAGAGAAAATTAAAAATTTATTTAACGAAGCACACACTACGGGTGTTTTAGTTATCCAACAAGGCCAAACTCAACAAAGCTATGGTAATGATCTTGCTCGTGCTTCGACCGAGTATGTACCTGCTTCGACCTTCAAAATGCTTAATGCTTTGATCGGCCTTGAGCACCATAAGGCAACCACTACAGAAGTATTTAAGTGGGACGGGCAAAAAAGGCTATTCCCAGAATGGGAAAAGAACATGACCCTAGGCGATGCTATGAAAGCTTCCGCTATTCCGGTTTATCAAGATTTAGCTCGTCGTATTGGACTTGAACTCATGTCTAATGAAGTGAAGCGTGTTGGTTATGGCAATGCAGATATCGGTACCCAAGTCGATAATTTTTGGCTGGTGGGTCCTTTAAAAATTACTCCTCAGCAAGAGGCACAGTTTGCTTACAAGCTAGCTAATAAAACGCTTCCATTTAGCCAAAAAGTCCAAGATGAAGTGCAATCCATGTTATTCATAGAAGAAAAGAATGGAAATAAAATATACGCAAAAAGTGGTTGGGGATGGGATGTAGACCCACAAGTGGGTTGGTTAACTGGATGGGTTGTTCAGCCTCAAGGGAATATTGTAGCGTTCTCCCTTAACTTAGAAATGAAAAAAGGAATACCTAGCTCTGTTCGAAAAGAGATTACTTATAAAAGTTTA UPDATED fmax with 786 UPDATED accession with EU220744 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Acinetobacter baumannii UPDATED NCBI_taxonomy_id with 470 UPDATED NCBI_taxonomy_cvterm_id with 35507 UPDATED accession with ABW95047.1 UPDATED sequence with LLITSAIFISACSPYIVSANPNHSASKSDDKAEKIKNLFNEAHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFKMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSNEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSL UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1610 UPDATE OXA-74 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 326 UPDATE OXA-225 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2872 UPDATE PDC-93 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCCGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1116 UPDATED accession with KR057762.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18033.1 UPDATED sequence with DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMAPQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 2871 UPDATE PDC-92 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAACTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1110 UPDATED accession with KR057761.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18032.1 UPDATED sequence with DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMAPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 2870 UPDATE PDC-91 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED partial with 1 UPDATED sequence with GATGAGGCCCCGGCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCTTGGCCGTAGCCATCAGCCTGAAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCGGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCGGTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCGGCGCTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCGGTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCGAGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAATTGTTCCCGGCACTGGGCCTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTACGGCAAGGACGACCGCCCGCTACGGGTCGGTCCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGCCTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCCTACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGCTGCAACCACACAGGATCGCCAGGCTGCCCGCGCCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGCTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCATTCCGGGCCGCGACCTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAGGCCAAGGTGCCGCTGAAGCGCTGA UPDATED fmax with 1104 UPDATED accession with KR057760.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AKR18031.1 UPDATED sequence with DEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQLFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSLQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFIPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQAKVPLKR " 2877 UPDATE OXA-535 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2876 UPDATE OXA-436 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 209 UPDATE AAC(3)-Ib/AAC(6')-Ib'' antibiotic inactivation; AAC(3); AAC(6'); kanamycin A; gentamicin C; aminoglycoside antibiotic; tobramycin; ARO_category "DELETED 35926 " 779 UPDATE OXA-350 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3356 UPDATE OXA-296 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 73 UPDATE OXA-35 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1040 UPDATE OXA-95 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1047 UPDATE catS antibiotic inactivation; thiamphenicol; chloramphenicol acetyltransferase (CAT); azidamfenicol; phenicol antibiotic; chloramphenicol; model_sequences "UPDATED partial with 1 UPDATED sequence with TTTACGAATATACCTTGCACATACAGTATGACTGTTAAATTGGATATTACACAAATAAAAAAGAAACGAATGAAATTATACCCTGCGATGCTTTATTATCTTGCAACGATTGTAAACCGTCATTCAGAGTTTAGAACGGCAATTAATCAGGAGGGTGAACTGGGAATATATGACGAGATGATACCCAGCTATACCATATTCCATGAGGACACAGAGACATTTTCCAACCTTTGGACACCATACATACCAGATTTTGAAGCATTTTCTATGGCGTATGCGAATGATATGCAAAGGTATGGAAGCAATTATGGAATGATAGGAAAACCAGATATACCAGAAAATGTTTTTAATGTATCGATGATACCATGGTCAACCTTCGATAGCTTTAATCTGAATTTGCAGAAAGGATATGATTATTTGATTCCTATTTTTACGATGGGGAAATATTACAGAGATGATGAAAAAATCATACTTCCTCTCGCCATCCAAGTT UPDATED fmax with 492 UPDATED accession with X74948 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Streptococcus pyogenes UPDATED NCBI_taxonomy_id with 1314 UPDATED NCBI_taxonomy_cvterm_id with 36764 UPDATED accession with CAA52904.1 UPDATED sequence with FTNIPCTYSMTVKLDITQIKKKRMKLYPAMLYYLATIVNRHSEFRTAINQEGELGIYDEMIPSYTIFHEDTETFSNLWTPYIPDFEAFSMAYANDMQRYGSNYGMIGKPDIPENVFNVSMIPWSTFDSFNLNLQKGYDYLIPIFTMGKYYRDDEKIILPLAIQV " 1686 UPDATE OXA-34 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1761 UPDATE OXA-351 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1764 UPDATE OXA-97 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1765 UPDATE OXA-56 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1143 UPDATE OXA-7 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1269 UPDATE OXA-192 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1141 UPDATE OXA-169 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3498 UPDATE OXA-414 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3499 UPDATE OXA-416 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3496 UPDATE OXA-412 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3497 UPDATE OXA-413 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1148 UPDATE OXA-363 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3495 UPDATE OXA-411 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3492 UPDATE OXA-407 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3493 UPDATE OXA-408 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3490 UPDATE OXA-405 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3491 UPDATE OXA-406 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3653 UPDATE SCO-1 penam; cefalotin; antibiotic inactivation; penicillin; penem; piperacillin-tazobactam; cephalosporin; cefotaxime; ceftazidime; cefepime; SCO beta-lactamase; ticarcillin; ticarcillin-clavulanic acid; amoxicillin; cefuroxime; clavulanic acid; piperacillin; tazobactam; amoxicillin-clavulanic acid; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGACAAGATCTGCCCTTTTGATTCCACTCACCACGGCGGCTATCGCGCTAAACGCAATATCGCCGGTTTATGCGAGCGACACCCATTCTATTGATGATACCGTAAAACAGGTTGAAACCACGCTGGGAGCAAAAGTGGGTATAGCCGTCCTGGACACCGGGTCTCAACGTGCCTGGTTCCACCGTGCTGATGACCGTTTCCCGATGGCGAGCACATCCAAAGCTCTGACCTGTGCAGCGCTGTTGGATAAAGGTCAGAGCTTTATGAATAAAGAGGCCTTGATCAAAAAGGCGGACCTGGATGAATATGCACCAGTGACATCCGGCATAGTCGGCAAAAAAGTAAGTGCGGCTGACCTTTGCAGCATTACCATGCGTACAAGTGACAATACCGCCGTCAACAAAGTTCTTGAAATCCTGGGAGGACCGCAAGCTGTAACCGCTTATTTGCGCAAGACAGGTGATAACATTACTCGACTTGACAGAAATGAACCGGACCTCAACGAAGGAACGCCTGGAGACGTGCGCGACACGACAACGCCTCGCGCTATTCTCGAAACACTTAATAAACTGGTACTGGGCCCCACTCTTGGCTCTGACGAGCGAAAACAACTCACAACCTGGCTTGAAAGTAATGAGGTTGGTGACCCTTTGCTGCGCGCTGGAGTTCCTTCTGATTGGCGCGTCGCCGATCGAACTGGCGCTGGAGGTAACGGGACGCGTGGGGTGATTGCCGTCATGTGGCCGCCAAAACACGCGCCAATCATTGCTGCGATTTACATTACACAGACGAAAGCCACTATGGAGGAAAGGAACGCTGCCATCGCCTCTATTGGCAAAGCGATTGCTGCCGAAGTTCTGGAATAA UPDATED fmax with 1988 UPDATED accession with EF063111.1 UPDATED fmin with 1121 UPDATED strand with + UPDATED NCBI_taxonomy_name with Acinetobacter baumannii UPDATED NCBI_taxonomy_id with 470 UPDATED NCBI_taxonomy_cvterm_id with 35507 UPDATED accession with ABL75133.1 UPDATED sequence with MTRSALLIPLTTAAIALNAISPVYASDTHSIDDTVKQVETTLGAKVGIAVLDTGSQRAWFHRADDRFPMASTSKALTCAALLDKGQSFMNKEALIKKADLDEYAPVTSGIVGKKVSAADLCSITMRTSDNTAVNKVLEILGGPQAVTAYLRKTGDNITRLDRNEPDLNEGTPGDVRDTTTPRAILETLNKLVLGPTLGSDERKQLTTWLESNEVGDPLLRAGVPSDWRVADRTGAGGNGTRGVIAVMWPPKHAPIIAAIYITQTKATMEERNAAIASIGKAIAAEVLE " 2525 UPDATE AAC(6')-34 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 693 UPDATE OXA-22 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 690 UPDATE OXA-347 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 544 UPDATE AAC(6')-Is AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3784 UPDATE mlaF oxazolidinone antibiotic; ATP-binding cassette (ABC) antibiotic efflux pump; antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; ARO_category "UPDATED category_aro_name with oxazolidinone antibiotic UPDATED category_aro_cvterm_id with 36218 UPDATED category_aro_accession with 3000079 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Oxazolidinones are a class of synthetic antibiotics discovered the the 1980's. They inhibit protein synthesis by binding to domain V of the 23S rRNA of the 50S subunit of bacterial ribosomes. Linezolid is the only member of this class currently in clinical use. " 1314 UPDATE OXA-214 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1312 UPDATE OXA-111 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 993 UPDATE AAC(6')-Ib9 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3405 UPDATE OXA-402 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3407 UPDATE OXA-103 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3406 UPDATE OXA-140 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3409 UPDATE OXA-123 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3408 UPDATE OXA-122 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1821 UPDATE AAC(6')-Ir AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 414 UPDATE OXA-377 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3445 UPDATE OXA-280 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 416 UPDATE OXA-204 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 412 UPDATE OXA-117 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 413 UPDATE OXA-144 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1384 UPDATE OXA-382 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 922 UPDATE AAC(6')-30/AAC(6')-Ib' fusion protein AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1387 UPDATE OXA-99 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 924 UPDATE AAC(6')-33 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 927 UPDATE OXA-381 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3827 UPDATE OXA-898 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3826 UPDATE OXA-899 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3825 UPDATE RanA efflux pump complex or subunit conferring antibiotic resistance; ATP-binding cassette (ABC) antibiotic efflux pump; aminoglycoside antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_name with aminoglycoside antibiotic UPDATED category_aro_cvterm_id with 35935 UPDATED category_aro_accession with 0000016 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth. " 3824 UPDATE RanB efflux pump complex or subunit conferring antibiotic resistance; ATP-binding cassette (ABC) antibiotic efflux pump; aminoglycoside antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_name with aminoglycoside antibiotic UPDATED category_aro_cvterm_id with 35935 UPDATED category_aro_accession with 0000016 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Aminoglycosides are a group of antibiotics that are mostly effective against Gram-negative bacteria. These molecules consist of aminated sugars attached to a dibasic cyclitol. Aminoglycosides work by binding to the bacterial 30S ribosomal subunit (some work by binding to the 50S subunit), inhibiting the translocation of the peptidyl-tRNA from the A-site to the P-site and also causing misreading of mRNA, leaving the bacterium unable to synthesize proteins vital to its growth. " 3823 UPDATE mef(D) efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_category "UPDATED category_aro_name with macrolide antibiotic UPDATED category_aro_cvterm_id with 35919 UPDATED category_aro_accession with 0000000 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Macrolides are a group of drugs (typically antibiotics) that have a large macrocyclic lactone ring of 12-16 carbons to which one or more deoxy sugars, usually cladinose and desosamine, may be attached. Macrolides bind to the 50S-subunit of bacterial ribosomes, inhibiting the synthesis of vital proteins. " 313 UPDATE OXA-143 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 312 UPDATE OXA-167 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3276 UPDATE Staphylococcus aureus LmrS antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim; macrolide antibiotic; chloramphenicol; kanamycin A; linezolid; diaminopyrimidine antibiotic; florfenicol; oxazolidinone antibiotic; streptomycin; aminoglycoside antibiotic; phenicol antibiotic; erythromycin; model_name "UPDATED model_name with Staphylococcus aureus LmrS " 3443 UPDATE OXA-277 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1928 UPDATE OXA-50 penam; antibiotic inactivation; carbapenem; cephalosporin; cefalotin; ampicillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3474 UPDATE OXA-340 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3475 UPDATE OXA-341 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3476 UPDATE OXA-342 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3477 UPDATE OXA-343 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3470 UPDATE OXA-308 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3471 UPDATE OXA-336 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3472 UPDATE OXA-337 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3473 UPDATE OXA-339 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3478 UPDATE OXA-344 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3479 UPDATE OXA-345 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 360 UPDATE AAC(6')-Iy AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 361 UPDATE OXA-278 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3319 UPDATE AAC(6')-Ian AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 385 UPDATE OXA-46 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3799 UPDATE LptD peptide antibiotic; ATP-binding cassette (ABC) antibiotic efflux pump; antibiotic efflux; aminocoumarin antibiotic; carbapenem; efflux pump complex or subunit conferring antibiotic resistance; rifamycin antibiotic; ARO_category "UPDATED category_aro_name with peptide antibiotic UPDATED category_aro_cvterm_id with 36192 UPDATED category_aro_accession with 3000053 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Peptide antibiotics have a wide range of antibacterial mechanisms, depending on the amino acids that make up the antibiotic, although most act to disrupt the cell membrane in some manner. Subclasses of peptide antibiotics can include additional sidechains of other types, such as lipids in the case of the lipopeptide antibiotics. UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. UPDATED category_aro_name with aminocoumarin antibiotic UPDATED category_aro_cvterm_id with 36242 UPDATED category_aro_accession with 3000103 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Aminocoumarin antibiotics bind DNA gyrase subunit B to inhibit ATP-dependent DNA supercoiling. UPDATED category_aro_name with rifamycin antibiotic UPDATED category_aro_cvterm_id with 36296 UPDATED category_aro_accession with 3000157 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Rifamycin antibiotics are a group of broad-spectrum ansamycin antibiotics that inhibit bacterial RNA polymerase by binding to a highly conserved region, blocking the oligonucleotide exit tunnel, and preventing the extension of nascent mRNAs. " 784 UPDATE AAC(6')-Iv AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1641 UPDATE OXA-203 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 782 UPDATE OXA-63 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 573 UPDATE OXA-136 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 572 UPDATE OXA-137 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3755 UPDATE qacEdelta1 antibiotic efflux; acridine dye; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; ARO_category "UPDATED category_aro_name with acridine dye UPDATED category_aro_cvterm_id with 36193 UPDATED category_aro_accession with 3000054 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Acridine dyes are cell permeable, basic molecules with an acridine chromophore. These compounds intercalate DNA. The image shown represents the core structure of the acridine family, with specific dyes containing varying substituents. " 574 UPDATE AAC(6')-Ia AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 61 UPDATE OXA-330 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 258 UPDATE OXA-208 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 63 UPDATE AAC(6')-Ib AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; plazomicin; tobramycin; ARO_category "DELETED 35953 " 67 UPDATE OXA-391 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 254 UPDATE OXA-150 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2202 UPDATE AAC(3)-Ib/AAC(6')-Ib'' antibiotic inactivation; AAC(3); AAC(6'); kanamycin A; gentamicin C; aminoglycoside antibiotic; tobramycin; ARO_category "DELETED 35926 " 1587 UPDATE OXA-10 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 730 UPDATE AAC(6')-IIc AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 732 UPDATE OXA-237 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1032 UPDATE OXA-365 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 738 UPDATE AAC(6')-Iae AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 500 UPDATE OXA-164 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1212 UPDATE OXA-141 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1359 UPDATE OXA-233 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 633 UPDATE OXA-355 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1217 UPDATE OXA-139 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1352 UPDATE OXA-251 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2422 UPDATE efrB antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; rifampin; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; ciprofloxacin; fluoroquinolone antibiotic; rifamycin antibiotic; erythromycin; model_sequences "UPDATED partial with 1 UPDATED sequence with TTAGATACGTGTCGCATATTCAGGAGGAATGCTAAATCACCAGTAAATATTGCAAAGCATGCAAAATTCATTAGGAGACTTAAATGGTTATGTTCAGAAAATATGACTGGGTTCAGTGTCTTAAAACTATATGTTCGGAAAAAGAAACCCTTGAAAGGCTTTAAACAAGTCAATCATCGTTTTAAATGGTTTGGCTTCAAAGCATCCTTTATCTCAGGATTAATGTTGCCATTGGTTCAAATGACCGCTTATGGGACCTATATCGGGGTAGCTGTCCTTGGTAGTTACTATGTGGTTGCTGGTGTGATCGTAGTGGGGCAGTTACAAGCGTTTATTCAATATATTTGGCAAATTAGCCAACCAATGGGGAATATTACGCAGTTGTCTGCAGCTTTACAAAGCGCTTCAGCTTCGACCATGCGGATTTTTGAAATCCTAGATGAACCAGAAGAAGAACTTAACGAACAAGATGTTCCTTTGCCAGAACCTATTTTAGGCTCTGTTGAATTTGAAAATGTCAGCTTTAGTTATGACCCAGAAAAACCGTTAATTCGTAATTTGAACTTTAAAGTTGATGCGGGCCAAATGGTTGCGATTGTGGGACCAACTGGCGCTGGGAAAACAACCTTAATCAACTTACTGATGCGTTTTTATGATGTAACAGAAGGCGCCATTAAAATTGATGGTATTGACACAAAAAAAATGAACCGTAGTGATGTCCGATCTGTATTTGGAATGGTATTGCAAGATGCTTGGTTGTATAAAGGTACCATTGCAGATAACATTCGTTTTGGGAAGTTGGATGCCACGGATTATGAAGTTGTCGATGCAGCGAAAACGGCCAATGTGGATCACTTCATTCGGACAATGCCAGATGGGTATGAAATGGAAATCAATTCTGAGGGAGATAACGTTTCCCTTGGTCAAAAACAATTGTTGACCATTGCCCGAGCGGTAATTTCTGATCCGAAAATTTTGATTTTAGATGAGGCGACTAGTTCAGTCGATACACGCTTGGAAGCCTTAATTCAAAAAGCAATGGATCGTGTTATGGAAGGACGAACGAGTTTCGTTATTGCCCACCGT UPDATED fmax with 1086 UPDATED accession with HG970103.1 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Enterococcus faecium UPDATED NCBI_taxonomy_id with 1352 UPDATED NCBI_taxonomy_cvterm_id with 36779 UPDATED accession with CDO61516.1 UPDATED sequence with LDTCRIFRRNAKSPVNIAKHAKFIRRLKWLCSENMTGFSVLKLYVRKKKPLKGFKQVNHRFKWFGFKASFISGLMLPLVQMTAYGTYIGVAVLGSYYVVAGVIVVGQLQAFIQYIWQISQPMGNITQLSAALQSASASTMRIFEILDEPEEELNEQDVPLPEPILGSVEFENVSFSYDPEKPLIRNLNFKVDAGQMVAIVGPTGAGKTTLINLLMRFYDVTEGAIKIDGIDTKKMNRSDVRSVFGMVLQDAWLYKGTIADNIRFGKLDATDYEVVDAAKTANVDHFIRTMPDGYEMEINSEGDNVSLGQKQLLTIARAVISDPKILILDEATSSVDTRLEALIQKAMDRVMEGRTSFVIAHR " 461 UPDATE OXA-13 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1356 UPDATE dfrA22 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGAACCGGGAATCGGTCCGCATTTATCTGGTCGCTGCCATGGGTGCCAATCGGGTTATTGGCAATGGCCCCGACATCCCCTGGACAATCCCAGGTGAGCAGAAGATTTTTCGCAGGCTCACCGAGGGCAAAGTGGTCGTGATGGGTCGTAAGACATTTGAGTCCATAGGAAAGCCCTTACCAAGCCGCCGCACAGTGGTGCTCTCCCGCCAAGCTGGTTATAGCGCTGCTGGTTGTGCAGTTGTTTCAACGCTGTCGCAGGCTATTGCCATCGCAGCCGAACACGGCAAAGAACTCTACGTAGCCGGCGGAGCCGAGGTATATGCACTGGCACTACCTCATGCCGACGGCGTCTTTCTATCTGAGGTACATCAAACCTTCGAGGGTGACGCCTTCTTCCCTGTGCTCAACGCAGCAGAATTCGAGGTTGTCTCAGCCGAAACCGTTCAAGCCACTATCACGTACACGCACTCCGTCTATGCACGTCGTAACGGCTAA UPDATED fmax with 603 UPDATED accession with KF525301.1 UPDATED fmin with 105 UPDATED strand with + UPDATED NCBI_taxonomy_name with uncultured bacterium UPDATED NCBI_taxonomy_id with 77133 UPDATED NCBI_taxonomy_cvterm_id with 36791 UPDATED accession with AGY30828.1 UPDATED sequence with MNRESVRIYLVAAMGANRVIGNGPDIPWTIPGEQKIFRRLTEGKVVVMGRKTFESIGKPLPSRRTVVLSRQAGYSAAGCAVVSTLSQAIAIAAEHGKELYVAGGAEVYALALPHADGVFLSEVHQTFEGDAFFPVLNAAEFEVVSAETVQATITYTHSVYARRNG " 1169 UPDATE OXA-360 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1860 UPDATE OXA-165 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1862 UPDATE OXA-109 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 160 UPDATE OXA-236 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 163 UPDATE OXA-376 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 964 UPDATE OXA-129 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 965 UPDATE OXA-333 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 967 UPDATE AAC(6')-Isa AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1728 UPDATE OXA-42 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 962 UPDATE OXA-356 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3438 UPDATE OXA-271 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1100 UPDATE OXA-245 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1517 UPDATE OXA-33 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED partial with 1 UPDATED sequence with GCAAATATTATCTACAGCAGCGCCAGTGCATCAACAGATATCTCTACTGTTGCATCTCCATTATTTGAAGGAACTGAAGGTTGTTTTTTACTTTACGATGTATCCACAAACGCTGAAATTGCTCAATTCAATAAAGCAAAGTGTGCAACGCAAATGGCACCAGATTCAACTTTCAAGATCGCATTATCACTTATGGCATTTGATGCGGAAATAATAGATCAGAAAACCATATTCAAATGGGATAAAACCCCCAAAGGAATGGAGATCTGGAACAGCAATCATACACCAAAGACGTGGATGCAATTTTCTGTTGTTTGGGTTTCGCAAGAAATAACCCAAAAAATTGGATTAAATAAAATCAAGAATTATCTCAAAGATTTTGATTATGGAAATCAAGACTTCTCTGGAGATAAAGAAAGAAACAACGGATTAACAGAAGCATGGCTCGAAAGTAGCTTAAAAATTTCACCAGAAGAACAAATTCAATTCCTGCGTAAAATTATTAATCACAATCTCCCAGTTAAAAACTCAGCCATAGAAAACACCATAGAGAACATGTATCTACAAGATCTGGAGAATAGTACAAAACTGTATGGGAAAACTGGTGCAGGATTCACAGCAAATAGAACCTTACAAAACGGATGGTTTGAAGGGTTTATTATAAGCAAATCAGGACATAAATATGTTTTTGTGTCCGCACTTACAGGAAACTTGGGGTCGAATTTAACATCAAGCATAAAAGCCAAGAAAAATGCGATCACCATTCTAA UPDATED fmax with 769 UPDATED accession with AY008291 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AAG23871.1 UPDATED sequence with ANIIYSSASASTDISTVASPLFEGTEGCFLLYDVSTNAEIAQFNKAKCATQMAPDSTFKIALSLMAFDAEIIDQKTIFKWDKTPKGMEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTEAWLESSLKISPEEQIQFLRKIINHNLPVKNSAIENTIENMYLQDLENSTKLYGKTGAGFTANRTLQNGWFEGFIISKSGHKYVFVSALTGNLGSNLTSSIKAKKNAITIL UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1511 UPDATE OXA-423 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 909 UPDATE OXA-5 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1151 UPDATE OXA-240 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3531 UPDATE OXA-466 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3530 UPDATE OXA-465 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3533 UPDATE OXA-471 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3532 UPDATE OXA-470 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3535 UPDATE OXA-473 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3534 UPDATE OXA-472 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3537 UPDATE OXA-475 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3536 UPDATE OXA-474 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3539 UPDATE OXA-477 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3538 UPDATE OXA-476 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1814 UPDATE AAC(6')-Ie-APH(2'')-Ia antibiotic inactivation; kanamycin A; gentamicin B; AAC(6'); aminoglycoside antibiotic; plazomicin; sisomicin; arbekacin; APH(2''); netilmicin; gentamicin C; amikacin; isepamicin; tobramycin; ARO_category "DELETED 35926 " 3439 UPDATE OXA-272 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3430 UPDATE OXA-263 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3431 UPDATE OXA-264 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3432 UPDATE OXA-265 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3433 UPDATE OXA-266 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3434 UPDATE OXA-267 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3435 UPDATE OXA-268 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3436 UPDATE OXA-269 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3437 UPDATE OXA-270 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 674 UPDATE OXA-15 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2031 UPDATE OXA-173 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 675 UPDATE OXA-25 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 676 UPDATE AAC(6')-Ih AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 677 UPDATE OXA-171 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 897 UPDATE OXA-383 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 899 UPDATE OXA-94 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1087 UPDATE OXA-253 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1530 UPDATE OXA-67 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3544 UPDATE OXA-483 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3545 UPDATE OXA-484 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3546 UPDATE OXA-485 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3547 UPDATE OXA-486 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3540 UPDATE OXA-478 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3541 UPDATE OXA-479 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3542 UPDATE OXA-480 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1978 UPDATE OXA-200 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1977 UPDATE AAC(6')-Ik AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1602 UPDATE AAC(6')-Iai AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3548 UPDATE OXA-488 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1972 UPDATE OXA-149 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 213 UPDATE OXA-21 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1780 UPDATE OXA-146 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1784 UPDATE OXA-334 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 767 UPDATE OXA-207 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1962 UPDATE OXA-47 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3328 UPDATE AAC(6')-Im antibiotic inactivation; AAC(6'); aminoglycoside antibiotic; kanamycin A; netilmicin; amikacin; dibekacin; tobramycin; ARO_description; ARO_category "UPDATED ARO_description with AAC(6')-Im is an aminoglycoside acetyltransferase encoded by plasmids in E. coli, and E. faecium. DELETED 35953 " 2323 UPDATE qacH efflux pump complex or subunit conferring antibiotic resistance; small multidrug resistance (SMR) antibiotic efflux pump; antibiotic efflux; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with qacH is a subunit of the qac multidrug efflux pump in Staphylococcus saprophyticus UPDATED partial with 0 UPDATED sequence with ATGCCATATTTATATTTGTTATTATCAATAGTCAGTGAAGTAATAGGCAGTGCATTTTTAAAATCTTCAGACGGTTTCTCAAAATTATATCCAACTATAACAACAATCATTTCATTCCTTATTTGTTTTTATTTTCTGAGTAAAACTATGCAACATTTACCACTTAATATTACTTACGCAAGTTGGGCAGGTTTAGGATTAGTATTAACAACAATTGTTTCAGTTCTTATTTTCAAAGAACAAATAAATTTAATAAGCATTATTTCAATTATTTTAATAATATTTGGTGTTGTTTTACTAAACACATTCGGATCATCACACTAA UPDATED fmax with 2185 UPDATED accession with Y16945.1 UPDATED fmin with 1861 UPDATED strand with + UPDATED NCBI_taxonomy_name with Staphylococcus saprophyticus UPDATED NCBI_taxonomy_id with 29385 UPDATED NCBI_taxonomy_cvterm_id with 40387 UPDATED accession with CAA76544.1 UPDATED sequence with MPYLYLLLSIVSEVIGSAFLKSSDGFSKLYPTITTIISFLICFYFLSKTMQHLPLNITYASWAGLGLVLTTIVSVLIFKEQINLISIISIILIIFGVVLLNTFGSSH DELETED 35920 " 1568 UPDATE OXA-183 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1777 UPDATE OXA-177 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1079 UPDATE OXA-161 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1077 UPDATE OXA-420 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1072 UPDATE OXA-37 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 289 UPDATE OXA-85 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1299 UPDATE AAC(6')-Ic AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1678 UPDATE AAC(6')-Ib-cr antibiotic inactivation; AAC(6')-Ib-cr; plazomicin; ciprofloxacin; fluoroquinolone antibiotic; aminoglycoside antibiotic; tobramycin; model_sequences; ARO_name; ARO_category "UPDATED partial with 0 UPDATED sequence with GTGACCAACAGCAACGATTCCGTCACACTGCGCCACATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGACGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA UPDATED fmax with 655 UPDATED accession with NG_052213.1 UPDATED fmin with 100 UPDATED strand with + UPDATED NCBI_taxonomy_name with Stenotrophomonas maltophilia UPDATED NCBI_taxonomy_id with 40324 UPDATED NCBI_taxonomy_cvterm_id with 37076 UPDATED accession with WP_071846215.1 UPDATED sequence with MTNSNDSVTLRHMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERTRSDA UPDATED ARO_name with AAC(6')-Ib-cr1 DELETED 35953 UPDATED category_aro_name with AAC(6')-Ib-cr UPDATED category_aro_cvterm_id with 43328 UPDATED category_aro_accession with 3005113 UPDATED category_aro_class_name with AMR Gene Family UPDATED category_aro_description with A subfamily of aminoglycoside 6'-N-acetyltransferases, AAC(6'), which doubly confer resistance to aminoglycoside and fluoroquinolone antibiotics through fluoroquinolone-acetylating activity. " 1679 UPDATE OXA-49 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1674 UPDATE AAC(6')-It AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3489 UPDATE OXA-404 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3488 UPDATE OXA-403 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1093 UPDATE AAC(6')-31 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3481 UPDATE OXA-364 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3480 UPDATE OXA-346 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3483 UPDATE OXA-373 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3482 UPDATE OXA-372 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3485 UPDATE OXA-392 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1099 UPDATE OXA-48 antibiotic inactivation; penam; carbapenem; cephalosporin; temocillin; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3487 UPDATE OXA-401 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3486 UPDATE OXA-400 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 267 UPDATE OXA-43 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 30 UPDATE OXA-226 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1555 UPDATE SHV-140 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences "UPDATED partial with 1 UPDATED sequence with AAGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCCCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATAGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGGATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 861 UPDATED accession with JN051143 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with AEK80394.1 UPDATED sequence with KRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYSQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR " 1551 UPDATE OXA-78 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 59 UPDATE OXA-256 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2191 UPDATE AAC(6')-Iaj AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 55 UPDATE OXA-69 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2396 UPDATE OXA-368 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1419 UPDATE OXA-454 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1410 UPDATE OXA-19 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1411 UPDATE OXA-62 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1413 UPDATE OXA-172 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1416 UPDATE OXA-89 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1417 UPDATE OXA-131 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1326 UPDATE OXA-170 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1327 UPDATE AAC(6')-Iq AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1325 UPDATE OXA-65 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 981 UPDATE OXA-86 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 110 UPDATE AAC(6')-Iu AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1858 UPDATE OXA-387 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 537 UPDATE OXA-120 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1853 UPDATE OXA-20 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1526 UPDATE AAC(6')-Iaa AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1255 UPDATE OXA-119 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1399 UPDATE OXA-315 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1398 UPDATE OXA-108 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1396 UPDATE OXA-11 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2071 UPDATE AAC(6')-Ib8 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 916 UPDATE OXA-36 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1258 UPDATE OXA-55 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 646 UPDATE OXA-349 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3543 UPDATE OXA-482 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 300 UPDATE AAC(6')-29a AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3519 UPDATE OXA-450 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3518 UPDATE OXA-449 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1937 UPDATE OXA-118 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3456 UPDATE OXA-293 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1939 UPDATE AAC(6')-Ix AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3467 UPDATE OXA-305 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3466 UPDATE OXA-304 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3465 UPDATE OXA-303 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3464 UPDATE OXA-302 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3463 UPDATE OXA-301 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3462 UPDATE OXA-300 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3461 UPDATE OXA-299 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3460 UPDATE OXA-298 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3500 UPDATE OXA-417 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3501 UPDATE OXA-427 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3502 UPDATE OXA-429 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3455 UPDATE OXA-292 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3504 UPDATE OXA-431 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3505 UPDATE OXA-432 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 849 UPDATE OXA-138 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3468 UPDATE OXA-306 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3458 UPDATE OXA-295 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3510 UPDATE OXA-440 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1986 UPDATE OXA-309 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1980 UPDATE OXA-247 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1730 UPDATE OXA-235 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1733 UPDATE OXA-415 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 569 UPDATE OXA-228 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 560 UPDATE OXA-77 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 758 UPDATE OXA-198 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 566 UPDATE OXA-32 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1596 UPDATE OXA-24 penam; antibiotic inactivation; carbapenem; BAL30072; cephalosporin; monobactam; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3506 UPDATE OXA-433 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 226 UPDATE OXA-113 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1598 UPDATE OXA-101 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1024 UPDATE AAC(6')-Ib-SK AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1020 UPDATE OXA-241 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1186 UPDATE OXA-327 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1187 UPDATE OXA-248 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1184 UPDATE OXA-182 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1185 UPDATE OXA-176 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1845 UPDATE OXA-312 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 724 UPDATE AAC(6')-Ij AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 721 UPDATE OXA-28 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1741 UPDATE OXA-359 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1743 UPDATE OXA-338 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 605 UPDATE OXA-96 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 604 UPDATE OXA-385 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 153 UPDATE adeF antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; fluoroquinolone antibiotic; tetracycline; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGAATATTTCTAAATTTTTTATTGATCGGCCGATCTTTGCTGGTGTGCTATCAGTCTTGATTTTACTCGCCGGTCTCCTTTCGGTATTTCAGTTACCGATTTCTGAATATCCCGAGGTTGTTCCACCATCTGTGGTGGTACGCGCCCAATATCCGGGTGCAAACCCAAAAGTGATTGCTGAAACGGTTGCATCTCCGCTCGAAGAGTCAATCAACGGCGTCGAAGACATGCTGTATATGCAATCTCAAGCAAACAGCGACGGTAACCTAACCATTACGGTGAACTTTAAGCTCGGTATCGACCCAGACAAAGCCCAACAATTGGTTCAAAACCGTGTGTCTCAGGCCATGCCCCGTTTACCTGAAGATGTACAGCGCTTAGGTGTAACCACACTAAAAAGCTCACCTACTTTAACTATGGTAGTGCATCTGACCTCACCAGATAATCGCTATGACATGACCTACTTACGTAACTATGCGGTGCTCAACGTGAAAGACCGTTTAGCGCGTTTACAAGGGGTTGGTGAAGTCGGATTATTTGGTTCTGGTGACTACGCGATGCGTGTATGGCTTGACCCGCAAAAAGTAGCGCAGCGTAACCTCACCGCGACCGAAATTGTGAATGCAATCCGTGAACAAAATATTCAGGTTGCAGCGGGTACAATCGGTGCATCACCAAGTAATTCACCTTTACAGCTTTCAGTCAATGCTCAAGGTCGTTTAACTACTGAACAAGAATTCGCAGATATCATTTTAAAAACTGCACCAGATGGCGCGGTTACCCGATTGGGTGATGTTGCTCGTGTCGAACTTGCAGCCTCTCAATATGGCTTACGTTCATTGCTTGATAATAAACAAGCGGTCGCGATTCCAATTTTCCAAGCACCGGGTGCGAATGCTTTACAAGTTTCCGATCAAGTGCGTAGCACAATGAAGGAGCTTTCAAAAGATTTCCCATCTTCAATTAAATACGACATTGTTTATGACCCGACTCAATTCGTACGTGCAAGTATTAAAGCGGTCGTTCATACCTTACTTGAAGCAATTACACTGGTTGTTGTGGTCGTTATTTTATTCTTGCAAACATGGCGTGCCTCAATCATTCCATTGCTTGCCGTACCGGTTTCAATTATTGGTACATTCGCGCTCATGCTCGCTTTTGGTTACTCAATCAATGCGCTATCACTGTTCGGAATGGTACTTGCCATCGGGATTGTCGTCGATGACGCGATTGTGGTCGTCGAAAATGTCGAGAGGAATATTGAAGCAGGCTTAAACCCAAGGGAGGCGACTTACCGTGCCATGCGAGAAGTCAGTGGACCGATTATTGCCATTGCTTTAACACTTGTTGCAGTATTCGTACCTCTTGCCTTTATGACAGGCTTAACAGGGCAATTCTATAAACAATTTGCCATGACCATTGCCATTTCAACGGTTATTTCGGCATTTAACTCGCTTACCCTATCTCCTGCTTTGGCAGCGCTGTTACTGAAAGGACATGATGCTAAACCGGATGCCTTAACACGTATTATGAATCGTGTATTCGGTCGTTTCTTTGCACTGTTTAACCGTGTGTTTTCACGTGCTTCAGACCGTTATAGTCAAGGCGTCAGCCGTGTCATTTCCCATAAAGCTTCGGCAATGGGTGTCTATGCAGCACTCTTAGGTTTAACCGTTGGTATTTCCTATATTGTTCCAGGTGGTTTCGTTCCTGCGCAGGACAAACAATATTTAATTAGCTTTGCGCAGCTACCAAACGGCGCATCATTAGATCGTACCGAAGCGGTCATTCGTAAAATGAGTGACACTGCACTTAAACAACCTGGTGTAGAAAGTGCAGTTGCCTTTCCTGGCCTATCAATTAACGGTTTCACCAATAGCTCAAGTGCCGGTATTGTCTTTGTGACTTTAAAGCCATTTGATGAACGTAAGGCAAAAGACTTATCTGCAAATGCAATTGCAGGTGCGCTCAACCAGAAATATTCAGCTATTCAAGATGCCTATATCGCGGTTTTCCCACCGCCACCAGTGATGGGCTTAGGTACTATGGGCGGCTTTAAACTACAACTTGAAGACCGAGGTGCCTTAGGCTATTCAGCCTTGAACGATGCTGCACAAAACTTTATGAAGGCAGCACAATCAGCCCCTGAACTGGGTCCAATGTTCTCAAGTTATCAAATTAACGTACCTCAACTCAACGTAGATCTGGACCGTGTAAAAGCTAAACAGCAAGGCGTTGCTGTGACAGATGTTTTCAATACTATGCAGATTTATTTAGGTTCTCAGTACGTTAACGACTTTAACCGCTTTGGACGTGTTTATCAGGTTCGTGCACAAGCCGATGCGCCTTTCCGTGCTAACCCTGAAGATATTTTGCAGCTTAAAACCCGTAATAGTGCCGGACAAATGGTGCCATTATCTTCATTGGTGAATGTAACTCAAACCTATGGTCCTGAAATGGTCGTTCGTTATAACGGTTACACATCAGCAGATATTAACGGTGGCCCTGCCCCAGGTTATTCATCTAGCCAAGCAGAAGCTGCGGTTGAACGTATTGCTGCACAAACTCTACCGCGTGGTATCAAGTTTGAATGGACAGATTTAACTTATCAAAAAATCTTGGCTGGTAATGCTGGACTTTGGGTATTCCCTATTAGCGTATTACTCGTGTTCTTAGTGTTAGCTGCTCAGTATGAAAGCTTAACCCTACCATTAGCAGTTATCTTAATTGTACCAATGGGAATCTTAGCGGCTCTGACAGGTGTCTGGTTGACAGCTGGAGATAACAACATCTTTACTCAAATCGGTCTAATGGTACTGGTCGGGCTAGCCTGTAAAAATGCCATCTTAATTGTCGAATTTGCGAGGGAACTTGAAATGCAAGGTGCGACTGCCTTTAAAGCAGCCGTTGAAGCAAGTCGTCTACGTTTACGCCCAATTTTAATGACCTCTATTGCATTTATTATGGGTGTAGTGCCACTGGTTACTTCAACTGGCGCAGGTTCTGAAATGCGACATGCGATGGGTGTTGCCGTATTCTTCGGTATGATCGGTGTAACATTCTTTGGTTTATTCCTCACCCCGGCCTTTTACGTTCTGATTCGTACCCTCAACAGCAAACATAAACTGCATTCTGCGGCAGTTCATGAAGCGCCGTTAGCTAGCCCACATGATCATTAA UPDATED fmax with 3180 UPDATED accession with CT025801.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Acinetobacter baumannii AYE UPDATED NCBI_taxonomy_id with 509173 UPDATED NCBI_taxonomy_cvterm_id with 35535 UPDATED accession with CAJ77856.1 UPDATED sequence with MNISKFFIDRPIFAGVLSVLILLAGLLSVFQLPISEYPEVVPPSVVVRAQYPGANPKVIAETVASPLEESINGVEDMLYMQSQANSDGNLTITVNFKLGIDPDKAQQLVQNRVSQAMPRLPEDVQRLGVTTLKSSPTLTMVVHLTSPDNRYDMTYLRNYAVLNVKDRLARLQGVGEVGLFGSGDYAMRVWLDPQKVAQRNLTATEIVNAIREQNIQVAAGTIGASPSNSPLQLSVNAQGRLTTEQEFADIILKTAPDGAVTRLGDVARVELAASQYGLRSLLDNKQAVAIPIFQAPGANALQVSDQVRSTMKELSKDFPSSIKYDIVYDPTQFVRASIKAVVHTLLEAITLVVVVVILFLQTWRASIIPLLAVPVSIIGTFALMLAFGYSINALSLFGMVLAIGIVVDDAIVVVENVERNIEAGLNPREATYRAMREVSGPIIAIALTLVAVFVPLAFMTGLTGQFYKQFAMTIAISTVISAFNSLTLSPALAALLLKGHDAKPDALTRIMNRVFGRFFALFNRVFSRASDRYSQGVSRVISHKASAMGVYAALLGLTVGISYIVPGGFVPAQDKQYLISFAQLPNGASLDRTEAVIRKMSDTALKQPGVESAVAFPGLSINGFTNSSSAGIVFVTLKPFDERKAKDLSANAIAGALNQKYSAIQDAYIAVFPPPPVMGLGTMGGFKLQLEDRGALGYSALNDAAQNFMKAAQSAPELGPMFSSYQINVPQLNVDLDRVKAKQQGVAVTDVFNTMQIYLGSQYVNDFNRFGRVYQVRAQADAPFRANPEDILQLKTRNSAGQMVPLSSLVNVTQTYGPEMVVRYNGYTSADINGGPAPGYSSSQAEAAVERIAAQTLPRGIKFEWTDLTYQKILAGNAGLWVFPISVLLVFLVLAAQYESLTLPLAVILIVPMGILAALTGVWLTAGDNNIFTQIGLMVLVGLACKNAILIVEFARELEMQGATAFKAAVEASRLRLRPILMTSIAFIMGVVPLVTSTGAGSEMRHAMGVAVFFGMIGVTFFGLFLTPAFYVLIRTLNSKHKLHSAAVHEAPLASPHDH " 156 UPDATE AAC(6')-Iaf AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 608 UPDATE OXA-361 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1203 UPDATE Mycobacterium tuberculosis ndh with mutation conferring resistance to isoniazid isoniazid; antibiotic target alteration; antibiotic resistant ndh; model_param "UPDATED 10057 with G339A UPDATED 10057 with G339A UPDATED 10058 with nt969+1:G UPDATED param_type_id with 41345 UPDATED param_type with insertion mutation from nucleotide sequence UPDATED param_description with A subtype of the insertion mutation detection model parameter. This parameter is used when a set of insertion mutations is reported in a nucleotide sequence format. Such mutations may be of variable length - possibly causing a frameshift, but not causing premature termination or a functional knockout. Mutation parameters of this type are reported in CARD with the notation: [+]nt[position]:[nucleotides]. " 1898 UPDATE OXA-379 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1891 UPDATE AAC(6')-Iih AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1892 UPDATE OXA-114a carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 635 UPDATE OXA-332 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 959 UPDATE OXA-64 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 958 UPDATE OXA-418 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 48 UPDATE OXA-90 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 47 UPDATE OXA-60 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3444 UPDATE OXA-279 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1111 UPDATE AAC(6')-Ig AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 1112 UPDATE OXA-58 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1115 UPDATE OXA-435 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1293 UPDATE OXA-197 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1562 UPDATE aad(6) antibiotic inactivation; streptomycin; aminoglycoside antibiotic; ANT(6); model_sequences "UPDATED partial with 1 UPDATED sequence with GAGGGGTCACGCGCAAATATTAATATACCTAAAGATGAATTTCAGGATTATGATATTACATATTTTGTAAGTGATATAGAACCGTTTATATCTAATGATGACTGGCTTAATCAATTTGGGAATATAATAATGATGCAAAAGCCGGAGGATATGGAATTATTCCCACCTGAAGAAAAGGGATTTTCCTATCTTATGCTATTTGATGATTACAATAAAATTGATCTTACCTTATTGCCCTTGGAAGAGTTAGATAATTACCTAAAGGGCGATAAATTAATAAAGGTTCTAATTGATAAAGATTGTAGAATTAAAAGGGACATAGTTCCGACTGATATAGATTATCATGTAAGAAAGCCAAGCGCAAGGGAGTATGATGATTGCTGCAATGAATTTTGGAATGTAACACCTTATGTTATTAAAGGATTGTGCCGTAAGGAAATTTTATTTGCTATTGATCATTTTAATCAGATTGTTCGCCATGAGCTGCTGAGAATGATATCATGGAAGGTCGGCATCGAAACAGGCTTTAAATTAAGTGTAGGCAAGAACTATAAGTTTATTGAAAGGTATATATCCGAGGATTTGTGGGAGAAACTTTTGTCCACCTACCGGATGGATTCCTATGAAAACATATGGGAAGCATTATTTCTATGCCATCAATTGTTCAGGGCGGTATCCGGTGAGGTGGCGGAAAGGCTTCATTATGCCTATCCGGAGTATGATAGGAATATAACAAAATATACCAGGGACATGTATAAAAAATACACTGGTAAAACCGGCTGCCTGGATAGCACATATGCCGCTGATATAGAAGAGAGGCGGGAACAGTGA UPDATED fmax with 831 UPDATED accession with AY712687 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Streptococcus oralis UPDATED NCBI_taxonomy_id with 1303 UPDATED NCBI_taxonomy_cvterm_id with 39527 UPDATED accession with AAU10334.1 UPDATED sequence with EGSRANINIPKDEFQDYDITYFVSDIEPFISNDDWLNQFGNIIMMQKPEDMELFPPEEKGFSYLMLFDDYNKIDLTLLPLEELDNYLKGDKLIKVLIDKDCRIKRDIVPTDIDYHVRKPSAREYDDCCNEFWNVTPYVIKGLCRKEILFAIDHFNQIVRHELLRMISWKVGIETGFKLSVGKNYKFIERYISEDLWEKLLSTYRMDSYENIWEALFLCHQLFRAVSGEVAERLHYAYPEYDRNITKYTRDMYKKYTGKTGCLDSTYAADIEERREQ " 1296 UPDATE OKP-B-12 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; model_sequences "UPDATED partial with 1 UPDATED sequence with ACCGCCCTGCCACTGGCGGTATTCGCCAGCCCTCAGCCGCTTGAGCAGATTAAAATCAGCGAAGGTCAGCTGGCGGGCCGGGTGGGCTATGTTGAAATGGATCTGGCCAGCGGCCGCATGCTGGCCGCCTGGCGCGCCAGTGAGCGCTTTCCGCTGATGAGCACCTTTAAAGTGCTGCTCTGCGGCGCTGTGCTGGCCCGGGTGGATGCCGGCGACGAACAGCTGGATCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCGGTCAGCGAAAAACACCTTGCCGACGGGATGACCGTTGGCGAACTCTGCGCCGCCGCCATCACCATGAGCGATAACAGCGCCGGCAATCTGCTGTTGAAGAGCGTCGGCGGCCCCGCGGGATTGACCACTTTTCTGCGCCAGATCGGTGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTCAATGAGGCGCTTCCCGGCGACGTGCGCGACACCACCACCCCGGCCAGCATGGCCACCACCCTGCGCAAGTTGCTAACCACCCCCTCTCTGAGCGCCCGTTCGCAGCAGCAGCTGCTGCAGTGGATGGTGGACGACCAGGTGGCCGGCCCGTTGATCCGCGCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAAACCGGGGCCGGTGAGCGGGGCTCACGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAAGCGGAGCGTATCGTGGTGATCTATCTGCGGGATACCGCTGCGACCATGGCCGAACGTAACCAGCAGATCGCCGGG UPDATED fmax with 789 UPDATED accession with AJ635420 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAG25831.1 UPDATED sequence with TALPLAVFASPQPLEQIKISEGQLAGRVGYVEMDLASGRMLAAWRASERFPLMSTFKVLLCGAVLARVDAGDEQLDRRIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAGNLLLKSVGGPAGLTTFLRQIGDNVTRLDRWETELNEALPGDVRDTTTPASMATTLRKLLTTPSLSARSQQQLLQWMVDDQVAGPLIRAVLPAGWFIADKTGAGERGSRGIVALLGPDGKAERIVVIYLRDTAATMAERNQQIAG " 1449 UPDATE OXA-59 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1361 UPDATE OXA-223 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1807 UPDATE OXA-70 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1806 UPDATE OXA-14 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3429 UPDATE OXA-262 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1804 UPDATE OXA-107 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1802 UPDATE OXA-168 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 1801 UPDATE AAC(6')-Ib11 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_category "DELETED 35953 " 3785 UPDATE mlaD oxazolidinone antibiotic; ATP-binding cassette (ABC) antibiotic efflux pump; antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; ARO_category "UPDATED category_aro_name with oxazolidinone antibiotic UPDATED category_aro_cvterm_id with 36218 UPDATED category_aro_accession with 3000079 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Oxazolidinones are a class of synthetic antibiotics discovered the the 1980's. They inhibit protein synthesis by binding to domain V of the 23S rRNA of the 50S subunit of bacterial ribosomes. Linezolid is the only member of this class currently in clinical use. " 3423 UPDATE OXA-185 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3422 UPDATE OXA-158 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3421 UPDATE OXA-157 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3420 UPDATE OXA-156 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3427 UPDATE OXA-260 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3426 UPDATE OXA-259 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3425 UPDATE OXA-252 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3424 UPDATE OXA-234 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 470 UPDATE OXA-4 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2001 UPDATE OXA-250 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 2007 UPDATE OXA-335 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 475 UPDATE OXA-106 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_name with carbapenem UPDATED category_aro_cvterm_id with 35939 UPDATED category_aro_accession with 0000020 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Carbapenems are a class of beta-lactam antibiotics with a broad spectrum of antibacterial activity, and have a structure which renders them highly resistant to beta-lactamases. Carbapenem antibiotics are bactericidal, and act by inhibiting the synthesis of the peptidoglycan layer of bacterial cell walls. The peptidoglycan layer is important for cell wall structural integrity, especially in Gram-positive organisms. " 3920 ADD CMY-96 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3856 ADD OXA-846 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; N/A N/A 3857 ADD NDM-29 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; N/A N/A 3854 ADD PDC-47 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3855 ADD PDC-51 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3852 ADD PDC-66 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3853 ADD PDC-14 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3850 ADD PDC-63 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3851 ADD PDC-57 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3858 ADD PDC-11 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3859 ADD PDC-62 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3834 ADD Mycobacterium tuberculosis katG mutations conferring resistance to prothionamide antibiotic target alteration; prothionamide resistant katG; prothionamide; N/A N/A 3836 ADD Mycobacterium tuberculosis ethA mutations conferring resistance to isoniazid isoniazid; antibiotic target alteration; isoniazid resistant ethA; N/A N/A 3837 ADD Mycobacterium tuberculosis ethA mutations conferring resistance to prothionamide antibiotic target alteration; prothionamide; prothionamide resistant ethA; N/A N/A 3830 ADD qacL efflux pump complex or subunit conferring antibiotic resistance; small multidrug resistance (SMR) antibiotic efflux pump; antibiotic efflux; N/A N/A 3831 ADD 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(A) antibiotic target alteration; streptogramin antibiotic; Erm 23S ribosomal RNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; N/A N/A 3832 ADD FosB2 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; N/A N/A 3838 ADD Mycobacterium tuberculosis mshA mutations conferring resistance to prothionamide antibiotic target alteration; prothionamide; prothionamide resistant mshA; N/A N/A 3839 ADD blaS1 penam; antibiotic inactivation; mezlocillin; cefixime; blaS; cephalosporin; cephamycin; oxacillin; carbenicillin; ampicillin; piperacillin; ceftriaxone; cefoxitin; N/A N/A 3841 ADD AAC(6')-Ib-cr4 antibiotic inactivation; fluoroquinolone antibiotic; aminoglycoside antibiotic; AAC(6')-Ib-cr; N/A N/A 3840 ADD AAC(6')-Ib-cr3 antibiotic inactivation; fluoroquinolone antibiotic; aminoglycoside antibiotic; AAC(6')-Ib-cr; N/A N/A 3843 ADD AAC(6')-Ib-cr6 antibiotic inactivation; fluoroquinolone antibiotic; aminoglycoside antibiotic; AAC(6')-Ib-cr; N/A N/A 3842 ADD AAC(6')-Ib-cr5 antibiotic inactivation; fluoroquinolone antibiotic; aminoglycoside antibiotic; AAC(6')-Ib-cr; N/A N/A 3845 ADD AAC(6')-Ib-cr8 antibiotic inactivation; fluoroquinolone antibiotic; aminoglycoside antibiotic; AAC(6')-Ib-cr; N/A N/A 3844 ADD AAC(6')-Ib-cr7 antibiotic inactivation; fluoroquinolone antibiotic; aminoglycoside antibiotic; AAC(6')-Ib-cr; N/A N/A 3847 ADD lsa(D) pleuromutilin antibiotic; macrolide antibiotic; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; phenicol antibiotic; lincosamide antibiotic; N/A N/A 3846 ADD AAC(6')-Ib-cr9 antibiotic inactivation; fluoroquinolone antibiotic; aminoglycoside antibiotic; AAC(6')-Ib-cr; N/A N/A 3849 ADD PDC-70 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3848 ADD PDC-68 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3829 ADD mecC-type BlaZ penam; antibiotic inactivation; blaZ beta-lactamase; penicillin; N/A N/A 3869 ADD PDC-240 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3868 ADD PDC-44 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3898 ADD CMY-156 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3899 ADD CMY-160 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3892 ADD CMY-107 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3893 ADD CMY-158 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3890 ADD CMY-134 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3891 ADD CMY-143 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3896 ADD CMY-147 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3897 ADD CMY-146 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3894 ADD CMY-173 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3878 ADD PDC-69 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3879 ADD APH(3')-XV antibiotic inactivation; APH(3'); aminoglycoside antibiotic; G418; neomycin; N/A N/A 3870 ADD PDC-61 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3871 ADD PDC-45 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3872 ADD PDC-49 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3873 ADD PDC-50 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3874 ADD PDC-48 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3875 ADD PAC-1 antibiotic inactivation; cephalosporin; PAC beta-lactamase; N/A N/A 3876 ADD PDC-53 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3877 ADD PDC-72 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3727 ADD Mycobacterium tuberculosis mshA mutations conferring resistance to isoniazid isoniazid; antibiotic target alteration; isoniazid resistant mshA; N/A N/A 3885 ADD OXA-812 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; N/A N/A 3884 ADD OXA-818 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; N/A N/A 3887 ADD dfrA35 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; N/A N/A 3886 ADD FosA7.5 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; N/A N/A 3881 ADD PDC-28 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3880 ADD PDC-23 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3883 ADD OXA-668 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; N/A N/A 3882 ADD PDC-41 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3888 ADD Tet(X1) tetracycline antibiotic; antibiotic inactivation; tetracycline inactivation enzyme; N/A N/A 3904 ADD CMY-165 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3905 ADD CMY-166 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3906 ADD CMY-149 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3907 ADD CMY-139 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3900 ADD CMY-162 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3901 ADD CMY-140 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3902 ADD CMY-164 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3903 ADD CMY-161 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3863 ADD PDC-59 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3862 ADD OXA-906 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; N/A N/A 3861 ADD PDC-54 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3860 ADD PDC-43 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3908 ADD CMY-148 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3909 ADD CMY-163 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3865 ADD PDC-67 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3864 ADD OXA-850 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; N/A N/A 3917 ADD CMY-157 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3916 ADD CMY-122 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3915 ADD CMY-145 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3914 ADD CMY-125 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3913 ADD CMY-124 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3912 ADD CMY-141 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3911 ADD CMY-142 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3910 ADD CMY-154 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3919 ADD CMY-155 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3918 ADD CMY-171 antibiotic inactivation; CMY beta-lactamase; cephamycin; N/A N/A 3867 ADD PDC-52 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A 3866 ADD PDC-56 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; N/A N/A