{"$update": {"5259": {"$insert": {"CARD_short_name": "PDC-123"}}, "4446": {"$insert": {"CARD_short_name": "CfiA11"}}, "4447": {"$insert": {"CARD_short_name": "CfiA14"}}, "1020": {"$update": {"ARO_description": "OXA-241 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1759": {"$update": {"dna_sequence": {"$update": {"accession": "JX025021.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-241"}}, "4026": {"$update": {"ARO_description": "PDC-461 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-461"}}, "4027": {"$update": {"ARO_description": "PDC-19a is a class C beta-lactamase found in Pseudomonas (multispecies)."}, "$insert": {"CARD_short_name": "PDC-19a"}}, "4024": {"$update": {"ARO_description": "PDC-19b is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-19b"}}, "4025": {"$update": {"ARO_description": "PDC-380 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-380"}}, "4022": {"$update": {"ARO_description": "PDC-352 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-352"}}, "4023": {"$update": {"ARO_description": "PDC-464 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-464"}}, "4020": {"$update": {"ARO_description": "PDC-337 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-337"}}, "4021": {"$update": {"ARO_description": "PDC-212 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-212"}}, "854": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1362": {"$update": {"dna_sequence": {"$update": {"accession": "HQ185697.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-58"}}, "4028": {"$update": {"ARO_description": "PDC-272 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-272"}}, "4029": {"$update": {"ARO_description": "PDC-255 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-255"}}, "5080": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-771"}}, "344": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"989": {"$update": {"dna_sequence": {"$update": {"accession": "LN515534.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-188"}}, "345": {"$update": {"ARO_description": "bcrA is an ABC transporter found in Bacillus licheniformis that confers bacitracin resistance.", "model_sequences": {"$update": {"sequence": {"$update": {"745": {"$update": {"dna_sequence": {"$update": {"accession": "L20573.1"}}}}}}}}}, "$insert": {"CARD_short_name": "bcrA"}}, "346": {"$update": {"ARO_description": "QnrB23 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"$update": {"720": {"$update": {"dna_sequence": {"$update": {"accession": "FJ981622.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB23"}}, "347": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1878": {"$update": {"dna_sequence": {"$update": {"accession": "AF197943.1"}}}}}}}}}, "$insert": {"CARD_short_name": "SFH-1"}}, "340": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"904": {"$update": {"dna_sequence": {"$update": {"accession": "JQ733571.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-51"}}, "341": {"$update": {"ARO_description": "IMP-1 is a beta-lactamase found in Serratia marcescens.", "model_sequences": {"$update": {"sequence": {"$update": {"1594": {"$update": {"dna_sequence": {"$update": {"accession": "AJ223604.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-1"}}, "342": {"$update": {"ARO_description": "smeS is the protein kinase sensor component of a two component signal transduction system that includes smeR.", "model_sequences": {"$update": {"sequence": {"$update": {"4492": {"$update": {"dna_sequence": {"$update": {"accession": "AF173226.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "smeS"}}, "343": {"$update": {"ARO_description": "OXA-31 is a beta-lactamase found in P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1211": {"$update": {"dna_sequence": {"$update": {"accession": "AF294653.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-31"}}, "3997": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-234"}}, "3996": {"$update": {"ARO_description": "TEM-233 is a beta-lactamase.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-233"}}, "3995": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-232"}}, "3994": {"$update": {"ARO_description": "TEM-231 is a beta-lactamase.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-231"}}, "348": {"$update": {"ARO_description": "OXY-3-1 is a beta-lactamase found in Klebsiella oxytoca.", "model_sequences": {"$update": {"sequence": {"$update": {"1848": {"$update": {"dna_sequence": {"$update": {"accession": "AF491278.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXY-3-1"}}, "349": {"$update": {"ARO_description": "VanL is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Ser, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity in Enterococcus faecalis.", "model_sequences": {"$update": {"sequence": {"$update": {"612": {"$update": {"dna_sequence": {"$update": {"accession": "EU250284.1"}}}}}}}}, "ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "vanL"}}, "3991": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-228"}}, "3990": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-227"}}, "4686": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-59"}}, "4687": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-60"}}, "966": {"$update": {"ARO_description": "Also known as vanSC, is a vanS variant found in the vanC gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"565": {"$update": {"dna_sequence": {"$update": {"accession": "AF162694.1"}}}}}}}}, "model_name": "vanS gene in vanC cluster", "ARO_name": "vanS gene in vanC cluster"}, "$insert": {"CARD_short_name": "vanS_in_vanC_cl"}}, "967": {"$update": {"ARO_description": "AAC(6')-Isa is a plasmid-encoded aminoglycoside acetyltransferase in Streptomyces albulus.", "model_sequences": {"$update": {"sequence": {"$update": {"705": {"$update": {"dna_sequence": {"$update": {"accession": "AB116646.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Isa"}}, "5373": {"$insert": {"CARD_short_name": "PDC-235"}}, "1653": {"$update": {"ARO_description": "AAC(6')-Ip is an aminoglycoside acetyltransferase encoded by plasmids and integrons in C. freundii, E. coli, E. faecium and Klebsiella aerogenes."}, "$insert": {"CARD_short_name": "AAC(6')-Ip"}}, "4934": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-608"}}, "4683": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-53"}}, "4732": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-73"}}, "4733": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-74"}}, "4730": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-71"}}, "4731": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-72"}}, "4736": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-77"}}, "4737": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-78"}}, "4734": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-75"}}, "4735": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-76"}}, "2317": {"$update": {"ARO_description": "mgrB is a small transmembrane protein produced in the PhoPQ signalling system. It acts as a negative regulator in this system. Inactivation or down-regulation of mgrB confers colistin resistance by absence as shown in Klebsiella pneumoniae.", "ARO_category": {"$update": {"40429": {"$update": {"category_aro_description": "Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin)."}}}}}, "$insert": {"CARD_short_name": "mgrB"}}, "2314": {"$insert": {"CARD_short_name": "Abau_gyrA_FLO"}}, "2315": {"$update": {"model_name": "Acinetobacter baumannii parC conferring resistance to fluoroquinolones"}, "$insert": {"CARD_short_name": "Abau_parC_FLO"}}, "3572": {"$insert": {"CARD_short_name": "CIA-3"}}, "2310": {"$insert": {"CARD_short_name": "Scin_EFTu_ELF"}}, "4831": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-493"}}, "298": {"$update": {"ARO_description": "Also known as vanYG, is a vanY variant found in the vanG gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"416": {"$update": {"dna_sequence": {"$update": {"accession": "DQ212986.1"}}}}}}}}, "model_name": "vanY gene in vanG cluster", "ARO_name": "vanY gene in vanG cluster"}, "$insert": {"CARD_short_name": "vanY_in_vanG_cl"}}, "299": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3286": {"$update": {"dna_sequence": {"$update": {"accession": "X80277.1"}}}}}}}}, "model_name": "CepS"}, "$insert": {"CARD_short_name": "CepS"}}, "296": {"$update": {"ARO_description": "VIM-23 is a beta-lactamase found in Enterobacter cloacae.", "model_sequences": {"$update": {"sequence": {"$update": {"1729": {"$update": {"dna_sequence": {"$update": {"accession": "GQ242167.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-23"}}, "297": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1778": {"$update": {"dna_sequence": {"$update": {"accession": "KC603538.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-98"}}, "294": {"$update": {"ARO_description": "cfxA4 beta-lactamase is a class A beta-lactamase found in Bacteroides fragilis.", "model_sequences": {"$update": {"sequence": {"$update": {"1592": {"$update": {"dna_sequence": {"$update": {"accession": "AY769933.1"}}}}}}}}, "ARO_category": {"$update": {"39434": {"$update": {"category_aro_description": "CfxA beta-lactamases are class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "CfxA4"}}, "295": {"$update": {"ARO_description": "OXA-145 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1451": {"$update": {"dna_sequence": {"$update": {"accession": "FJ790516.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-145"}}, "292": {"$update": {"model_sequences": {"$update": {"sequence": {"8244": {"dna_sequence": {"partial": "0", "sequence": "ATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAACAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTAAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACCCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTTTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATTTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA", "fmax": "861", "accession": "Y14574.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Capnocytophaga ochracea", "NCBI_taxonomy_id": "1018", "NCBI_taxonomy_cvterm_id": "36958"}, "protein_sequence": {"accession": "CAA74912.2", "sequence": "MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-17"}}, "293": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-180"}}, "290": {"$update": {"ARO_description": "vatD is a transposon-mediated acetyltransferase found in Enterococcus faecium.", "model_sequences": {"$update": {"sequence": {"$update": {"462": {"$update": {"dna_sequence": {"$update": {"accession": "AF368302.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}}}}, "$insert": {"CARD_short_name": "vatD"}}, "291": {"$update": {"ARO_category": {"$update": {"36265": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'."}}}}}, "$insert": {"CARD_short_name": "APH(3')-Ia"}}, "3773": {"$insert": {"CARD_short_name": "CTX-M-161"}}, "3772": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "FLC-1"}}, "3771": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "FRI-9"}}, "3770": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "FRI-8"}}, "3777": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamase, no other information available."}, "$insert": {"CARD_short_name": "CTX-M-165"}}, "3776": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamase, no other information available."}, "$insert": {"CARD_short_name": "CTX-M-164"}}, "3775": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamase, no other information available."}, "$insert": {"CARD_short_name": "CTX-M-163"}}, "3774": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamase, no other information available."}, "$insert": {"CARD_short_name": "CTX-M-162"}}, "4835": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-500"}}, "3779": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Yrc-1"}}, "3778": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamase, no other information available."}, "$insert": {"CARD_short_name": "CTX-M-166"}}, "4834": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-498"}}, "270": {"$update": {"ARO_description": "LEN-20 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"8276": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTTATGTTCGCCTGTGTGTTATCTCCCTGTTAGCCACCCTGCCACTGGCGGTAGACGCCGGTCCACAGCCGCTTGAGCAGATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTGGGGATGGTGGAAATGGATCTGGCCAGCGGCCGCACGCTGGCCGCCTGGCGCGCCGATGAACGCTTTCCCATGGTGAGCACCTTTAAAGTGCTGCTGTGCGGCGCGGTGCTGGCGCGGGTGGATGCCGGGCTCGAACAACTGGATCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCGGTCAGCGAAAAACACCTTACCGACGGGATGACGGTCGGCGAACTCTGCGCCGCCGCCATCACCCTGAGCGATAACAGCGCTGGCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCGGGATTAACTGCCTTTCTGCGCCAGATCGGTGACAACGTCACCCGTCTTGACCGCTGGGAAACGGCACTGAATGAGGCGCTTCCCGGCGACGCGCGCGACACCACCACCCCGGCCAGCATGGCCGCCACGCTGCGCAAACTACTGACCGCGCAGCATCTGAGCGCCCGTTCGCAACAGCAACTCCTGCAGTGGATGGTGGACGATCGGGTTGCCGGCCCGCTGATCCGCGCCGTGCTGCCGCCGGGCTGGTTTATCGCCGACAAAACCGGGGCTGGCGAACGGGGTGCGCGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAACCGGAGCGCATTGTGGTGATCTATCTGCGGGATACCCCGGTGAGTATGGCCGAGCGTAATCAACATATCGCCGGGATCGGCGCAGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "861", "accession": "AM850910.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAP12348.2", "sequence": "MRYVRLCVISLLATLPLAVDAGPQPLEQIKQSESQLSGRVGMVEMDLASGRTLAAWRADERFPMVSTFKVLLCGAVLARVDAGLEQLDRRIHYRQQDLVDYSPVSEKHLTDGMTVGELCAAAITLSDNSAGNLLLATVGGPAGLTAFLRQIGDNVTRLDRWETALNEALPGDARDTTTPASMAATLRKLLTAQHLSARSQQQLLQWMVDDRVAGPLIRAVLPPGWFIADKTGAGERGARGIVALLGPDGKPERIVVIYLRDTPVSMAERNQHIAGIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-20"}}, "271": {"$update": {"ARO_description": "CMY-4 is a beta-lactamase found in Proteus mirabilis.", "model_sequences": {"$update": {"sequence": {"$update": {"1179": {"$update": {"dna_sequence": {"$update": {"accession": "Y15130.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-4"}}, "272": {"$update": {"ARO_description": "QnrB36 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"$update": {"591": {"$update": {"dna_sequence": {"$update": {"accession": "JN173058.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB36"}}, "273": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1728": {"$update": {"dna_sequence": {"$update": {"accession": "FJ825622.1"}}}}}}}}, "ARO_category": {"$update": {"36182": {"$update": {"category_aro_description": "VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam."}}}}}, "$insert": {"CARD_short_name": "VEB-7"}}, "274": {"$update": {"ARO_description": "OXA-174 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"2002": {"$update": {"dna_sequence": {"$update": {"accession": "HM113560.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-174"}}, "275": {"$update": {"ARO_description": "OKP-B-2 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1366": {"$update": {"dna_sequence": {"$update": {"accession": "AM051151.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-B-2"}}, "276": {"$update": {"ARO_description": "TetR is the repressor of the tetracycline resistance element; its N-terminal region forms a helix-turn-helix structure and binds DNA. Binding of tetracycline to TetR reduces the repressor affinity for the tetracycline resistance gene (tetA) promoter operator sites. Mutations arise within tetR results in lower affinity for tetracyclin.", "model_sequences": {"$update": {"sequence": {"$update": {"2090": {"$update": {"dna_sequence": {"$update": {"accession": "AL513383.1"}}}}}}}}}, "$insert": {"CARD_short_name": "tetR"}}, "277": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1888": {"$update": {"dna_sequence": {"$update": {"accession": "AB049569.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-91"}}, "278": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1892": {"$update": {"dna_sequence": {"$update": {"accession": "Y10415.1"}}}}}}}}}, "$insert": {"CARD_short_name": "imiS"}}, "279": {"$update": {"model_sequences": {"$update": {"sequence": {"8376": {"dna_sequence": {"partial": "1", "sequence": "GGTTAAAAAATCACTGCGTCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACGGCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAAATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGCGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAACCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTTGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATGTCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGCGTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCGCGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTGGTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAGAACCGGCAGCGGTGGCTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAACCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCA", "fmax": "864", "accession": "JF274244.1", "fmin": "1", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Shigella sp. SH219", "NCBI_taxonomy_id": "1074433", "NCBI_taxonomy_cvterm_id": "39656"}, "protein_sequence": {"accession": "AEM44650.1", "sequence": "VKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDRTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVT"}}}}}}, "$insert": {"CARD_short_name": "CTX-M-107"}}, "4836": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-501"}}, "4659": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-46"}}, "4658": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-45"}}, "2814": {"$insert": {"CARD_short_name": "Mint_23S_AZM"}}, "4784": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-B-21"}}, "1023": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1985": {"$update": {"dna_sequence": {"$update": {"accession": "AY553332.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-14"}}, "1780": {"$update": {"ARO_description": "OXA-146 is a beta-lactamase found in Enterobacteriaceae.", "model_sequences": {"$update": {"sequence": {"$update": {"1524": {"$update": {"dna_sequence": {"$update": {"accession": "FJ194494.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-146"}}, "2146": {"$update": {"ARO_description": "Point mutations in the 5' domain of helix 18, in the rrnB 16S rRNA gene of Escherichia coli can confer resistance to streptomycin.", "model_sequences": {"$update": {"sequence": {"$update": {"3237": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "model_name": "Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to streptomycin"}, "$insert": {"CARD_short_name": "Ecol_16S_STR"}}, "941": {"$update": {"ARO_description": "GES-1 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1593": {"$update": {"dna_sequence": {"$update": {"accession": "AF156486.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-1"}}, "2268": {"$insert": {"CARD_short_name": "eatAv"}}, "4431": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-47"}}, "2262": {"$insert": {"CARD_short_name": "mefC"}}, "2263": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3517": {"$update": {"dna_sequence": {"$update": {"accession": "KP399637.1"}}, "protein_sequence": {"$update": {"accession": "AKA86814.1"}}}}}}}}}, "$insert": {"CARD_short_name": "optrA"}}, "2260": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3514": {"$update": {"dna_sequence": {"$update": {"accession": "AF170730.1"}}, "protein_sequence": {"$update": {"accession": "AAF63432.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}}}}, "$insert": {"CARD_short_name": "vatF"}}, "2261": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3515": {"$update": {"dna_sequence": {"$update": {"accession": "KF287643.1"}}, "protein_sequence": {"$update": {"accession": "AGT57825.1"}}}}}}}}}, "$insert": {"CARD_short_name": "lnuE"}}, "2267": {"$insert": {"CARD_short_name": "Ecol_nfsA_NIT"}}, "2264": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3518": {"$update": {"dna_sequence": {"$update": {"accession": "L06249.1"}}, "protein_sequence": {"$update": {"accession": "AAA26793.1"}}}}}}}}}, "$insert": {"CARD_short_name": "oleC"}}, "2265": {"$update": {"ARO_description": "salA is an ABC-F subfamily protein gene isolated from the chromosome of Mammaliicoccus sciuri conferring resistance to lincosamides and streptogramins.", "model_sequences": {"$update": {"sequence": {"$update": {"3519": {"$update": {"dna_sequence": {"$update": {"accession": "KC693025.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Mammaliicoccus sciuri", "NCBI_taxonomy_id": "1296", "NCBI_taxonomy_cvterm_id": "36794"}}, "protein_sequence": {"$update": {"accession": "AGN74946.1"}}}}}}}}, "ARO_category": {"$delete": ["37716"], "$insert": {"37013": {"category_aro_name": "virginiamycin M1", "category_aro_cvterm_id": "37013", "category_aro_accession": "3000669", "category_aro_class_name": "Antibiotic", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}, "37713": {"category_aro_name": "retapamulin", "category_aro_cvterm_id": "37713", "category_aro_accession": "3001314", "category_aro_class_name": "Antibiotic", "category_aro_description": "Retapamulin is a semi-synthetic pleuromutilin antibiotic approved for the treatment of skin infections."}, "37015": {"category_aro_name": "tiamulin", "category_aro_cvterm_id": "37015", "category_aro_accession": "3000671", "category_aro_class_name": "Antibiotic", "category_aro_description": "Tiamulin is a pleuromutilin derivative currently used in veterinary medicine. It binds to the 23 rRNA of the 50S ribosomal subunit to inhibit protein translation."}, "35983": {"category_aro_name": "clindamycin", "category_aro_cvterm_id": "35983", "category_aro_accession": "0000066", "category_aro_class_name": "Antibiotic", "category_aro_description": "Clindamycin is a lincosamide antibiotic that blocks A-site aminoacyl-tRNA binding. It is usually used to treat infections with anaerobic bacteria but can also be used to treat some protozoal diseases, such as malaria."}}}}, "$insert": {"CARD_short_name": "salA"}}, "1781": {"$update": {"ARO_description": "AAC(2')-Ia is a chromosomal-encoded aminoglycoside acetyltransferase in P. stuartii.", "model_sequences": {"$update": {"sequence": {"8144": {"dna_sequence": {"partial": "0", "sequence": "ATGGGCATAGAATACCGCAGTCTGCATACCAGCCAATTGACACTGAGTGAAAAAGAAGCGCTTTACGATTTATTAATTGAAGGTTTTGAAGGCGATTTTTCGCATGACGATTTCGCGCACACTTTAGGTGGAATGCACGTCATGGCTTTTGATCAACAAAAATTGGTTGGTCATGTTGCAATTATTCAACGCCATATGGCCCTAGATAATACGCCTATCTCTGTAGGGTATGTTGAAGCGATGGTAGTTGAACAAAGTTATCGTCGCCAAGGTATTGGGCGGCAATTGATGCTGCAAACCAATAAAATTATAGCTTCGTGTTATCAATTAGGGCTGCTGTCGGCTTCAGATGATGGACAAAAATTGTATCATTCGGTTGGATGGCAAATCTGGAAAGGTAAGTTGTTTGAATTGAAACAAGGGAGCTATATCCGTTCTATTGAAGAAGAAGGCGGAGTCATGGGCTGGAAAGCGGATGGTGAGGTTGATTTTACCGCTTCGCTTTACTGTGATTTTCGTGGCGGTGATCAGTGGTAA", "fmax": "800", "accession": "L06156.2", "fmin": "263", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Providencia stuartii", "NCBI_taxonomy_id": "588", "NCBI_taxonomy_cvterm_id": "36946"}, "protein_sequence": {"accession": "AAA03550.1", "sequence": "MGIEYRSLHTSQLTLSEKEALYDLLIEGFEGDFSHDDFAHTLGGMHVMAFDQQKLVGHVAIIQRHMALDNTPISVGYVEAMVVEQSYRRQGIGRQLMLQTNKIIASCYQLGLLSASDDGQKLYHSVGWQIWKGKLFELKQGSYIRSIEEEGGVMGWKADGEVDFTASLYCDFRGGDQW"}}}}}}, "$insert": {"CARD_short_name": "AAC(2')-Ia"}}, "2445": {"$update": {"model_name": "Erm(44)v"}, "$insert": {"CARD_short_name": "Erm(44)v"}}, "108": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1940": {"$update": {"dna_sequence": {"$update": {"accession": "FJ666071.1"}}}}}}}}}, "$insert": {"CARD_short_name": "PDC-8"}}, "109": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"384": {"$update": {"dna_sequence": {"$update": {"accession": "X51891.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}, "37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "ErmE"}}, "102": {"$insert": {"CARD_short_name": "TLA-2"}}, "103": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1470": {"$update": {"dna_sequence": {"$update": {"accession": "AJ920369.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-12"}}, "100": {"$update": {"ARO_description": "Specific mutations that occurs on Mycobacterium tuberculosis ethA causing it to be ethionamide resistant.", "ARO_category": {"$update": {"40067": {"$update": {"category_aro_description": "ethionamide is a second-line antitubercular agent that inhibits mycolic acid synthesis."}}, "40050": {"$update": {"category_aro_description": "Mutations that occurs on the ethA genes resulting in the inability to catalyzes the oxidation of ethionamide (ETH) to the corresponding sulfoxide (the active drug)."}}}}}, "$insert": {"CARD_short_name": "Mtub_ethA_ETO"}}, "101": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1397": {"$update": {"dna_sequence": {"$update": {"accession": "AY628175.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-109"}}, "106": {"$update": {"ARO_description": "catB9 is a chromosome-encoded variant of the cat gene found in Vibrio cholerae.", "model_sequences": {"$update": {"sequence": {"$update": {"386": {"$update": {"dna_sequence": {"$update": {"accession": "AF462019.1"}}}}}}}}, "ARO_category": {"$update": {"36261": {"$update": {"category_aro_description": "Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini."}}}}}, "$insert": {"CARD_short_name": "catB9"}}, "107": {"$update": {"model_sequences": {"$update": {"sequence": {"8238": {"dna_sequence": {"partial": "0", "sequence": "ATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTAAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCTGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCATTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGACGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA", "fmax": "861", "accession": "U95363.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "AAC32889.2", "sequence": "MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-43"}}, "104": {"$update": {"ARO_description": "OXA-61 is a beta-lactamase found in Campylobacter jejuni.", "model_sequences": {"$update": {"sequence": {"$update": {"1464": {"$update": {"dna_sequence": {"$update": {"accession": "AY587956.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-61"}}, "105": {"$update": {"ARO_description": "CARB-4 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1585": {"$update": {"dna_sequence": {"$update": {"accession": "U14749.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-4"}}, "2046": {"$insert": {"CARD_short_name": "tet(33)"}}, "2047": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1930": {"$update": {"dna_sequence": {"$update": {"accession": "KF203096.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-322"}}, "2044": {"$update": {"ARO_description": "QnrB31 is a plasmid-mediated quinolone resistance protein found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"8167": {"dna_sequence": {"partial": "0", "sequence": "ATGACGCCATTACTGTATAAGAAAACAGGTACAAATATGGCTCTGGCGCTCGTGGGCGAAAAAATTGACAGAAACCGTTTCACCGGTGAGAAAATTGAAAATAGTACATTTTTTTTATGTGATTTTTCAGGAGCCGACCTGAGCGGCACTGAGTTTATCGGCTGTCAATTCTATGATCGTGAAAGCCAGAAAGGCTGCAATTTTAGTCGTGCGATGTTAAAGGATGCCATTTTTAAAAGCTGCGATTTATCCATGGCGGATTTTCGCAATGCAAGCGCCCTGGGTATTGAGATTTCTCATTGTAGGGCTCAGGGTGCAGATTTTCGCGGCGCAAGCTTTATGAACATGATTACCACGCGCACTTGGTTCTGCAGCGCGTATATCACGAATACGAATCTGTCTTATGCCAATTTTTCGAAAGTCGTGTTGGAGAAGTGTGAGTTATGGGAAAACCGTTGGATGGGTGCCCAGGTACTGGGCGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCAACTTTCGACTGGCGAGCAGCAAACTTTACACATTGCGATCTCACAAATTCGGAGTTGGGTGACTTAGATATTCGTCGGGTTGATTTACAAGGCGTTAAGTTGGACAACTACCAGGCTTCGTTGCTCATGGAGCGACTTGGCATCGCGATAATTGGTTGA", "fmax": "681", "accession": "HQ418999.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "ADQ43424.1", "sequence": "MTPLLYKKTGTNMALALVGEKIDRNRFTGEKIENSTFFLCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNASALGIEISHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRRVDLQGVKLDNYQASLLMERLGIAIIG"}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB31"}}, "2045": {"$update": {"ARO_description": "OXY-2-3 is a beta-lactamase found in Klebsiella oxytoca.", "model_sequences": {"$update": {"sequence": {"8260": {"dna_sequence": {"partial": "0", "sequence": "ATGATAAAAAGTTCGTGGCGTAAAATTGCAATGCTAGCCGCCGTTCCGCTGCTGCTGGCGAGCGGCGCACTGTGGGCCAGTACCGATGCTATCCATCAGAAGCTGACAGATCTCGAGAAGCGTTCAGGCGGCAGGTTGGGCGTGGCGCTAATCAACACGGCAGATAATTCTCAAATCTTATATCGCGGCGACGAGCGTTTTGCCATGTGCAGCACCAGTAAAGTGATGGCCGCCGCCGCGGTATTAAAACAGAGCGAAAGCAATAAAGAGGTGGTAAATAAAAGGCTGGAGATTAACGCAGCCGATTTGGTGGTCTGGAGTCCGATTACCGAAAAACATCTCCAGAGCGGAATGACGCTGGCTGAGCTAAGCGCGGCGACGCTGCAATATAGCGACAATACGGCGATGAATCTGATCATCGGCTACCTTGGCGGGCCGGAAAAAGTCACCGCCTTCGCCCGCAGTATCGGCGATGCCACCTTTCGTCTCGATCGTACGGAGCCCACGCTGAATACCGCCATCCCGGGCGATGAGCGTGATACCAGCACGCCGCTGGCGATGGCTGAAAGCCTACGCAAGCTGACGCTTGGCGATGCGCTGGGCGAACAGCAACGCGCCCAGTTAGTCACCTGGCTGAAAGGCAATACCACCGGCGGGCAAAGCATTCGCGCGGGCCTGCCTGAAAGCTGGGTGGTCGGCGATAAAACCGGCGGCGGAGATTACGGCACCACCAATGATATTGCGGTTATCTGGCCGGAAGATCACGCTCCGCTGGTATTAGTCACCTACTTTACCCAGCCGCAGCAGGATGCGAAAAACCGCAAAGAGGTGTTAGCCGCAGCGGCAAAAATCGTGACCGAAGGGCTTTAA", "fmax": "1031", "accession": "AY077488.2", "fmin": "161", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella oxytoca", "NCBI_taxonomy_id": "571", "NCBI_taxonomy_cvterm_id": "36788"}, "protein_sequence": {"accession": "AAL78281.2", "sequence": "MIKSSWRKIAMLAAVPLLLASGALWASTDAIHQKLTDLEKRSGGRLGVALINTADNSQILYRGDERFAMCSTSKVMAAAAVLKQSESNKEVVNKRLEINAADLVVWSPITEKHLQSGMTLAELSAATLQYSDNTAMNLIIGYLGGPEKVTAFARSIGDATFRLDRTEPTLNTAIPGDERDTSTPLAMAESLRKLTLGDALGEQQRAQLVTWLKGNTTGGQSIRAGLPESWVVGDKTGGGDYGTTNDIAVIWPEDHAPLVLVTYFTQPQQDAKNRKEVLAAAAKIVTEGL"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXY-2-3"}}, "2042": {"$update": {"ARO_description": "IND-8 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1340": {"$update": {"dna_sequence": {"$update": {"accession": "GU186044.1"}}}}}}}}, "ARO_category": {"$update": {"36199": {"$update": {"category_aro_description": "IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "IND-8"}}, "2043": {"$update": {"ARO_description": "aadA8 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in V. cholerae, K. pneumoniae and Bacillus endophyticus.", "model_sequences": {"$update": {"sequence": {"$update": {"558": {"$update": {"dna_sequence": {"$update": {"accession": "AY139603.1"}}}}}}}}, "ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "aadA8"}}, "2040": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1079": {"$update": {"dna_sequence": {"$update": {"accession": "AF047171.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-60"}}, "2041": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1055": {"$update": {"dna_sequence": {"$update": {"accession": "KM588352.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-424"}}, "4819": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-114t"}}, "4818": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-114s"}}, "2048": {"$update": {"ARO_description": "OXA-57 is a beta-lactamase found in Burkholderia pseudomallei.", "model_sequences": {"$update": {"sequence": {"$update": {"1137": {"$update": {"dna_sequence": {"$update": {"accession": "AJ631966.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-57"}}, "2049": {"$update": {"ARO_description": "QnrB72 is a plasmid-mediated quinolone resistance protein found in Citrobacter sp. TR21_24.", "model_sequences": {"$update": {"sequence": {"$update": {"469": {"$update": {"dna_sequence": {"$update": {"accession": "KC741443.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB72"}}, "4219": {"$insert": {"CARD_short_name": "ADC-149"}}, "2811": {"$insert": {"CARD_short_name": "Mavi_23S_CLR"}}, "3597": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-11"}}, "4279": {"$insert": {"CARD_short_name": "ADC-214"}}, "4843": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-508"}}, "2032": {"$update": {"ARO_description": "CTX-M-62 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"8210": {"dna_sequence": {"partial": "0", "sequence": "ATGGTTAAAAAATCACTGCGTCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACGGCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGAAGACTGGGGGTGGCATTGATTAACACAGCGGATAATTCGCAAATACTTTATCGTGCTGATGAGCGCTTCGCGATGTGCAGCACCAGTAAAGTGATGGCCGCGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAACCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTGGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATGTCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGCGTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGTCGACGTTAAACACCGCCATTCCGGGCGATCCGCGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTGGTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCAGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGCGGTGACTATGGCACCACCAACGATATCGCGGTGATTTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAACCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA", "fmax": "3001", "accession": "EF219134.3", "fmin": "2125", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "ABP04245.1", "sequence": "MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTESTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL"}}}}}}, "$insert": {"CARD_short_name": "CTX-M-62"}}, "3519": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-450"}}, "3518": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-449"}}, "5298": {"$insert": {"CARD_short_name": "PDC-16"}}, "3513": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-443"}}, "3512": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-442"}}, "3511": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-441"}}, "3510": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-440"}}, "3517": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-448"}}, "3516": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-447"}}, "3515": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-446"}}, "3514": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-444"}}, "2688": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ArmR"}}, "2689": {"$update": {"ARO_description": "Point mutations in the 23S rRNA subunit of the large ribosomal bacterial subunit in Staphylococcus aureus, which confer resistance to linezolid by disrupting antibiotic target binding."}, "$insert": {"CARD_short_name": "Saur_23S_LZD"}}, "2685": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Paer_CpxR"}}, "2686": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Paer_CpxR_MULT"}}, "2680": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Paer_tMexR_MULT"}}, "2681": {"$update": {"ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "model_name": "Escherichia coli fabG mutations conferring resistance to triclosan"}, "$insert": {"CARD_short_name": "Ecol_fabG_TRC"}}, "2682": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Paer_NalC_ATM"}}, "2683": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}, "model_name": "MexAB-OprM with NalD mutations conferring resistance to multiple antibiotics"}, "$insert": {"CARD_short_name": "Paer_NalD_MULT"}}, "5407": {"$insert": {"CARD_short_name": "PDC-273"}}, "3999": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-236"}}, "1249": {"$update": {"ARO_description": "FOX-5 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1276": {"$update": {"dna_sequence": {"$update": {"accession": "AY007369.1"}}}}}}}}, "ARO_category": {"$update": {"36206": {"$update": {"category_aro_description": "FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins."}}}}}, "$insert": {"CARD_short_name": "FOX-5"}}, "5406": {"$insert": {"CARD_short_name": "PDC-271"}}, "3998": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-235"}}, "1434": {"$update": {"ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}, "37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "Erm(35)"}}, "99": {"$update": {"ARO_description": "QnrB38 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"8281": {"dna_sequence": {"partial": "0", "sequence": "ATGGCTCTGGCATTAATTGGCGAAAAAATTGACAGAAACCGCTTCACCGGTGAAAAAGTTGAAAATAGCACTTTTTTTAACTGTGATTTTTCGGGTGCCGACCTTAGCGGTACTGAATTTATCGGCTGTCAGTTCTATGATCGAGAAAGCCAGAAAGGGTGCAATTTCAGTCGCGCAATACTGAAAGATGCCATTTTTAAAAGCTGTGATTTATCCATGGCGGATTTTCGCAACGTCAGTGCGTTGGGCATAGAAATTCGCCACTGCCGCGCACAGGGTGCAGATTTTCGCGGCGCAAGTTTCATGAATATGATCACCACGCGCACCTGGTTTTGCAGCGCATATATCACTAATACCAATCTAAGCTACGCCAACTTTTCGAAGGCCGTGCTTGAAAAGTGCGAATTGTGGGAAAATCGCTGGATGGGAACTCAGGTACTGGGTGCGACGTTGAGTGGTTCCGATCTCTCCGGTGGCGAGTTTTCGTCGTTCGACTGGCGGACGGCAAATTTCACGCACTGTGATTTGACCAATTCAGAACTGGGTGATTTAGATATTCGGGGCGTCGATTTACAAGGTGTCAAATTGGACAGCTATCAGGCCGCATTGCTCATGGAACGTCTTGGCATCGCTGTCATTGGCTAA", "fmax": "2951", "accession": "JN173060.2", "fmin": "2306", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Citrobacter freundii", "NCBI_taxonomy_id": "546", "NCBI_taxonomy_cvterm_id": "36915"}, "protein_sequence": {"accession": "AEL00461.1", "sequence": "MALALIGEKIDRNRFTGEKVENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAILKDAIFKSCDLSMADFRNVSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKAVLEKCELWENRWMGTQVLGATLSGSDLSGGEFSSFDWRTANFTHCDLTNSELGDLDIRGVDLQGVKLDSYQAALLMERLGIAVIG"}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB38"}}, "98": {"$update": {"model_sequences": {"$update": {"sequence": {"8245": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGATATGCTGCGCGCTGCTGCTGACAGCCTCTTTCTCCACGTTTGCTGCCGCAAAAACAGAACAACAAATTGCCGATATCGTTAACCGCACCATCACACCACTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTGGCGATTATCTACGAGGGGAAACCTTATTACTTTACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGGTCGGTCAGTAAGACGTTTAACGGCGTGTTGGGCGGCGACGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCGGGGTATCAGCCTGCTGCACTTAGCCACCTATACAGCGGGTGGCCTGCCGCTGCAGATCCCCGATGACGTTACGGATAAAGCCGCATTACTGCGCTTTTATCAAAACTGGCAACCACAATGGACTCCGGGCGCTAAGCGTCTTTACGCTAACTCCAGCATTGGTCTGTTTGGTGCGCTGGCGGTGAAACCTTCAGGTATGAGCTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAAAGCGAACAAAAAAATTATGCCTGGGGCTATCGCGAAGGGAAGCCTGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATCGATATGGCCCGCTGGGTTCAGGCCAACATGGACGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGAGCTTGCGCAGTCTCGTTACTGGCGTATTGGTGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCAGCACCTGCCGTGAAAGCCTCATGGGTGCATAAAACGGGATCCACAGGTGGATTTGGCAGCTACGTTGCCTTCGTTCCAGAAAAAAACCTTGGCATAGTGATGCTGGCAAACAAAAGCTATCCTAACCCGGCTCGCGTAGAGGCGGCCTGGCGCATTCTTGAAAAACTGCAATAA", "fmax": "2185", "accession": "HM569226.2", "fmin": "1039", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Citrobacter freundii", "NCBI_taxonomy_id": "546", "NCBI_taxonomy_cvterm_id": "36915"}, "protein_sequence": {"accession": "ADP02979.1", "sequence": "MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWRGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPARVEAAWRILEKLQ"}}}}}}, "$insert": {"CARD_short_name": "CMY-48"}}, "1435": {"$update": {"ARO_description": "cmlA6 is a plasmid-encoded chloramphenicol exporter that is found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"728": {"$update": {"dna_sequence": {"$update": {"accession": "AF294653.1"}}}}}}}}}, "$insert": {"CARD_short_name": "cmlA6"}}, "91": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "gadX"}}, "90": {"$update": {"ARO_description": "Point mutations that occurs in Staphylococcus aureus rpoB resulting in resistance to rifampicin."}, "$insert": {"CARD_short_name": "Saur_rpoB_RIF"}}, "93": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1941": {"$update": {"dna_sequence": {"$update": {"accession": "FJ194944.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-105"}}, "92": {"$update": {"ARO_description": "CTX-M-42 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1742": {"$update": {"dna_sequence": {"$update": {"accession": "DQ061159.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-42"}}, "95": {"$update": {"ARO_description": "CMY-56 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1196": {"$update": {"dna_sequence": {"$update": {"accession": "HQ322613.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-56"}}, "94": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1897": {"$update": {"dna_sequence": {"$update": {"accession": "JQ733576.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-79"}}, "97": {"$update": {"ARO_description": "Also known as vanXYC, is a vanXY variant found in the vanC gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"39": {"$update": {"dna_sequence": {"$update": {"accession": "AF162694.1"}}}}}}}}, "model_name": "vanXY gene in vanC cluster", "ARO_name": "vanXY gene in vanC cluster"}, "$insert": {"CARD_short_name": "vanXY_in_vanC"}}, "96": {"$update": {"ARO_description": "OXA-426 is a beta-lactamase found in clinical isolates of Acinetobacter baumannii. It is carbapenem resistant.", "model_sequences": {"$update": {"sequence": {"$update": {"1216": {"$update": {"dna_sequence": {"$update": {"accession": "KM588354.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-426"}}, "1623": {"$update": {"ARO_description": "GIM-2 is a metallo-beta-lactamase present on an integron found in clinical isolates of Enterobacter cloacae in Germany.", "model_sequences": {"$update": {"sequence": {"$update": {"2106": {"$update": {"dna_sequence": {"$update": {"accession": "KM659858.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GIM-2"}}, "1622": {"$update": {"ARO_description": "Also known as vanWG, is a vanW variant found in the vanG gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"535": {"$update": {"dna_sequence": {"$update": {"accession": "DQ212986.1"}}}}}}}}, "model_name": "vanW gene in vanG cluster", "ARO_name": "vanW gene in vanG cluster"}, "$insert": {"CARD_short_name": "vanW_in_vanG_cl"}}, "1993": {"$update": {"ARO_description": "QnrB74 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"556": {"$update": {"dna_sequence": {"$update": {"accession": "KJ415247.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB74"}}, "1620": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1741": {"$update": {"dna_sequence": {"$update": {"accession": "KM211509.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-156"}}, "1627": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"869": {"$update": {"dna_sequence": {"$update": {"accession": "FN813245.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-95"}}, "1626": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"562": {"$update": {"dna_sequence": {"$update": {"accession": "FR772051.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}}}}, "$insert": {"CARD_short_name": "vgaE"}}, "1625": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1126": {"$update": {"dna_sequence": {"$update": {"accession": "HM570035.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-179"}}, "1624": {"$update": {"ARO_description": "lmrD is a chromosomally-encoded efflux pump that confers resistance to lincosamides in Streptomyces lincolnensis and Lactococcus lactis. It can dimerize with lmrC."}, "$insert": {"CARD_short_name": "lmrD"}}, "1999": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2127": {"$update": {"dna_sequence": {"$update": {"accession": "KP050492.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-215"}}, "1998": {"$update": {"ARO_description": "CTX-M-83 is a beta-lactamase found in Salmonella enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"1170": {"$update": {"dna_sequence": {"$update": {"accession": "FJ214366.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-83"}}, "1629": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1493": {"$update": {"dna_sequence": {"$update": {"accession": "HQ877606.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-197"}}, "1628": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1389": {"$update": {"dna_sequence": {"$update": {"accession": "JX121121.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-154"}}, "3992": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6356": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-229"}}, "3398": {"$update": {"ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "aadA10"}}, "3535": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-473"}}, "4376": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6751": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-15"}}, "3534": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-472"}}, "2860": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-81"}}, "2861": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-82"}}, "2862": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-83"}}, "2863": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-84"}}, "2864": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-85"}}, "2865": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-86"}}, "2866": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-87"}}, "2867": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-88"}}, "2868": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-89"}}, "2869": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-90"}}, "557": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1717": {"$update": {"dna_sequence": {"$update": {"accession": "S82452.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-9"}}, "556": {"$update": {"ARO_description": "Also known as vanYB, is a vanY variant found in the vanB gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"3457": {"$update": {"dna_sequence": {"$update": {"accession": "U35369.1"}}}}}}}}, "model_name": "vanY gene in vanB cluster", "ARO_name": "vanY gene in vanB cluster"}, "$insert": {"CARD_short_name": "vanY_in_vanB_cl"}}, "551": {"$update": {"ARO_description": "CTX-M-117 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"906": {"$update": {"dna_sequence": {"$update": {"accession": "JN227085.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-117"}}, "550": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1267": {"$update": {"dna_sequence": {"$update": {"accession": "JQ711184.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-71"}}, "553": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1500": {"$update": {"dna_sequence": {"$update": {"accession": "JX982634.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-35"}}, "552": {"$update": {"ARO_description": "QnrB28 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"$update": {"191": {"$update": {"dna_sequence": {"$update": {"accession": "HM439643.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB28"}}, "5054": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-745"}}, "2744": {"$update": {"ARO_description": "MarR is a repressor of the mar operon marRAB, thus regulating the expression of marA, the activator of multidrug efflux pump AcrAB.", "model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_id": "39962", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$delete": ["35954"], "$insert": {"35997": {"category_aro_name": "antibiotic target alteration", "category_aro_cvterm_id": "35997", "category_aro_accession": "0001001", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Mutational alteration or enzymatic modification of antibiotic target which results in antibiotic resistance."}, "43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}, "36590": {"category_aro_name": "protein(s) and two-component regulatory system modulating antibiotic efflux", "category_aro_cvterm_id": "36590", "category_aro_accession": "3000451", "category_aro_class_name": "Efflux Regulator", "category_aro_description": "Protein(s) and two component regulatory systems that directly or indirectly change rates of antibiotic efflux."}}}, "ARO_accession": "3003378"}, "$insert": {"CARD_short_name": "Ecol_MarR_MULT"}}, "5409": {"$insert": {"CARD_short_name": "PDC-275"}}, "5055": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-746"}}, "1502": {"$update": {"ARO_description": "OXA-209 is a beta-lactamase found in Riemerella anatipestifer.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-209"}}, "5408": {"$insert": {"CARD_short_name": "PDC-274"}}, "5678": {"$update": {"ARO_category": {"$update": {"36182": {"$update": {"category_aro_description": "VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam."}}}}}, "$insert": {"CARD_short_name": "VEB-15"}}, "4848": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-513"}}, "1199": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1233": {"$update": {"dna_sequence": {"$update": {"accession": "JX870080.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-168"}}, "1198": {"$update": {"model_name": "mef(B)"}, "$insert": {"CARD_short_name": "mef(B)"}}, "3348": {"$insert": {"CARD_short_name": "cfr(B)"}}, "3349": {"$update": {"ARO_description": "Tetracycline-resistant determinant encoded on the plasmid pKQ10 in Enterococcus faecium."}, "$insert": {"CARD_short_name": "tetU"}}, "1191": {"$update": {"ARO_description": "Multidrug resistance protein MdtM.", "ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "mdtM"}}, "1190": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1378": {"$update": {"dna_sequence": {"$update": {"accession": "KF297583.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-354"}}, "1193": {"$update": {"ARO_description": "ErmH is a plasmid-mediated methyltransferase found in Streptomyces thermotolerans.", "model_sequences": {"$update": {"sequence": {"$update": {"63": {"$update": {"dna_sequence": {"$update": {"accession": "M16503.1"}}}}}}}}}, "$insert": {"CARD_short_name": "ErmH"}}, "1192": {"$update": {"ARO_category": {"$update": {"36182": {"$update": {"category_aro_description": "VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam."}}}}}, "$insert": {"CARD_short_name": "VEB-1"}}, "1195": {"$update": {"model_sequences": {"$update": {"sequence": {"8263": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTTTTATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACATCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGAGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTAGCAAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATCGTGGTGATTTATCTGCGGGATACCCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "861", "accession": "AJ863560.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAI10727.2", "sequence": "MRFIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-55"}}, "1194": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5866": {"$update": {"dna_sequence": {"$update": {"accession": "AF043100.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-16"}}, "1197": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2087": {"$update": {"dna_sequence": {"$update": {"accession": "AE000516.1"}}}}}}}}, "ARO_category": {"$update": {"40003": {"$update": {"category_aro_description": "Ribosomal protein S12 stabilizes the highly conserved pseudoknot structure formed by 16S rRNA. Amino acid substitutions in RpsL affect the higher-order structure of 16S rRNA and confer antibiotic resistance."}}}}}, "$insert": {"CARD_short_name": "Mtub_rpsL_STR"}}, "1196": {"$update": {"ARO_description": "OXA-71 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1057": {"$update": {"dna_sequence": {"$update": {"accession": "AY750913.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-71"}}, "1759": {"$update": {"ARO_description": "VanF is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Lac, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity. It is associated with both vancomycin and teicoplanin resistance in Paenibacillus popilliae.", "model_sequences": {"$update": {"sequence": {"$update": {"258": {"$update": {"dna_sequence": {"$update": {"accession": "AF155139.1"}}}}}}}}, "ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "vanF"}}, "1758": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"974": {"$update": {"dna_sequence": {"$update": {"accession": "KF203100.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-326"}}, "1757": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"411": {"$update": {"dna_sequence": {"$update": {"accession": "AP009048.1"}}}}}}}}}, "$insert": {"CARD_short_name": "emrA"}}, "1756": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1549": {"$update": {"dna_sequence": {"$update": {"accession": "KF992025.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-93"}}, "1755": {"$update": {"ARO_description": "CTX-M-23 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1411": {"$update": {"dna_sequence": {"$update": {"accession": "AF488377.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-23"}}, "1754": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"675": {"$update": {"dna_sequence": {"$update": {"accession": "KF478993.1"}}}}}}}}, "ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "vanO"}}, "1753": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"829": {"$update": {"dna_sequence": {"$update": {"accession": "JX121115.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-148"}}, "1752": {"$update": {"model_name": "MdtK"}, "$insert": {"CARD_short_name": "MdtK"}}, "1751": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5165": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Mammaliicoccus sciuri"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}, "37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "Erm(33)"}}, "1750": {"$update": {"ARO_description": "OXA-254 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1530": {"$update": {"dna_sequence": {"$update": {"accession": "AB781687.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-254"}}, "1177": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1786": {"$update": {"dna_sequence": {"$update": {"accession": "HQ641421.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-12"}}, "1176": {"$update": {"ARO_category": {"$update": {"40000": {"$update": {"category_aro_description": "Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity. It is a catalase-peroxidases that catalyzes the activation of isoniazid. Mutations that arises within this protein cause changes that results in the inability for katG to activate antibiotics, conferring resistance."}}}}, "model_param": {"$update": {"snp": {"$update": {"param_value": {"$insert": {"12300": "P365R"}}, "clinical": {"$insert": {"12300": "P365R"}}}}}}}, "$insert": {"CARD_short_name": "Mtub_katG_INH"}}, "1175": {"$insert": {"CARD_short_name": "Efac_cls_DAP"}}, "1174": {"$update": {"ARO_description": "QnrB22 is a plasmid-mediated quinolone resistance protein found in Citrobacter werkmanii.", "model_sequences": {"$update": {"sequence": {"$update": {"689": {"$update": {"dna_sequence": {"$update": {"accession": "FJ981621.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB22"}}, "1173": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1959": {"$update": {"dna_sequence": {"$update": {"accession": "AF104442.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-54"}}, "1172": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1925": {"$update": {"dna_sequence": {"$update": {"accession": "HQ425492.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-194"}}, "1171": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"410": {"$update": {"dna_sequence": {"$update": {"accession": "FN594949.1"}}}}}}}}, "model_name": "tet(44)"}, "$insert": {"CARD_short_name": "tet(44)"}}, "1170": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1738": {"$update": {"dna_sequence": {"$update": {"accession": "FN556186.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-46"}}, "4251": {"$insert": {"CARD_short_name": "ADC-186"}}, "4250": {"$insert": {"CARD_short_name": "ADC-185"}}, "4253": {"$insert": {"CARD_short_name": "ADC-188"}}, "4252": {"$insert": {"CARD_short_name": "ADC-187"}}, "4255": {"$insert": {"CARD_short_name": "ADC-190"}}, "4254": {"$insert": {"CARD_short_name": "ADC-189"}}, "1179": {"$update": {"ARO_description": "IMP-4 is a beta-lactamase found in Acinetobacter baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1785": {"$update": {"dna_sequence": {"$update": {"accession": "AF244145.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-4"}}, "1178": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"823": {"$update": {"dna_sequence": {"$update": {"accession": "JQ733578.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-81"}}, "5533": {"$insert": {"CARD_short_name": "PDC-403"}}, "5532": {"$insert": {"CARD_short_name": "PDC-402"}}, "5531": {"$insert": {"CARD_short_name": "PDC-401"}}, "5530": {"$insert": {"CARD_short_name": "PDC-400"}}, "5537": {"$insert": {"CARD_short_name": "PDC-407"}}, "5536": {"$insert": {"CARD_short_name": "PDC-406"}}, "5535": {"$insert": {"CARD_short_name": "PDC-405"}}, "5534": {"$insert": {"CARD_short_name": "PDC-404"}}, "5539": {"$insert": {"CARD_short_name": "PDC-409"}}, "5538": {"$insert": {"CARD_short_name": "PDC-408"}}, "1005": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2074": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "Ecol_soxR_MULT"}}, "1285": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"584": {"$update": {"dna_sequence": {"$update": {"accession": "AB211124.1"}}}}}}}}, "model_name": "SAT-2"}, "$insert": {"CARD_short_name": "SAT-2"}}, "1284": {"$update": {"ARO_description": "IND-15 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1987": {"$update": {"dna_sequence": {"$update": {"accession": "AB563173.1"}}}}}}}}, "ARO_category": {"$update": {"36199": {"$update": {"category_aro_description": "IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "IND-15"}}, "1287": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1665": {"$update": {"dna_sequence": {"$update": {"accession": "JF274242.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-110"}}, "512": {"$update": {"ARO_description": "CTX-M-82 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1088": {"$update": {"dna_sequence": {"$update": {"accession": "DQ256091.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-82"}}, "1281": {"$update": {"ARO_description": "OXA-110 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1600": {"$update": {"dna_sequence": {"$update": {"accession": "EF650036.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-110"}}, "1280": {"$update": {"ARO_description": "QnrB12 is a plasmid-mediated quinolone resistance protein found in Citrobacter werkmanii.", "model_sequences": {"$update": {"sequence": {"$update": {"176": {"$update": {"dna_sequence": {"$update": {"accession": "AM774474.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB12"}}, "1283": {"$update": {"ARO_description": "KPC-6 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1437": {"$update": {"dna_sequence": {"$update": {"accession": "EU555534.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-6"}}, "1282": {"$update": {"ARO_description": "SIM-1 is an integron-encoded Ambler class B beta-lactamase isolated from Acinetobacter baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1152": {"$update": {"dna_sequence": {"$update": {"accession": "GQ288397.1"}}}}}}}}, "model_name": "SIM-1", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SIM-1"}}, "2819": {"$update": {"ARO_description": "Point mutation in the 23S rRNA of Escherichia coli shown to confer resistance to oxazolidinone type antibiotics.", "ARO_category": {"$update": {"41323": {"$update": {"category_aro_description": "Point mutations in the 23S rRNA subunit may confer resistance to oxazolidinone antibiotics."}}}}}, "$insert": {"CARD_short_name": "Ecol_23S_OXZ"}}, "515": {"$update": {"model_sequences": {"$update": {"sequence": {"8170": {"dna_sequence": {"partial": "0", "sequence": "ATGAAGCGAAAAGAGTTGCACGAGACGTCTCGTCTCGCATACGGTCGTCGCATGACCACTCGCCCCGCGCACATCGCCATGTTCTCCATCGCCCTGCACGGCCACGTGAACCCCAGCCTGGAGGTCATCCGCGAGCTCGTCGCGCGGGGGCACCGGGTGACGTACGCGATCCCGCCGCTCCTCGCGGACAAGGTCGCCGAGGCGGGCGCCGAACCCAAGCTCTGGAACAGCACACTGCCCGGCCCCGACGCCGACCCGGAGGCCTGGGGGAGCACCCTCCTGGACAACGTGGAGCCCTTCCTCGCCGACGCGATCCAGTCGCTCCCGCAGCTCGCCCAGGCGTACGAGGGGGACGAGCCGGACCTGGTCCTGCACGACATCGCCTCCTACACCGCCCGCGTCCTGGGCCGCCGCTGGGAGGTGCCCGTGATCTCCCTGTCGCCCTGCATGGTCGCCTGGGAGGGGTACGAGCAGGAGGTCGGCGAGCCGATGTGGGAGGAGCCGCGGAAGACCGAGCGCGGGCAGGCGTACTACGCCCGCTTCCACGCCTGGCTGGAGGAGAACGGGATCACCGACCACCCCGACCCGTTCATCGGCCGCCCCGACCGCTCCCTGGTGCTGATCCCCAAGGCGCTCCAGCCCCACGCCGACCGGGTGGACGAGACGACGTACACCTTCGTCGGCGCCTGCCAGGGGGACCGCACCGCCGAGGGCGACTGGGCCCGTCCCGAGGGCGCGGAGAAGGTCGTCCTGGTCTCGCTCGGTTCGGCCTTCACCAAGCAGCCCGCGTTCTACCGGGAGTGCGTCCGGGCCTTCGGTGAGCTGCCCGGCTGGCACACCGTGCTCCAGGTCGGCCGGCACGTAGACCCGGCCGAGCTGGGCGACGTACCGGACAACGTGGAAGTCCGCACGTGGGTACCGCAGTTGGCGATCCTCCAGCAGGCCGACCTGTTCGTCACCCACGCGGGCGCGGGCGGCAGCCAGGAGGGTCTGGCCACCGCCACGCCGATGATCGCCGTACCGCAGGCCGCGGACCAGTTCGGCAACGCCGACATGCTCCAGGGCCTCGGCGTCGCCCGCACCCTCCCGACCGAGGAGGCCACCGCGAAGGCGCTGCGCACCGCCGCCCTCGCCCTGGTCGACGACCCGGAGGTGGCGGCGCGCCTGAAGGAGATCCAGGCGCGGATGGCCCAGGAGGGCGGCACCCGCCGGGCCGCCGACCTCATCGAGGCCGAACTGGCCGCCGCGCGCGGCTGA", "fmax": "1257", "accession": "DQ185434.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Streptomyces lividans", "NCBI_taxonomy_id": "1916", "NCBI_taxonomy_cvterm_id": "39569"}, "protein_sequence": {"accession": "ABA28305.2", "sequence": "MKRKELHETSRLAYGRRMTTRPAHIAMFSIALHGHVNPSLEVIRELVARGHRVTYAIPPLLADKVAEAGAEPKLWNSTLPGPDADPEAWGSTLLDNVEPFLADAIQSLPQLAQAYEGDEPDLVLHDIASYTARVLGRRWEVPVISLSPCMVAWEGYEQEVGEPMWEEPRKTERGQAYYARFHAWLEENGITDHPDPFIGRPDRSLVLIPKALQPHADRVDETTYTFVGACQGDRTAEGDWARPEGAEKVVLVSLGSAFTKQPAFYRECVRAFGELPGWHTVLQVGRHVDPAELGDVPDNVEVRTWVPQLAILQQADLFVTHAGAGGSQEGLATATPMIAVPQAADQFGNADMLQGLGVARTLPTEEATAKALRTAALALVDDPEVAARLKEIQARMAQEGGTRRAADLIEAELAAARG"}}}}}}, "$insert": {"CARD_short_name": "mgtA"}}, "1050": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"172": {"$update": {"dna_sequence": {"$update": {"accession": "L12710.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Ii"}}, "3565": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BRO-1"}}, "1289": {"$update": {"ARO_description": "OKP-B-7 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1831": {"$update": {"dna_sequence": {"$update": {"accession": "AM051156.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-B-7"}}, "1288": {"$update": {"ARO_description": "OXA-82 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1846": {"$update": {"dna_sequence": {"$update": {"accession": "EU019536.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-82"}}, "514": {"$update": {"ARO_description": "LEN-10 is a beta-lactamase found in Klebsiella pneumoniae.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-10"}}, "3430": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-263"}}, "1579": {"$update": {"ARO_description": "QnrB9 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"$update": {"681": {"$update": {"dna_sequence": {"$update": {"accession": "EF526508.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB9"}}, "1578": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1773": {"$update": {"dna_sequence": {"$update": {"accession": "GQ390805.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-123"}}, "689": {"$update": {"ARO_description": "CTX-M-123 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1254": {"$update": {"dna_sequence": {"$update": {"accession": "JN790864.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-123"}}, "688": {"$update": {"ARO_description": "MOX-2 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1039": {"$update": {"dna_sequence": {"$update": {"accession": "AJ276453.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MOX-2"}}, "3431": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5627": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Acinetobacter haemolyticus CIP 64.3 = MTCC 9819"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-264"}}, "685": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1529": {"$update": {"dna_sequence": {"$update": {"accession": "JQ837239.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-239"}}, "684": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1475": {"$update": {"dna_sequence": {"$update": {"accession": "AF467948.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-37"}}, "687": {"$update": {"ARO_description": "APH(3')-Vc is a chromosomal-encoded aminoglycoside phosphotransferase in M. chalcea.", "model_sequences": {"$update": {"sequence": {"$update": {"470": {"$update": {"dna_sequence": {"$update": {"accession": "S81599.1"}}}}}}}}, "ARO_category": {"$update": {"36265": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'."}}}}}, "$insert": {"CARD_short_name": "APH(3')-Vc"}}, "686": {"$update": {"ARO_description": "OXA-162 is a beta-lactamase found in Enterobacteriaceae.", "model_sequences": {"$update": {"sequence": {"$update": {"967": {"$update": {"dna_sequence": {"$update": {"accession": "HM015773.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-162"}}, "681": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1072": {"$update": {"dna_sequence": {"$update": {"accession": "AY243512.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-120"}}, "680": {"$update": {"ARO_description": "CMY-54 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1036": {"$update": {"dna_sequence": {"$update": {"accession": "HM544039.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-54"}}, "683": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1587": {"$update": {"dna_sequence": {"$update": {"accession": "JQ733572.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-75"}}, "682": {"$update": {"ARO_description": "QnrS4 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"212": {"$update": {"dna_sequence": {"$update": {"accession": "FJ418153.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS4"}}, "4189": {"$insert": {"CARD_short_name": "ADC-115"}}, "3433": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-266"}}, "2818": {"$update": {"ARO_description": "Point mutation in the 23S rRNA of Streptomyces ambofaciens shown to confer resistance to macrolide type antibiotics.", "model_name": "Streptomyces ambofaciens 23S rRNA with mutation conferring resistance to macrolide antibiotics"}, "$insert": {"CARD_short_name": "Samb_23S_MAC"}}, "1226": {"$insert": {"CARD_short_name": "adeG"}}, "995": {"$update": {"ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}, "model_name": "MexG"}, "$insert": {"CARD_short_name": "MexG"}}, "3434": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-267"}}, "1240": {"$insert": {"CARD_short_name": "mphL"}}, "621": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"593": {"$update": {"dna_sequence": {"$update": {"accession": "M17124.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}, "37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "ErmF"}}, "873": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"954": {"$update": {"dna_sequence": {"$update": {"accession": "KJ775801.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-19"}}, "1224": {"$insert": {"CARD_short_name": "Erm(30)"}}, "3436": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-269"}}, "627": {"$update": {"ARO_description": "Point mutations that occurs in Escherichia coli rpoB resulting in resistance to rifampicin."}, "$insert": {"CARD_short_name": "Ecol_rpoB_RIF"}}, "3437": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-270"}}, "1888": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1102": {"$update": {"dna_sequence": {"$update": {"accession": "KM087858.1"}}}}}}}}, "ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-10"}}, "1222": {"$update": {"model_name": "FosA"}, "$insert": {"CARD_short_name": "FosA"}}, "4592": {"$insert": {"CARD_short_name": "EC-18"}}, "4389": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6764": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-28"}}, "4388": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6763": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-27"}}, "1221": {"$update": {"ARO_description": "OXA-231 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"8258": {"dna_sequence": {"partial": "0", "sequence": "ATGAAAAAATTTATACTTCCTATTCTCAGCATTTCTACTCTACTTTCTGTCAGTGCATGCTCATCTATTCAAACTAAATTTGAAGACACTTTTCATACTTCTAATCAGCAACATGAAAAAGCCATTAAAAGCTATTTTGATGAAGCTCAAACACAGGGTGTAATCATTATTAAAAAGGGAAAAAATATTAGTACCTATGGTAATAACCTGACACGAGCACATACAGAATATGTCCCTGCATCAACATTTAAGATGCTAAATGCCTTAATTGGACTAGAAAATCATAAAGCTACAACAACTGAGATTTTCAAATGGGACGGTAAAAAGAGATCTTATCCCATGTGGGAAAAAGATATGACTTTAGGTGATGCCATGGCACTTTCAGCAGTTCCTGTATATCAAGAACTTGCAAGACGGACTGGCTTAGACCTAATGCAAAAAGAAGTTAAACGGGTTGGTTTTGGTAATATGAACATTGGAACACAAGTTGATAACTTCTGGTTGGTTGGCCCCCTCAAGATTACACCAATACAAGAGGTTAATTTTGCCGATGATTTTGCAAATAATCGATTACCCTTTAAATTAGAGACTCAAGAAGAAGTTAAAAAAATGCTTCTGATTAAAGAATTCAATGGTAGTAAAATTTATGCAAAAAGCGGCTGGGGAATGGCTGTAACCCCTCAAGTAGGTTGGTTAACAGGTTGGGTAGAAAAATCTAATGGAGAAAAAGTTGCCTTTTCTCTAAACATAGAAATGAAGCAAGGAATGCCTGGTTCTATTCGTAATGAAATTACTTATAAATCATTAGAGAATTTAGGGATTATATAA", "fmax": "1021", "accession": "JQ326200.2", "fmin": "193", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter baumannii", "NCBI_taxonomy_id": "470", "NCBI_taxonomy_cvterm_id": "35507"}, "protein_sequence": {"accession": "AFG29918.1", "sequence": "MKKFILPILSISTLLSVSACSSIQTKFEDTFHTSNQQHEKAIKSYFDEAQTQGVIIIKKGKNISTYGNNLTRAHTEYVPASTFKMLNALIGLENHKATTTEIFKWDGKKRSYPMWEKDMTLGDAMALSAVPVYQELARRTGLDLMQKEVKRVGFGNMNIGTQVDNFWLVGPLKITPIQEVNFADDFANNRLPFKLETQEEVKKMLLIKEFNGSKIYAKSGWGMAVTPQVGWLTGWVEKSNGEKVAFSLNIEMKQGMPGSIRNEITYKSLENLGII"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-231"}}, "5629": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"8004": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "PLN-1"}}, "5628": {"$insert": {"CARD_short_name": "PLA-6"}}, "4383": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6758": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-22"}}, "4382": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-20"}}, "4381": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6756": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-2"}}, "4380": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-19"}}, "4387": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6762": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-26"}}, "5622": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7997": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "PFM-1"}}, "4385": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6760": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-24"}}, "4384": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-23"}}, "407": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1213": {"$update": {"dna_sequence": {"$update": {"accession": "KF297581.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-352"}}, "406": {"$update": {"ARO_description": "ACC-4 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"8175": {"dna_sequence": {"partial": "0", "sequence": "ATGCAGAACACATTGAAGCTGTTATCCGTGATTACCTGTCTGGCAGCAACTGTCCAAGGTGCTCTGGCTGCTAATATCGATGAGAGCAAAATTAAAGACACCGTTGATGACCTGATCCAGCCGCTGATGCAGAAGAATAATATTCCCGGTATGTCGGTCGCAGTGACCGTCAACGGTAAAAACTACATTTATAACTATGGGTTAGCGGCAAAACAGCCTCAGCAGCCGGTTACGGAAAATACGTTATTTGAAGTGGGTTCGCTGAGTAAAACGTTTGCTGCCACCTTGGCGTCCTATGCGCAGGTGAGCGGTAAGCTGTCTTTGGATCAAAGCGTTAGCCATTACGTTCCAGAGTTGCGTGGCAGCAGCTTTGACCACGTTAGCGTACTCAATGTGGGCACGCATACCTCAGGCCTACAGCTATTTATGCCGGAAGATATTAAAAATACCACACAGCTGATGGCTTATCTAAAAGCATGGAAACCTGCCGATGCGGCTGGAACCCATCGCGTTTATTCCAATATCGGTACTGGTTTGCTAGGGATGATTGCGGCGAAAAGTCTGGGTGTGAGCTATGAAGATGCGATTGAGAAAACCCTCCTTCCTCAGTTAGGCATGCATCACAGCTACTTGAAGGTTCCGGCTGACCAGATGGAAAACTATGCGTGGGGCTACAACAAGAAAGATGAGCCAGTGCACGGGAATATGGAGATTTTGGGTAACGAAGCTTATGGTATCAAAACCACCTCCAGCGACTTGTTACGCTACGTGCAAGCCAATATGGGGCAGTTAAAGCTTGATGCTAATGCCAAGATGCAACAGGCTCTGACAGCCACCCACACCGGCTATTTCAAATCGGGTGAGATTACTCAGGATCTGATGTGGGAGCAGCTGCCATATCCGGTTTCTCTGCCGAATTTGCTCACCGGTAACGATATGGCGATGACGAAAAGCGTGGCTACGCCGATTGTTCCGCCGTTACCGCCACAGGAAAATGTGTGGATTAATAAGACCGGATCAACTAACGGCTTCGGTGCCTATATTGCGTTTGTTCCTGCTAAGAAGATGGGGATCGTGATGCTGGCTAACAAAAACTACTCAATCGATCAGCGAGTGACGGTGGCGTATAAAATCCTGAGCTCATTGGAAGGGAATAAGTAG", "fmax": "3155", "accession": "EF504260.2", "fmin": "1994", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "ABP49606.1", "sequence": "MQNTLKLLSVITCLAATVQGALAANIDESKIKDTVDDLIQPLMQKNNIPGMSVAVTVNGKNYIYNYGLAAKQPQQPVTENTLFEVGSLSKTFAATLASYAQVSGKLSLDQSVSHYVPELRGSSFDHVSVLNVGTHTSGLQLFMPEDIKNTTQLMAYLKAWKPADAAGTHRVYSNIGTGLLGMIAAKSLGVSYEDAIEKTLLPQLGMHHSYLKVPADQMENYAWGYNKKDEPVHGNMEILGNEAYGIKTTSSDLLRYVQANMGQLKLDANAKMQQALTATHTGYFKSGEITQDLMWEQLPYPVSLPNLLTGNDMAMTKSVATPIVPPLPPQENVWINKTGSTNGFGAYIAFVPAKKMGIVMLANKNYSIDQRVTVAYKILSSLEGNK"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACC-4"}}, "405": {"$update": {"ARO_description": "OXA-202 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1454": {"$update": {"dna_sequence": {"$update": {"accession": "HQ734813.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-202"}}, "1372": {"$update": {"ARO_description": "Plasmid or integron-encoded nucleotidylylation of 2-deoxystreptamine aminoglycosides at the hydroxyl group at position 2'' in P. aeruginosa, K. pneumoniae, Morganella morganii, E. coli, S. typhimurium, C. freundii and A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"457": {"$update": {"dna_sequence": {"$update": {"accession": "AF078527.1"}}}}}}}}}, "$insert": {"CARD_short_name": "ANT(2'')-Ia"}}, "1375": {"$update": {"ARO_description": "CMY-11 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1857": {"$update": {"dna_sequence": {"$update": {"accession": "AF357599.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-11"}}, "402": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3343": {"$update": {"dna_sequence": {"$update": {"accession": "AF070999.1"}}}}}}}}}, "$insert": {"CARD_short_name": "tet(Y)"}}, "1377": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1966": {"$update": {"dna_sequence": {"$update": {"accession": "AM411407.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-60"}}, "400": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1308": {"$update": {"dna_sequence": {"$update": {"accession": "FJ666065.1"}}}}}}}}}, "$insert": {"CARD_short_name": "PDC-1"}}, "1379": {"$update": {"ARO_description": "OXA-313 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1376": {"$update": {"dna_sequence": {"$update": {"accession": "KF057030.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-313"}}, "1378": {"$update": {"ARO_description": "AAC(3)-IIc is a plasmid-encoded aminoglycoside acetyltransferase in E. coli and P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"616": {"$update": {"dna_sequence": {"$update": {"accession": "X54723.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(3)-IIc"}}, "4183": {"$insert": {"CARD_short_name": "ADC-107"}}, "409": {"$update": {"ARO_description": "Also known as vanRL, is a vanR variant found in the vanL gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"287": {"$update": {"dna_sequence": {"$update": {"accession": "EU250284.1"}}}}}}}}, "model_name": "vanR gene in vanL cluster", "ARO_name": "vanR gene in vanL cluster"}, "$insert": {"CARD_short_name": "vanR_in_vanL_cl"}}, "408": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"4501": {"$update": {"dna_sequence": {"$update": {"accession": "KF986261.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-380"}}, "3834": {"$update": {"ARO_description": "Mutations in Mycobacterium tuberculosis katG conferring resistance to prothionamide, an analogue of isoniazid.", "ARO_category": {"$update": {"43316": {"$update": {"category_aro_description": "Mutations associated with katG conferring resistance to prothionamide, an analogue of isoniazid. Like isoniazid, prothionamide targets lnhA."}}}}}, "$insert": {"CARD_short_name": "Mtub_katG_PTO"}}, "3836": {"$update": {"ARO_description": "Mutations in Mycobacterium tuberculosis ethA conferring resistance to isoniazid.", "ARO_category": {"$update": {"43318": {"$update": {"category_aro_description": "Mutations in ethA conferring resistance to isoniazid."}}}}}, "$insert": {"CARD_short_name": "Mtub_ethA_INH"}}, "4182": {"$insert": {"CARD_short_name": "ADC-106"}}, "3830": {"$update": {"ARO_description": "A subunit of the qac multidrug efflux pump in Vibrio cholerae.", "model_sequences": {"$update": {"sequence": {"$update": {"6142": {"$update": {"protein_sequence": {"$update": {"accession": "AAZ42322.1"}}}}}}}}, "ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}}, "$insert": {"CARD_short_name": "qacL"}}, "3831": {"$insert": {"CARD_short_name": "Spyo_ErmA_MLSb"}}, "3832": {"$insert": {"CARD_short_name": "FosB2"}}, "454": {"$update": {"ARO_description": "KPC-4 is a beta-lactamase found in Klebsiella pneumoniae.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-4"}}, "2148": {"$update": {"ARO_description": "Point mutation in Ureaplasma urealyticum resulting in fluoroquinolone resistance.", "model_name": "Ureaplasma urealyticum gyrB conferring resistance to fluoroquinolones", "ARO_name": "Ureaplasma urealyticum gyrB conferring resistance to fluoroquinolones"}, "$insert": {"CARD_short_name": "Uure_gyrB_FLO"}}, "3838": {"$update": {"ARO_description": "Mutations in Mycobacterium tuberculosis mshA conferring resistance to prothionamide, an analogue to isoniazid.", "ARO_category": {"$update": {"43322": {"$update": {"category_aro_description": "Mutations in mshA conferring resistance to prothionamide, an analogue of isoniazid."}}}}}, "$insert": {"CARD_short_name": "Mtub_mshA_PTO"}}, "3839": {"$update": {"ARO_description": "Predominant beta-lactamase in Mycolicibacterium smegmatis.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "43325": {"$update": {"category_aro_description": "A class A beta-lactamase in Mycolicibacterium smegmatis."}}}}}, "$insert": {"CARD_short_name": "blaS1"}}, "1345": {"$insert": {"CARD_short_name": "tet(K)"}}, "4031": {"$update": {"ARO_description": "PDC-183 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-183"}}, "2749": {"$insert": {"CARD_short_name": "lnuG"}}, "4033": {"$update": {"ARO_description": "PDC-306 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-306"}}, "4032": {"$update": {"ARO_description": "PDC-207 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-207"}}, "4035": {"$update": {"ARO_description": "PDC-117 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-117"}}, "4187": {"$insert": {"CARD_short_name": "ADC-113"}}, "4037": {"$update": {"ARO_description": "PDC-104 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-104"}}, "2748": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems)."}, "$insert": {"CARD_short_name": "oqxAB"}}, "4039": {"$update": {"ARO_description": "PDC-292 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-292"}}, "4038": {"$update": {"ARO_description": "PDC-173 is a class C beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-173"}}, "4186": {"$insert": {"CARD_short_name": "ADC-112"}}, "4846": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-511"}}, "4847": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-512"}}, "379": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1679": {"$update": {"dna_sequence": {"$update": {"accession": "GQ853679.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-148"}}, "378": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2126": {"$update": {"dna_sequence": {"$update": {"accession": "KP050491.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-214"}}, "5427": {"$insert": {"CARD_short_name": "PDC-297"}}, "4842": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-507"}}, "371": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"993": {"$update": {"dna_sequence": {"$update": {"accession": "U92041.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-8"}}, "373": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1810": {"$update": {"dna_sequence": {"$update": {"accession": "AY743435.1"}}}}}}}}, "ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-3"}}, "372": {"$update": {"ARO_description": "qacA is a subunit of the qac multidrug efflux pump.", "model_sequences": {"$update": {"sequence": {"$update": {"265": {"$update": {"dna_sequence": {"$update": {"accession": "AB566411.1"}}}}}}}}}, "$insert": {"CARD_short_name": "qacA"}}, "375": {"$update": {"ARO_description": "Multidrug resistance protein MdtH.", "model_sequences": {"$update": {"sequence": {"$update": {"4493": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}}}}}}}}, "$insert": {"CARD_short_name": "mdtH"}}, "374": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1391": {"$update": {"dna_sequence": {"$update": {"accession": "AF117745.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-21"}}, "377": {"$insert": {"CARD_short_name": "mepA"}}, "376": {"$update": {"ARO_description": "lnuC is a transposon-mediated nucleotidyltransferase found in Streptococcus agalactiae.", "model_sequences": {"$update": {"sequence": {"$update": {"110": {"$update": {"dna_sequence": {"$update": {"accession": "AY928180.1"}}}}}}}}}, "$insert": {"CARD_short_name": "lnuC"}}, "4739": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-80"}}, "5665": {"$insert": {"CARD_short_name": "SST-1"}}, "1987": {"$update": {"ARO_description": "QnrA1 is a plasmid-mediated quinolone resistance protein found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"403": {"$update": {"dna_sequence": {"$update": {"accession": "DQ831141.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrA1"}}, "5664": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"8039": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "SRT-3"}}, "393": {"$update": {"ARO_description": "QnrS5 is a plasmid-mediated quinolone resistance protein found in Aeromonas sobria.", "model_sequences": {"$update": {"sequence": {"$update": {"254": {"$update": {"dna_sequence": {"$update": {"accession": "HQ631377.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS5"}}, "392": {"$update": {"ARO_description": "TUS-1 is a chromosome-encoded beta-lactamase from Myroides odoratus and Myroides odoratimimus.", "model_sequences": {"$update": {"sequence": {"$update": {"1163": {"$update": {"dna_sequence": {"$update": {"accession": "AF441287.1"}}}}}}}}, "model_name": "TUS-1", "ARO_category": {"$update": {"41369": {"$update": {"category_aro_description": "TUS beta-lactamases are Class B beta-lactamases that can hydrolyze a variety of beta-lactams, such as cephems and carbapenems."}}}}}, "$insert": {"CARD_short_name": "TUS-1"}}, "391": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1577": {"$update": {"dna_sequence": {"$update": {"accession": "EF614235.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-2"}}, "390": {"$update": {"ARO_description": "Also known as vanSG, is a vanS variant found in the vanG gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"706": {"$update": {"dna_sequence": {"$update": {"accession": "DQ212986.1"}}}}}}}}, "model_name": "vanS gene in vanG cluster", "ARO_name": "vanS gene in vanG cluster"}, "$insert": {"CARD_short_name": "vanS_in_vanG_cl"}}, "397": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1611": {"$update": {"dna_sequence": {"$update": {"accession": "KF421160.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-357"}}, "396": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"4494": {"$update": {"dna_sequence": {"$update": {"accession": "FJ196385.1"}}}}}}}}}, "$insert": {"CARD_short_name": "sul3"}}, "395": {"$update": {"ARO_description": "Class A beta-lactamase found in Mycolicibacterium fortuitum.", "model_sequences": {"$update": {"sequence": {"$update": {"3317": {"$update": {"dna_sequence": {"$update": {"accession": "L25634.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "blaF"}}, "394": {"$update": {"ARO_description": "OXA-130 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1601": {"$update": {"dna_sequence": {"$update": {"accession": "EU547445.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-130"}}, "399": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1581": {"$update": {"dna_sequence": {"$update": {"accession": "KM087861.1"}}}}}}}}, "ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-16"}}, "398": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1574": {"$update": {"dna_sequence": {"$update": {"accession": "AF203816.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-71"}}, "5669": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-99"}}, "1560": {"$update": {"ARO_description": "OKP-B-20 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"8261": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTTATGTTCGCCTGTGCCTTATCTCCCTGATTGCCGCCCTGCCACTGGCGGTATTCGCCAGCCCTCAGCCGCTTGAGCAGATTAAAATCAGCGAAAGTCAGCTGGCGGGCCGTGTGGGCTATGTTGAAATGGATCTGGCCAGCGGCCGCACGCTGGCCGCCTGGCGCGCCAGTGAGCGCTTTCCGCTGATGAGCACCTTTAAAGTGCTGCTCTGCGGCGCGGTGCTGGCCCGGGTGGATGCCGGCGACGAACAGCTGGATCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCGGTCAGCGAAAAACACCTTGCCGACGGGATGACCGTTGGCGAACTCTGCGCCGCCGCCATCACCATGAGCGACAACACCGCCGGCAATCTGCTGTTGAAGATCGTCGGCGGCCCCGCGGGATTGACCGCTTTTCTGCGCCAGATCGGTGACAACGTCACCCGTCTTGACCGCTGGGAAACGGAACTCAATGAGGCGCTTCCCGGCGACGTGCGCGACACCACCACCCCGGCCAGCATGGCCACCACCCTGCGCAAGCTGCTAACCACCCCCTCTCTGAGCGCCCGTTCGCAGCAGCAGCTGCTGCAGTGGATGGTTGACGACCGGGTGGCCGGCCCGTTGATCCGCGCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAAACCGGGGCCGGTGAGCGGGGCTCACGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAAGCGGAGCGTATCGTGGTGATCTATCTGCGTGATACCGCGGCGACCATGGTCGAGCGTAACCAGCAGATCGCCGGGATAGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "885", "accession": "AM850922.2", "fmin": "24", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAP12360.2", "sequence": "MRYVRLCLISLIAALPLAVFASPQPLEQIKISESQLAGRVGYVEMDLASGRTLAAWRASERFPLMSTFKVLLCGAVLARVDAGDEQLDRRIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNTAGNLLLKIVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDVRDTTTPASMATTLRKLLTTPSLSARSQQQLLQWMVDDRVAGPLIRAVLPAGWFIADKTGAGERGSRGIVALLGPDGKAERIVVIYLRDTAATMVERNQQIAGIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-B-20"}}, "2308": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "40429": {"$update": {"category_aro_description": "Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin)."}}}}, "model_name": "Acinetobacter baumannii OprD conferring resistance to imipenem"}, "$insert": {"CARD_short_name": "Abau_OprD_IPM"}}, "5668": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-98"}}, "4729": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-66"}}, "4728": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-65"}}, "2301": {"$update": {"ARO_category": {"$update": {"40483": {"$update": {"category_aro_description": "Mutations to the YybT gene confers daptomycin resistance."}}}}}, "$insert": {"CARD_short_name": "Efae_YybT_DAP"}}, "2300": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}, "model_name": "Acinetobacter baumannii ampC beta-lactamase"}, "$insert": {"CARD_short_name": "Abau_ampC_BLA"}}, "2303": {"$update": {"ARO_description": "Transmembrane protein which expels bicyclomycin from the cell, leading to bicyclomycin resistance. Identified in Pseudomonas aeruginosa strains responsible for outbreaks in Brazil, often appearing with blaSPM-1, another bicyclomycin resistance gene."}, "$insert": {"CARD_short_name": "bcr-1"}}, "4726": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-63"}}, "2305": {"$insert": {"CARD_short_name": "Efae_gshF_DAP"}}, "4720": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-44"}}, "2307": {"$update": {"ARO_category": {"$update": {"40429": {"$update": {"category_aro_description": "Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin)."}}}}, "model_name": "carO"}, "$insert": {"CARD_short_name": "carO"}}, "4722": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-59"}}, "5527": {"$insert": {"CARD_short_name": "PDC-398"}}, "4696": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-70"}}, "453": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"400": {"$update": {"dna_sequence": {"$update": {"accession": "X95635.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "mtrE"}}, "2746": {"$update": {"ARO_accession": "3004082", "ARO_description": "AcrAD-TolC efflux pump system in E. coli from the resistance-nodulation-division family, was shown to participate in the efflux of aminoglycosides.", "ARO_category": {"$delete": ["35933", "35932", "35969"]}, "ARO_name": "AcrAD-TolC", "model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_id": "41184", "model_name": "AcrAD-TolC"}, "$insert": {"CARD_short_name": "AcrAD-TolC"}}, "1500": {"$update": {"ARO_description": "APH(6)-Ia is a chromosomal-encoded aminoglycoside phosphotransferase in S. griseus.", "model_sequences": {"$update": {"sequence": {"$update": {"94": {"$update": {"dna_sequence": {"$update": {"accession": "Y00459.1"}}}}}}}}, "ARO_category": {"$update": {"36290": {"$update": {"category_aro_description": "Phosphorylation of streptomycin on the hydroxyl group at position 6."}}}}}, "$insert": {"CARD_short_name": "APH(6)-Ia"}}, "471": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"998": {"$update": {"dna_sequence": {"$update": {"accession": "DQ834729.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-151"}}, "3745": {"$insert": {"CARD_short_name": "Mtub_23S_CAP"}}, "245": {"$update": {"ARO_description": "cmlA5 is a plasmid or transposon-encoded chloramphenicol exporter that is found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"695": {"$update": {"dna_sequence": {"$update": {"accession": "AY115475.1"}}}}}}}}}, "$insert": {"CARD_short_name": "cmlA5"}}, "244": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"988": {"$update": {"dna_sequence": {"$update": {"accession": "HE981194.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-164"}}, "247": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1569": {"$update": {"dna_sequence": {"$update": {"accession": "EF534736.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-158"}}, "246": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1476": {"$update": {"dna_sequence": {"$update": {"accession": "AB703103.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-126"}}, "241": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1263": {"$update": {"dna_sequence": {"$update": {"accession": "KM087833.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-30"}}, "240": {"$update": {"ARO_description": "Also known as vanRF, is a vanR variant found in the vanF gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"202": {"$update": {"dna_sequence": {"$update": {"accession": "AF155139.1"}}}}}}}}, "model_name": "vanR gene in vanF cluster", "ARO_name": "vanR gene in vanF cluster"}, "$insert": {"CARD_short_name": "vanR_in_vanF_cl"}}, "243": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1219": {"$update": {"dna_sequence": {"$update": {"accession": "M55547.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-9"}}, "242": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1232": {"$update": {"dna_sequence": {"$update": {"accession": "JX121119.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-152"}}, "4628": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-45"}}, "4629": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-46"}}, "249": {"$update": {"ARO_description": "Histidine protein kinase sensor Lipid A modification gene; part of a two-component system involved in polymyxin resistance that senses high extracellular Fe(2+).", "model_sequences": {"$update": {"sequence": {"$update": {"3375": {"$update": {"dna_sequence": {"$update": {"accession": "JQ340365.1"}}}}}}}}}, "$insert": {"CARD_short_name": "basS"}}, "248": {"$update": {"ARO_description": "OKP-B-9 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1998": {"$update": {"dna_sequence": {"$update": {"accession": "AM051159.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-B-9"}}, "2274": {"$update": {"ARO_category": {"$update": {"37697": {"$update": {"category_aro_description": "Non-erm 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides."}}}}}, "$insert": {"CARD_short_name": "RlmA(II)"}}, "2277": {"$insert": {"CARD_short_name": "mphM"}}, "2276": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3538": {"$update": {"dna_sequence": {"$update": {"accession": "X74219.1"}}}}}}}}}, "$insert": {"CARD_short_name": "Saur_ileS_MUP"}}, "2271": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3524": {"$update": {"dna_sequence": {"$update": {"accession": "JQ231224.1"}}, "protein_sequence": {"$update": {"accession": "AEY83581.1"}}}}}}}}, "model_name": "Staphylococcus aureus mupB conferring resistance to mupirocin"}, "$insert": {"CARD_short_name": "Saur_mupB_MUP"}}, "2270": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3523": {"$update": {"dna_sequence": {"$update": {"accession": "X75439.1"}}, "protein_sequence": {"$update": {"accession": "CAA53189.1"}}}}}}}}, "model_name": "Staphylococcus aureus mupA conferring resistance to mupirocin"}, "$insert": {"CARD_short_name": "Saur_mupA_MUP"}}, "2272": {"$update": {"ARO_description": "Cardiolipin synthase (cls) is an inner membrane protein involved in membrane synthesis and phosopholipid metabolism, with mutations to the gene being capable of conferring daptomycin resistance.", "model_name": "Enterococcus faecalis cls with mutation conferring resistance to daptomycin"}, "$insert": {"CARD_short_name": "Efae_cls_DAP"}}, "2404": {"$update": {"ARO_description": "Point mutation in Neisseria gonorrhoeae DNA gyrase subunit A. Decreases affinity between fluoroquinolone antibiotic molecule and gyrA, thereby conferring resistance to fluoroquinolone."}, "$insert": {"CARD_short_name": "Ngon_gyrA_FLO"}}, "2279": {"$insert": {"CARD_short_name": "Lmon_mprF"}}, "2278": {"$update": {"model_name": "Bifidobacterium bifidum ileS conferring resistance to mupirocin"}, "$insert": {"CARD_short_name": "Bbif_ileS_MUP"}}, "5543": {"$insert": {"CARD_short_name": "PDC-414"}}, "5206": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-914"}}, "1734": {"$update": {"ARO_description": "IND-4 is a beta-lactamase found in Chryseobacterium indologenes.", "model_sequences": {"$update": {"sequence": {"8199": {"dna_sequence": {"partial": "0", "sequence": "ATGAGGAAAAATGTTAGGATTTTTACTGTGTTGTCTCTGTTCTTAATTAATTTTTTTAATGCGCAGGCCCGTGACTTTGTAATTGAGCAGCCTTTTGGCAAACAACTTTATCTGTATAAAACCTTCGGAGTTTTTGACGGCAAAGAATATTCAACCAATGCGCTTTATCTGGTCACTAAAAAAGGAGTAGTCCTTTTTGATGTCCCATGGCAGAAAACCCAGTATCAAAGTCTTATGGATACGATAAAGAAACGTCATAACTTACCGGTGATCGCTGTATTTGCAACACATTCACACTCAGACAGAGCCGGAGACCTGAGTTTTTACAATAAAAAAGGCATCCCGACCTATGCCACGGCCAAAACCAATGAACTGCTGAAGAAAGAAGGAAAAGCAACTTCCAGTAAATTAACAAAGATTGGAAAGAAATATAAAATAGGCGGTGAAGAATTCACTGTAGACTTCTTAGGTGAAGGTCACACAGCAGATAACGTGGTGGTTTGGTTTCCAAAATATAACGTCCTGGACGGTGGCTGCTTAGTGAAAAGCAGTGCAGCAGTTGATCTTGGATATACAGGAGAAGCTAATGTAGAACAATGGCCGGCAACCATGAAAAAGCTGCAGGCTAAATACCCCTCCACTGCAAAGGTAATTCCGGGACACGACGAGTGGAAAGGCAACGACCATGTAAAACATACACTGGAGCTTTTAGATCAACAAAAACAGTAG", "fmax": "729", "accession": "AF219135.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Chryseobacterium indologenes", "NCBI_taxonomy_id": "253", "NCBI_taxonomy_cvterm_id": "36916"}, "protein_sequence": {"accession": "AAG29765.2", "sequence": "MRKNVRIFTVLSLFLINFFNAQARDFVIEQPFGKQLYLYKTFGVFDGKEYSTNALYLVTKKGVVLFDVPWQKTQYQSLMDTIKKRHNLPVIAVFATHSHSDRAGDLSFYNKKGIPTYATAKTNELLKKEGKATSSKLTKIGKKYKIGGEEFTVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSSAAVDLGYTGEANVEQWPATMKKLQAKYPSTAKVIPGHDEWKGNDHVKHTLELLDQQKQ"}}}}}, "ARO_category": {"$update": {"36199": {"$update": {"category_aro_description": "IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "IND-4"}}, "971": {"$update": {"ARO_description": "cmlA4 is a plasmid-encoded chloramphenicol exporter that is found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"656": {"$update": {"dna_sequence": {"$update": {"accession": "AF156486.1"}}}}}}}}}, "$insert": {"CARD_short_name": "cmlA4"}}, "2155": {"$insert": {"CARD_short_name": "Cacn_16S_TET"}}, "179": {"$update": {"ARO_description": "QnrA5 is a plasmid-mediated quinolone resistance protein found in Shewanella algae.", "model_sequences": {"$update": {"sequence": {"$update": {"588": {"$update": {"dna_sequence": {"$update": {"accession": "DQ058663.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrA5"}}, "178": {"$update": {"ARO_description": "Also known as vanHA, is a vanH variant in the vanA gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"3279": {"$update": {"dna_sequence": {"$update": {"accession": "M97297.1"}}}}}}}}, "model_name": "vanH gene in vanA cluster", "ARO_name": "vanH gene in vanA cluster"}, "$insert": {"CARD_short_name": "vanH_in_vanA_cl"}}, "177": {"$update": {"ARO_description": "From Lahey's list of beta-lactamases, no additional information available.", "model_sequences": {"$update": {"sequence": {"$update": {"2108": {"$update": {"dna_sequence": {"$update": {"accession": "LC031883.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-51"}}, "176": {"$update": {"ARO_description": "CMY-25 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1282": {"$update": {"dna_sequence": {"$update": {"accession": "EU515249.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-25"}}, "175": {"$update": {"ARO_description": "CTX-M-24 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1477": {"$update": {"dna_sequence": {"$update": {"accession": "AY143430.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-24"}}, "174": {"$update": {"ARO_description": "CfxA2 beta-lactamase is a class A beta-lactamase found in Prevotella intermedia.", "ARO_category": {"$update": {"39434": {"$update": {"category_aro_description": "CfxA beta-lactamases are class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "CfxA2"}}, "173": {"$update": {"ARO_description": "arr-4 is an integron-encoded ribosyltransferase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"524": {"$update": {"dna_sequence": {"$update": {"accession": "EF660562.1"}}}}}}}}}, "$insert": {"CARD_short_name": "arr-4"}}, "172": {"$insert": {"CARD_short_name": "OprN"}}, "171": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2038": {"$update": {"dna_sequence": {"$update": {"accession": "AF190693.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-78"}}, "170": {"$update": {"ARO_description": "IMP-19 is a beta-lactamase found in Aeromonas caviae.", "model_sequences": {"$update": {"sequence": {"$update": {"1014": {"$update": {"dna_sequence": {"$update": {"accession": "EF118171.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-19"}}, "2051": {"$update": {"ARO_description": "dfrA15 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae.", "model_sequences": {"$update": {"sequence": {"$update": {"2102": {"$update": {"dna_sequence": {"$update": {"accession": "KF534911.1"}}}}}}}}}, "$insert": {"CARD_short_name": "dfrA15"}}, "2050": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1459": {"$update": {"dna_sequence": {"$update": {"accession": "KF203105.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-331"}}, "2053": {"$update": {"ARO_description": "dfrA7 is an integron-encoded dihydrofolate reductase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"525": {"$update": {"dna_sequence": {"$update": {"accession": "FJ854362.1"}}}}}}}}}, "$insert": {"CARD_short_name": "dfrA7"}}, "2052": {"$update": {"ARO_description": "APH(3'')-Ic is a chromosomal-encoded aminoglycoside phosphotransferase in Mycolicibacterium fortuitum.", "model_sequences": {"$update": {"sequence": {"$update": {"276": {"$update": {"dna_sequence": {"$update": {"accession": "DQ336355.1"}}}}}}}}, "ARO_category": {"$update": {"36266": {"$update": {"category_aro_description": "Phosphorylation of streptomycin on the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "APH(3'')-Ic"}}, "2055": {"$update": {"ARO_description": "LRA-3 is a beta-lactamase isolated from soil samples in Alaska.", "model_sequences": {"$update": {"sequence": {"$update": {"1917": {"$update": {"dna_sequence": {"$update": {"accession": "EU408348.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LRA-3"}}, "2054": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"363": {"$update": {"dna_sequence": {"$update": {"accession": "AF313494.1"}}}}}}}}}, "$insert": {"CARD_short_name": "msrC"}}, "2057": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1559": {"$update": {"dna_sequence": {"$update": {"accession": "KF705208.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-179"}}, "4829": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-489"}}, "4534": {"$insert": {"CARD_short_name": "CTX-M-205"}}, "2058": {"$update": {"ARO_description": "pp-flo is a plasmid chloramphenicol exporter that is found in Photobacterium damselae subsp. piscicida.", "model_sequences": {"$update": {"sequence": {"$update": {"285": {"$update": {"dna_sequence": {"$update": {"accession": "D37826.1"}}}}}}}}}, "$insert": {"CARD_short_name": "pp-flo"}}, "4536": {"$insert": {"CARD_short_name": "CTX-M-207"}}, "4537": {"$insert": {"CARD_short_name": "CTX-M-208"}}, "4530": {"$insert": {"CARD_short_name": "CTX-M-201"}}, "4823": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-114x"}}, "4532": {"$insert": {"CARD_short_name": "CTX-M-203"}}, "4821": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-114v"}}, "1501": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1975": {"$update": {"dna_sequence": {"$update": {"accession": "GQ402541.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-49"}}, "853": {"$update": {"ARO_description": "OXA-160 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"8188": {"dna_sequence": {"partial": "0", "sequence": "ATGAAAAAATTTATACTTCCTATATTCAGCATTTCTATTCTAGTTTCTCTCAGTGCATGTTCATCTATTAAAACTAAATCTGAAGATAATTTTCATATTTCTTCTCAGCAACATGAAAAAGCTATTAAAAGCTATTTTGATGAAGCTCAAACACAGGGTGTAATTATTATTAAAGAGGGTAAAAATCTTAGCACCTATGGTAATGCTCTTGCACGAGCAAATAAAGAATATGTCCCTGCATCAACATTTAAGATGCTAAATGCTTTAATCGGGCTAGAAAATCATAAAGCAACAACAAATGAGATTTTCAAATGGGATGGTAAAAAAAGAACTTATCCTATGTGGGAGAAAGATATGACTTTAGGTGAGGCAATGGCATTGTCAGCAGTTCCAGTATATCAAGAGCTTGCAAGACGGACTGGCCTAGAGCTAATGCAGAAAGAAGTAAAGCGGGTTAATTTTGGAAATACAAATATTGGAACACAGGTCGATAATTTTTGGTTAGTTGGCCCCCTTAAAATTACACCAGTACAAGAAGTTAATTTTGCCGATGACCTTGCACATAACCGATTACCTTTTAAATTAGAAACTCAAGAAGAAGTTAAAAAAATGCTTCTAATTAAAGAAGTAAATGGTAGTAAGATTTATGCAAAAAGTGGATGGGGAATGGGTGTTACTTCACAGGTAGGTTGGTTGACTGGTTGGGTGGAGCAAGCTAATGGAAAAAAAATCCCCTTTTCGCTCAACTTAGAAATGAAAGAAGGAATGTCTGGTTCTATTCGTAATGAAATTACTTATAAGTCGCTAGAAAATCTTGGAATCATTTAA", "fmax": "2023", "accession": "GU199038.2", "fmin": "1195", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter baumannii", "NCBI_taxonomy_id": "470", "NCBI_taxonomy_cvterm_id": "35507"}, "protein_sequence": {"accession": "ADB28891.1", "sequence": "MKKFILPIFSISILVSLSACSSIKTKSEDNFHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTSQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-160"}}, "1506": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1017": {"$update": {"dna_sequence": {"$update": {"accession": "JX440355.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-12"}}, "1507": {"$update": {"ARO_description": "smeA is the membrane fusion protein of the smeABC multidrug efflux complex in Stenotrophomonas maltophilia.", "model_sequences": {"$update": {"sequence": {"$update": {"496": {"$update": {"dna_sequence": {"$update": {"accession": "AF173226.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "smeA"}}, "1504": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1775": {"$update": {"dna_sequence": {"$update": {"accession": "KF564648.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-108"}}, "651": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"59": {"$update": {"dna_sequence": {"$update": {"accession": "HM140977.1"}}}}}}}}}, "$insert": {"CARD_short_name": "Saur_mprF"}}, "942": {"$update": {"ARO_description": "OXA-104 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1122": {"$update": {"dna_sequence": {"$update": {"accession": "EF581285.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-104"}}, "3526": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-459"}}, "3527": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-460"}}, "3524": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-457"}}, "3525": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-458"}}, "3522": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-453"}}, "3523": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-455"}}, "3520": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-451"}}, "3521": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-452"}}, "3528": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-461"}}, "3529": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "model_sequences": {"$update": {"sequence": {"$update": {"5724": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Aliarcobacter butzleri"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-464"}}, "4655": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-42"}}, "4793": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7168": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-C-1"}}, "4654": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-41"}}, "4657": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-44"}}, "1977": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"541": {"$update": {"dna_sequence": {"$update": {"accession": "L29510.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Ik"}}, "4656": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-43"}}, "2796": {"$update": {"model_sequences": {"$update": {"sequence": {"8185": {"dna_sequence": {"partial": "0", "sequence": "ATGAAACCCGTGGCAATGACCCTGCTGGCGCTGGCATTGTCCGGCTGCTCGCTGGCGCCCACCCATGAGCGCCCCGCGGCGCCGGTGCCGGCGCAGTACGACACGCCGGCGCAGCCCGGCCAGGCCGCCGCGCCGCAGGACTGGCGCGCCTATTTCAACGATCCGGCGCTGCAGGCCTGGATCGCGGCCGCGCTGGCCAACAACCGCGACCTGCGCGTGGCGGCGCTGCGCATCGAGGAAGCGCGCGCGCTGTACGGCGTGCAGCAATCCGAACGCCTGCCGGCCATCGACGCCAGCGGCGAATTCAGCCGCGGCCGCGCGACCGAGCCGGGCCAGCCGCGCACGCCGGTGTCCAACCGCTACCGCGCGGCCGTCGGCATCACCGCGTTCGAGCTGGACTTCTTCGGCCGGGTGCGGAGCCTGTCGGACGCCGCGCTGGCGCGCTACCTGGCCAGCGAGGAAGCGCACCGCGCCGCCACGCTGGCGCTGGTGGCGGAGACGGCGACGGCCTACTTCAACCAGCGTTCGCTGGCCGAGCAACTGCGCCTGACCGACGACACGCTGGCGCTGCGCGAGACCACGCTCAAGCTGACCCAGCGCCGCTACGACGCCGGGCTGGAAACCGCCATCGGCCTGCGCACCGCGCAGATGCTGGTGGAAAGCTCGCGCGCCACGCGCGCCGAGCTGACCCGCGAGGCCAGCCTGGCGCGGCACGCGCTGGGCCTGCTGGCCGGCGATTTCGCGCTGCCGCTCGGCGTCGACCCTACGCCGCTGGAAAGCCAGAGCCTGACGCCGCTGGCGGCGGGGCTGCCGTCCGAACTGCTGACGCGCCGCCCCGACCTGCGCCAGGCAGAGCAGGCGCTGCGCGCGGCCAACGCCGACATCGGCGCGGCGCGCGCGGCGTTCTTCCCGTCGGTGCAGCTGACCACGGACATCGGCACCACCGCCGACCGCTTCTCGGATCTGTTCAGCGGCGGCACCGGCGGCTGGAGCTTCGCGCCGCGCCTGACGCTGCCGATCTTCAACGCCGGCCGCAACCGCGCCAACCTGTCGCTGGCCGAGACCCGCAAGCACATCGCGGTGGCCCAGTACGAAGGCAGCATCCAGGCCGCGTTCCGCGACGTGGCCGACGCGCTGTCGGCGCGCGACGCGCTGCGCGACCAGATCGAGGCCCAGCGCAAGGTGCGCGACGCCGACCGCGAACGCCAGCGGCTGGCCGAGCGGCGTTATGCGCGCGGGGTGGCGAACTACCTGGAGATGCTGGAGGCCCAGCGCAGCCTGTTCGAGTCGGAACAGGAATTCATCCGGCTGCAGCAGCGCCGGCTGGTCAACGCGGTGGATCTGTACAAGGCGCTGGGCGGCTGGGACGACGGCTCATCGCCGGCGTCCTGA", "fmax": "23990", "accession": "AFRQ01000061.1", "fmin": "22598", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Achromobacter insuavis AXX-A", "NCBI_taxonomy_id": "1003200", "NCBI_taxonomy_cvterm_id": "41271"}, "protein_sequence": {"accession": "EGP45230.2", "sequence": "MKPVAMTLLALALSGCSLAPTHERPAAPVPAQYDTPAQPGQAAAPQDWRAYFNDPALQAWIAAALANNRDLRVAALRIEEARALYGVQQSERLPAIDASGEFSRGRATEPGQPRTPVSNRYRAAVGITAFELDFFGRVRSLSDAALARYLASEEAHRAATLALVAETATAYFNQRSLAEQLRLTDDTLALRETTLKLTQRRYDAGLETAIGLRTAQMLVESSRATRAELTREASLARHALGLLAGDFALPLGVDPTPLESQSLTPLAAGLPSELLTRRPDLRQAEQALRAANADIGAARAAFFPSVQLTTDIGTTADRFSDLFSGGTGGWSFAPRLTLPIFNAGRNRANLSLAETRKHIAVAQYEGSIQAAFRDVADALSARDALRDQIEAQRKVRDADRERQRLAERRYARGVANYLEMLEAQRSLFESEQEFIRLQQRRLVNAVDLYKALGGWDDGSSPAS"}}}}}}, "$insert": {"CARD_short_name": "OprZ"}}, "2697": {"$insert": {"CARD_short_name": "EdeQ"}}, "4651": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-38"}}, "2695": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}, "model_name": "MexCD-OprJ with type B NfxB mutation"}, "$insert": {"CARD_short_name": "Paer_NfxBb_MULT"}}, "2694": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}, "model_name": "MexCD-OprJ with type A NfxB mutation"}, "$insert": {"CARD_short_name": "Paer_NfxBa_MULT"}}, "2693": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Type_B_NfxB"}}, "1975": {"$update": {"ARO_description": "blt is an MFS efflux pump that confers resistance to multiple drugs such as rhodamine and acridine dyes, and fluoroquinolone antibiotics.", "model_sequences": {"$update": {"sequence": {"$update": {"710": {"$update": {"dna_sequence": {"$update": {"accession": "L32599.1"}}}}}}}}, "ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "blt"}}, "2691": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Type_A_NfxB"}}, "4650": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7025": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-37"}}, "2405": {"$update": {"ARO_description": "Point mutations in Neisseria gonorrhoeae parC protein that confer resistance to fluoroquinolone by reducing affinity to antibiotic binding site.", "model_name": "Neisseria gonorrhoeae parC conferring resistance to fluoroquinolones"}, "$insert": {"CARD_short_name": "Ngon_parC_FLO"}}, "4653": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-40"}}, "1973": {"$update": {"ARO_description": "TEM-111 is a beta-lactamase found in E. coli and P. mirabilis.", "model_sequences": {"$update": {"sequence": {"$update": {"1643": {"$update": {"dna_sequence": {"$update": {"accession": "AF468003.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-111"}}, "4800": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7175": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "ORN-6"}}, "4652": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-39"}}, "1661": {"$update": {"ARO_description": "CARB-8 is a beta-lactamase found in Oligella urethralis.", "model_sequences": {"$update": {"sequence": {"$update": {"1894": {"$update": {"dna_sequence": {"$update": {"accession": "AY178993.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-8"}}, "1972": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1754": {"$update": {"dna_sequence": {"$update": {"accession": "GQ853680.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-149"}}, "1971": {"$update": {"ARO_description": "dfrB2 is an integron-encoded dihydrofolate reductase found in an uncultured bacterium from a wastewater treatment plant."}, "$insert": {"CARD_short_name": "dfrB2"}}, "1748": {"$update": {"ARO_description": "LsaC is an ABC-F subfamily protein expressed in Streptococcus agalactiae. It confers resistance to lincomycin, clindamycin, dalfopristin, and tiamulin.", "model_sequences": {"$update": {"sequence": {"$update": {"76": {"$update": {"dna_sequence": {"$update": {"accession": "HM990671.1"}}}}}}}}}, "$insert": {"CARD_short_name": "lsaC"}}, "1970": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2025": {"$update": {"dna_sequence": {"$update": {"accession": "AY259119.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-44"}}, "1968": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2125": {"$update": {"dna_sequence": {"$update": {"accession": "KP050494.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-189"}}, "1969": {"$insert": {"CARD_short_name": "tet(35)"}}, "1618": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"809": {"$update": {"dna_sequence": {"$update": {"accession": "KF460532.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-362"}}, "1619": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1909": {"$update": {"dna_sequence": {"$update": {"accession": "AJ272109.1"}}}}}}}}}, "$insert": {"CARD_short_name": "L1_BLA"}}, "1616": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1589": {"$update": {"dna_sequence": {"$update": {"accession": "KJ461948.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-152"}}, "1617": {"$update": {"ARO_description": "VanE is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Ser, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity in Enterococcus faecalis.", "model_sequences": {"$update": {"sequence": {"$update": {"216": {"$update": {"dna_sequence": {"$update": {"accession": "FJ872411.1"}}}}}}}}, "ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "vanE"}}, "1614": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1325": {"$update": {"dna_sequence": {"$update": {"accession": "JN935136.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-194"}}, "1615": {"$update": {"ARO_description": "APH(2'')-IIa is a chromosomal-encoded aminoglycoside phosphotransferase in E. faecium and E. coli.", "model_sequences": {"$update": {"sequence": {"$update": {"696": {"$update": {"dna_sequence": {"$update": {"accession": "AF337947.1"}}}}}}}}, "ARO_category": {"$update": {"36267": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 2''."}}}}}, "$insert": {"CARD_short_name": "APH(2'')-IIa"}}, "1960": {"$update": {"ARO_description": "smeB is the inner membrane multidrug exporter of the efflux complex smeABC in Stenotrophomonas maltophilia.", "model_sequences": {"$update": {"sequence": {"$update": {"521": {"$update": {"dna_sequence": {"$update": {"accession": "AF173226.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "smeB"}}, "1613": {"$update": {"ARO_description": "CMY-38 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1021": {"$update": {"dna_sequence": {"$update": {"accession": "AM931008.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-38"}}, "1610": {"$update": {"ARO_description": "OXA-74 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1305": {"$update": {"dna_sequence": {"$update": {"accession": "AJ854182.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-74"}}, "1611": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1565": {"$update": {"dna_sequence": {"$update": {"accession": "KF481967.1"}}}}}}}}}, "$insert": {"CARD_short_name": "SME-4"}}, "4845": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-510"}}, "1966": {"$insert": {"CARD_short_name": "lmrA"}}, "1749": {"$update": {"ARO_description": "IMP-18 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"912": {"$update": {"dna_sequence": {"$update": {"accession": "JN596991.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-18"}}, "2873": {"$update": {"ARO_category": {"$update": {"36261": {"$update": {"category_aro_description": "Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini."}}}}}, "$insert": {"CARD_short_name": "catV"}}, "2872": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-93"}}, "2871": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-92"}}, "2870": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-91"}}, "2877": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-535"}}, "2876": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-436"}}, "2875": {"$insert": {"CARD_short_name": "sul4"}}, "2874": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACI-1"}}, "2878": {"$insert": {"CARD_short_name": "almG"}}, "3217": {"$update": {"ARO_description": "A chromosomal macrolide phosphotransferase identified from Bacillus subtilis."}, "$insert": {"CARD_short_name": "mphK"}}, "3355": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5535": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "ARO_category": {"$update": {"36261": {"$update": {"category_aro_description": "Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini."}}}}}, "$insert": {"CARD_short_name": "Ecol_catII"}}, "3357": {"$update": {"ARO_category": {"$update": {"36261": {"$update": {"category_aro_description": "Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini."}}}}}, "$insert": {"CARD_short_name": "catA4"}}, "3356": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-296"}}, "3351": {"$insert": {"CARD_short_name": "Erm(O)-lrm"}}, "3353": {"$insert": {"CARD_short_name": "Cdif_23S_MULT"}}, "3359": {"$update": {"ARO_description": "NBU2-encoded resistance gene. An MefE homolog in Bacteroides species. Macrolide efflux MFS transporter."}, "$insert": {"CARD_short_name": "Mef(En2)"}}, "3358": {"$update": {"ARO_category": {"$update": {"36261": {"$update": {"category_aro_description": "Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini."}}}}}, "$insert": {"CARD_short_name": "catA8"}}, "5492": {"$insert": {"CARD_short_name": "PDC-362"}}, "5449": {"$insert": {"CARD_short_name": "PDC-319"}}, "5448": {"$insert": {"CARD_short_name": "PDC-318"}}, "5443": {"$insert": {"CARD_short_name": "PDC-312"}}, "5442": {"$insert": {"CARD_short_name": "PDC-311"}}, "5441": {"$insert": {"CARD_short_name": "PDC-310"}}, "5440": {"$insert": {"CARD_short_name": "PDC-31"}}, "5447": {"$insert": {"CARD_short_name": "PDC-317"}}, "5446": {"$insert": {"CARD_short_name": "PDC-316"}}, "5445": {"$insert": {"CARD_short_name": "PDC-315"}}, "5444": {"$insert": {"CARD_short_name": "PDC-314"}}, "1768": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1185": {"$update": {"dna_sequence": {"$update": {"accession": "KJ020573.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-144"}}, "1769": {"$update": {"ARO_description": "CTX-M-115 is a beta-lactamase found in Acinetobacter baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"766": {"$update": {"dna_sequence": {"$update": {"accession": "KJ911020.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-115"}}, "1762": {"$update": {"ARO_description": "aadA16 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in E. coli, V. cholerae and K. pneumoniae.", "model_sequences": {"$update": {"sequence": {"8226": {"dna_sequence": {"partial": "0", "sequence": "ATGAGCAACGCAGTGCCCGCCGAGATTTCGGTACAGCTATCACAGGCACTCAACGTCATCGAGCGTCATCTGGGATCGACGTTGCTGGCCGTGCATTTGTACGGCTCTGCACTCGACGGTGGCCTGAAGCCATGCAGTGATATTGATTTGCTGGTTACTGTGACTGCACAGCTCGATGAGACTGTGCGGCAGGCTCTGTTCGTAGATTTCCTGGAAGTTTCCGCTTCTCCCGGCCAAAGTGAAGCTCTCCGTGCCTTGGAAGTTACCATCGTCGTGTACGGCGATGTTGCTCCTTGGCGTTATCTAGCCAGACGGGAACTGCAATTCGGGGAGTGGCAGCGCAAGGACATTCTTGCGGGCATCTTCGAGCCCGCGACAACCGATGTTGATCTGGCTATTCTGCTAACTAAAGCAAGGCAACACAGCCTTGCCTTGGCAGGTTCGGCCGCGGAAGATTTCTTCAACTCAGTCCCGGAAAGCGATCTATTCAAAGCACTGGCCGACACCTTGAAACTATGGAACTCACAACCGGATTGGGCAGGCGACGAGCGGAATGTAGTGCTTACTTTGTCTCGCATTTGGTACAGCGCAGCAACCGGCAAGATCGCGCCGAAGGATGTAGCTGCCAACTGGGTAATGGAACGCCTGCCCGTCCAACATCAGCCCGTGCTGCTTGAAGCCCAGCAGGCTTACCTTGGACAAGGGATGGATTGCTTGGCCTCACGCGCTGATCAGTTGACTGCGTTCATTTACTTTGTGAAGCACGAAGCCGCCAGTCTGCTCGGCTCCACGCCAATGATGTCTAACAGTTCATTCAAGCCGACGCCGCTTCGCGGCGCAGCTTAA", "fmax": "4042", "accession": "EU675686.2", "fmin": "3196", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "ACF17980.1", "sequence": "MSNAVPAEISVQLSQALNVIERHLGSTLLAVHLYGSALDGGLKPCSDIDLLVTVTAQLDETVRQALFVDFLEVSASPGQSEALRALEVTIVVYGDVAPWRYLARRELQFGEWQRKDILAGIFEPATTDVDLAILLTKARQHSLALAGSAAEDFFNSVPESDLFKALADTLKLWNSQPDWAGDERNVVLTLSRIWYSAATGKIAPKDVAANWVMERLPVQHQPVLLEAQQAYLGQGMDCLASRADQLTAFIYFVKHEAASLLGSTPMMSNSSFKPTPLRGAA"}}}}}, "ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "aadA16"}}, "1763": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"777": {"$update": {"dna_sequence": {"$update": {"accession": "JF703135.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "NDM-2"}}, "1760": {"$update": {"ARO_description": "QnrB35 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"$update": {"555": {"$update": {"dna_sequence": {"$update": {"accession": "JN173057.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB35"}}, "1761": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1133": {"$update": {"dna_sequence": {"$update": {"accession": "KF297580.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-351"}}, "1766": {"$update": {"ARO_description": "VIM-14 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1082": {"$update": {"dna_sequence": {"$update": {"accession": "AY635904.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-14"}}, "1767": {"$update": {"ARO_description": "OKP-A-16 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1287": {"$update": {"dna_sequence": {"$update": {"accession": "FJ755840.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-A-16"}}, "1764": {"$update": {"ARO_description": "OXA-97 is a beta-lactamase found in A. baumannii.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-97"}}, "1765": {"$update": {"ARO_description": "OXA-56 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1056": {"$update": {"dna_sequence": {"$update": {"accession": "AY445080.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-56"}}, "1142": {"$update": {"ARO_description": "dfrA17 is an integron-encoded dihydrofolate reductase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"291": {"$update": {"dna_sequence": {"$update": {"accession": "DQ838665.1"}}}}}}}}}, "$insert": {"CARD_short_name": "dfrA17"}}, "1143": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"894": {"$update": {"dna_sequence": {"$update": {"accession": "X75562.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-7"}}, "1140": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1197": {"$update": {"dna_sequence": {"$update": {"accession": "KJ207204.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-86"}}, "1141": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1525": {"$update": {"dna_sequence": {"$update": {"accession": "HM488990.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-169"}}, "1146": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1400": {"$update": {"dna_sequence": {"$update": {"accession": "AM941159.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-156"}}, "1147": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1859": {"$update": {"dna_sequence": {"$update": {"accession": "HQ650104.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-63"}}, "1144": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"4415": {"$update": {"dna_sequence": {"$update": {"accession": "AF015628.1"}}}}}}}}, "model_name": "vgbB", "ARO_category": {"$update": {"37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "vgbB"}}, "1145": {"$update": {"ARO_description": "CTX-M-124 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1333": {"$update": {"dna_sequence": {"$update": {"accession": "JQ429324.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-124"}}, "1148": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"890": {"$update": {"dna_sequence": {"$update": {"accession": "KF460533.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-363"}}, "1149": {"$update": {"ARO_description": "AER-1 is a beta-lactamase found in Aeromonas hydrophila.", "model_sequences": {"$update": {"sequence": {"$update": {"901": {"$update": {"dna_sequence": {"$update": {"accession": "U14748.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "AER-1"}}, "5508": {"$insert": {"CARD_short_name": "PDC-378"}}, "5509": {"$insert": {"CARD_short_name": "PDC-379"}}, "5506": {"$insert": {"CARD_short_name": "PDC-375"}}, "5507": {"$insert": {"CARD_short_name": "PDC-377"}}, "5504": {"$insert": {"CARD_short_name": "PDC-373"}}, "5505": {"$insert": {"CARD_short_name": "PDC-374"}}, "5502": {"$insert": {"CARD_short_name": "PDC-371"}}, "5503": {"$insert": {"CARD_short_name": "PDC-372"}}, "5500": {"$insert": {"CARD_short_name": "PDC-37"}}, "5501": {"$insert": {"CARD_short_name": "PDC-370"}}, "692": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1646": {"$update": {"dna_sequence": {"$update": {"accession": "EF136376.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-159"}}, "693": {"$update": {"ARO_description": "OXA-22 is a beta-lactamase found in Ralstonia pickettii.", "model_sequences": {"$update": {"sequence": {"8222": {"dna_sequence": {"partial": "0", "sequence": "ATGAAACGCCGCCACGCCGCCATCGGCGCCCTGCTTGCCGCGCTTGCCACCTTTGCCCACGCCGAGCACCCGATCTGCACGATCGTGGCCGATGCCGCCACGGGCAAGGCCGTCTTGCATGAAGGCAAGTGCGACGAGCGCGTGACGCCCGCTTCCACCTTCAAGCTGGCGCTGGCCGTCATGGGCTTCGACCACGGCTTCCTCAAAGATGAGCACACCCCGGTTGAGCACTTCAGGCACGGTGACCCCGACTGGGGCGGCGAAGCCTGGCACCAGCCGATCGACCCGGCGCTGTGGCTCAAGTATTCGGTGGTCTGGTATTCGCAGCGCATTACGCATGCGATGGGCGCGCAGACCTTCCAGGCCTACGTGCGCAAGCTTGGCTACGGCAACATGGATGTGAGCGGCGATCCGGGCAAGAACAACGGCATGGACCGCTCGTGGATCACCTCGTCGCTGAAGATTTCGCCGGAAGAGCAAGTCGGCTTGATGCGCCGGATCGTCAACCGGCAGTTGCCGGTGTCGGCGCACACCTACGAGATGCTCGACCGTACCGTGCAGACCTGGCAGGTGCCCGGCGGCTGGGCGGTGCAGGGCAAGACGGGCACTGCCGGTCCGGCGCCGGGCAACACGTCGCCCGATGGCACGTGGGATCAGGCACACGCTTACGGCTGGTTTGTCGGCTGGGCCAGGAAGGGCGACAAGACCTACGTATTCGCCAACCTGATCCAGGACGACAAGGTTGAGCCGACGTCGGGCGGTATCCGCTCGCGCGATGCGCTGTTTGCTCGCCTGTCGGAAGTGCTGGCCTTTGCTGGGCACTGA", "fmax": "1776", "accession": "AF064820.3", "fmin": "951", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Ralstonia pickettii", "NCBI_taxonomy_id": "329", "NCBI_taxonomy_cvterm_id": "36921"}, "protein_sequence": {"accession": "AAD12233.1", "sequence": "MKRRHAAIGALLAALATFAHAEHPICTIVADAATGKAVLHEGKCDERVTPASTFKLALAVMGFDHGFLKDEHTPVEHFRHGDPDWGGEAWHQPIDPALWLKYSVVWYSQRITHAMGAQTFQAYVRKLGYGNMDVSGDPGKNNGMDRSWITSSLKISPEEQVGLMRRIVNRQLPVSAHTYEMLDRTVQTWQVPGGWAVQGKTGTAGPAPGNTSPDGTWDQAHAYGWFVGWARKGDKTYVFANLIQDDKVEPTSGGIRSRDALFARLSEVLAFAGH"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-22"}}, "1544": {"$update": {"ARO_description": "dfrE is a chromosome-encoded dihydrofolate reductase found in Enterococcus faecalis."}, "$insert": {"CARD_short_name": "dfrE"}}, "691": {"$update": {"ARO_description": "Also known as vanRE, is a vanR variant found in the vanE gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"167": {"$update": {"dna_sequence": {"$update": {"accession": "FJ872411.1"}}}}}}}}, "model_name": "vanR gene in vanE cluster", "ARO_name": "vanR gene in vanE cluster"}, "$insert": {"CARD_short_name": "vanR_in_vanE_cl"}}, "696": {"$update": {"ARO_description": "CfrA is a chloramphenicol-florfenicol resistance gene and methyltransferase enzyme. Methylation of position 8 of A2503 in 23S rRNA confers resistance to chloramphenicol antibiotics first identified by Schwarz 2000 as cfr from Mammaliicoccus sciuri. Additional Oxazolidinone resistance mediated by the cfr gene in a human isolated was first reported from Colombia in linezolid- and methicillin-resistant Staphylococcus aureus.", "model_sequences": {"$update": {"sequence": {"$update": {"4584": {"$update": {"dna_sequence": {"$update": {"accession": "AM408573.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}}}}, "$insert": {"CARD_short_name": "cfrA"}}, "697": {"$update": {"ARO_description": "Erm42 confers MLSb phenotype in Pasteurella multocida.", "model_sequences": {"$update": {"sequence": {"$update": {"11": {"$update": {"dna_sequence": {"$update": {"accession": "FR734406.1"}}}}}}}}}, "$insert": {"CARD_short_name": "Erm(42)"}}, "694": {"$update": {"ARO_description": "CTX-M-40 is a beta-lactamase found in Escherichia coli."}, "$insert": {"CARD_short_name": "CTX-M-40"}}, "695": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"783": {"$update": {"dna_sequence": {"$update": {"accession": "JN714478.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-66"}}, "5510": {"$insert": {"CARD_short_name": "PDC-38"}}, "698": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1957": {"$update": {"dna_sequence": {"$update": {"accession": "KC900516.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-205"}}, "699": {"$update": {"ARO_description": "QnrS9 is a plasmid-mediated quinolone resistance protein found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"632": {"$update": {"dna_sequence": {"$update": {"accession": "KF732714.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS9"}}, "1548": {"$update": {"ARO_description": "APH(3')-Vb is a chromosomal-encoded aminoglycoside phosphotransferase in Streptomyces ribosidificus.", "model_sequences": {"$update": {"sequence": {"$update": {"407": {"$update": {"dna_sequence": {"$update": {"accession": "M22126.1"}}}}}}}}, "ARO_category": {"$update": {"36265": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'."}}}}}, "$insert": {"CARD_short_name": "APH(3')-Vb"}}, "1549": {"$update": {"model_sequences": {"$update": {"sequence": {"8354": {"dna_sequence": {"partial": "0", "sequence": "ATGAACAAAAATATAAAATATTCTCAAAACTTTTTAACGAGTGAAAAAGTACTCAACCAAATAATAAAACAATTGAATTTAAAAGAAACCGATACCGTTTACGAAATTGGAACAGGTAAAGGGCATTTAACGACGAAACTGGCTAAAATAAGTAAACAGGTAACGTCTATTGAATTAGACAGTCATCTATTCAACTTATCGTCAGAAAAATTAAAACTGAATACTCGTGTCACTTTAATTCACCAAGATATTCTACAGTTTCAATTCCCTAACAAACAGAGGTATAAAATTGTTGGGAGTATTCCTTACAATTTAAGCACACAAATTATTAAAAAAGTGGTTTTTGAAAGCCGTGCGTCTGACATCTATCTGATTGTTGAAGAAGGATTCTACAAGCGTACCTTGGATATTCACCGAACACTAGGGTTGCTCTTGCACACTCAAGTCTCGATTCAGCAATTGCTTAAGCTGCCAGCGGAATGCTTTCATCCTAAACCAAAAGTAAACAGTGTCTTAATAAAACTTACCCGCCATACCACAGATGTTCCAGATAAATATTGGAAGCTATATACGTACTTTGTTTCAAAATGGGTCAATCGAGAATATCGTCAACTGTTTACTAAAAATCAGTTTCATCAAGCAATGAAACACGCCAAAGTAAACAATTTAAGTACCATTACTTATGAGCAAGTATTGTCTATTTTTAATAGTTATCTATTATTTAACGGGAGGAAATTAATTCTATGA", "fmax": "2878", "accession": "AF242872.1", "fmin": "2131", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Enterococcus faecium", "NCBI_taxonomy_id": "1352", "NCBI_taxonomy_cvterm_id": "36779"}, "protein_sequence": {"accession": "AAF86219.1", "sequence": "MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGSIPYNLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRKLIL"}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}, "37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "ErmB"}}, "542": {"$insert": {"CARD_short_name": "adeH"}}, "543": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1153": {"$update": {"dna_sequence": {"$update": {"accession": "AY101578.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-106"}}, "540": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"65": {"$update": {"dna_sequence": {"$update": {"accession": "D78168.1"}}}}}}}}}, "$insert": {"CARD_short_name": "emrY"}}, "541": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"844": {"$update": {"dna_sequence": {"$update": {"accession": "AY528425.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-133"}}, "546": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3315": {"$update": {"dna_sequence": {"$update": {"accession": "AF148067.1"}}}}}}}}}, "$insert": {"CARD_short_name": "TLA-1"}}, "547": {"$update": {"ARO_description": "arr-5 is an integron-encoded ribosyltransferase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"567": {"$update": {"dna_sequence": {"$update": {"accession": "EF660563.1"}}}}}}}}}, "$insert": {"CARD_short_name": "arr-5"}}, "544": {"$update": {"ARO_description": "AAC(6')-Is is a chromosomal-encoded aminoglycoside acetyltransferase in Acinetobacter variabilis.", "model_sequences": {"$update": {"sequence": {"$update": {"669": {"$update": {"dna_sequence": {"$update": {"accession": "AF031327.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Is"}}, "545": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1415": {"$update": {"dna_sequence": {"$update": {"accession": "JX023441.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-22"}}, "3784": {"$insert": {"CARD_short_name": "mlaF"}}, "548": {"$update": {"ARO_description": "QnrB3 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"277": {"$update": {"dna_sequence": {"$update": {"accession": "DQ303920.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB3"}}, "549": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1240": {"$update": {"dna_sequence": {"$update": {"accession": "AY101764.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-107"}}, "1782": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"996": {"$update": {"dna_sequence": {"$update": {"accession": "M88143.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-12"}}, "3885": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-812"}}, "1783": {"$update": {"ARO_description": "VIM-36 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1578": {"$update": {"dna_sequence": {"$update": {"accession": "JX982635.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-36"}}, "4938": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-612"}}, "1784": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1687": {"$update": {"dna_sequence": {"$update": {"accession": "KF203108.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-334"}}, "1982": {"$update": {"ARO_description": "IMP-9 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"8223": {"dna_sequence": {"partial": "0", "sequence": "ATGAGCAAGTTATTTGTATTCTTTATGTTTTTGTTTTGTAGCATTACTGCCGCAGGAGAGTCTTTGCCAGATTTAAAAATTGAGAAGCTTGACGAAGGCGTTTATGTTCATACTTCGTTTGAAGAAGTTAACGGTTGGGGTGTTATTCCTAAACACGGCTTGGTGGTTCTTGTAAATACTGATGCCTATCTGATAGACACTCCATTTACTGCTAAAGATACTGAAAATTTAGTTAATTGGTTTGTTGAGCGCGGCTATAGAATAAAAGGCAGTATTTCCTCACATTTCCATAGCGACAGCACGGGTGGAATAGAGTGGCTTAATTCTCAATCTATCCCCACGTATGCATCTGAATTAACAAATGAACTTCTTAAAAAAGACGGTAAGGTACAAGCTAAATATTCATTTAGCGGAGTTAGCTATTGGCTAGTTAAGAAAAAGATTGAAGTTTTTTATCCTGGTCCAGGGCACGCTCCAGATAACGTAGTGGTTTGGCTGCCTGAAAATAGAGTTTTGTTCGGTGGTTGTTTTGTTAAACCCTACGGTCTAGGTAATTTGGGTGACGCAAATTTAGAAGCTTGGCCAAAATCCGCCAAATTATTAATGTCAAAATATAGTAAGGCAAAACTGGTTGTACCAAGTCATAGTGACATAGGAGATTCGTCGCTCTTGAAGCTTACATGGGAGCAGACGGTAAAAGGATTCAATGAAAGCAAAAAAAGTACCACTGCACATTAA", "fmax": "457877", "accession": "KC543497.1", "fmin": "457139", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AAK59385.1", "sequence": "MSKLFVFFMFLFCSITAAGESLPDLKIEKLDEGVYVHTSFEEVNGWGVIPKHGLVVLVNTDAYLIDTPFTAKDTENLVNWFVERGYRIKGSISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKYSFSGVSYWLVKKKIEVFYPGPGHAPDNVVVWLPENRVLFGGCFVKPYGLGNLGDANLEAWPKSAKLLMSKYSKAKLVVPSHSDIGDSSLLKLTWEQTVKGFNESKKSTTAH"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-9"}}, "1785": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1650": {"$update": {"dna_sequence": {"$update": {"accession": "Y10280.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-48"}}, "1786": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"414": {"$update": {"dna_sequence": {"$update": {"accession": "AB015853.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "mexY"}}, "957": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"239": {"$update": {"dna_sequence": {"$update": {"accession": "AF133139.1"}}}}}}}}}, "$insert": {"CARD_short_name": "tet(G)"}}, "1787": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2128": {"$update": {"dna_sequence": {"$update": {"accession": "KP071470.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-42"}}, "3880": {"$insert": {"CARD_short_name": "PDC-23"}}, "5476": {"$insert": {"CARD_short_name": "PDC-347"}}, "5618": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "PER-15"}}, "5619": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "PER-16"}}, "5719": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-70"}}, "5477": {"$insert": {"CARD_short_name": "PDC-348"}}, "5612": {"$insert": {"CARD_short_name": "PDC-99"}}, "5613": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "PER-10"}}, "5610": {"$insert": {"CARD_short_name": "PDC-97"}}, "5611": {"$insert": {"CARD_short_name": "PDC-98"}}, "5616": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "PER-13"}}, "5617": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7992": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "PER-14"}}, "5614": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7989": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "PER-11"}}, "5615": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "PER-12"}}, "414": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1612": {"$update": {"dna_sequence": {"$update": {"accession": "KF986258.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-377"}}, "415": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"4506": {"$update": {"dna_sequence": {"$update": {"accession": "GU371926.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-33"}}, "416": {"$update": {"ARO_description": "OXA-204 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1605": {"$update": {"dna_sequence": {"$update": {"accession": "JQ809466.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-204"}}, "417": {"$update": {"ARO_description": "QnrB6 is a plasmid-mediated quinolone resistance protein found in Pantoea agglomerans.", "model_sequences": {"$update": {"sequence": {"$update": {"610": {"$update": {"dna_sequence": {"$update": {"accession": "EF520349.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB6"}}, "1388": {"$update": {"ARO_description": "oleB is an ABC-F subfamily protein in Streptomyces antibioticus and is involved in oleandomycin secretion.", "model_sequences": {"$update": {"sequence": {"$update": {"3347": {"$update": {"dna_sequence": {"$update": {"accession": "L36601.1"}}}}}}}}}, "$insert": {"CARD_short_name": "oleB"}}, "411": {"$update": {"ARO_description": "QnrB11 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"$update": {"146": {"$update": {"dna_sequence": {"$update": {"accession": "EF653270.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB11"}}, "412": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-117"}}, "413": {"$update": {"ARO_description": "OXA-144 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1369": {"$update": {"dna_sequence": {"$update": {"accession": "FJ872530.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-144"}}, "1384": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2011": {"$update": {"dna_sequence": {"$update": {"accession": "KJ135345.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-382"}}, "1385": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "mdsB"}}, "1386": {"$update": {"ARO_description": "ANT(9)-Ia is an aminoglycoside nucleotidyltransferase encoded by plasmids and transposons in S. aureus, Enterococcus spp., Mammaliicoccus sciuri, and E. faecalis.", "ARO_category": {"$update": {"36367": {"$update": {"category_aro_description": "Nucleotidylylation of spectinomycin at the hydroxyl group at position 9."}}}}}, "$insert": {"CARD_short_name": "ANT(9)-Ia"}}, "1387": {"$update": {"ARO_description": "OXA-99 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1847": {"$update": {"dna_sequence": {"$update": {"accession": "DQ888718.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-99"}}, "1380": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1245": {"$update": {"dna_sequence": {"$update": {"accession": "JN935135.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-193"}}, "419": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3312": {"$update": {"dna_sequence": {"$update": {"accession": "AY590118.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SLB-1"}}, "1382": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"93": {"$update": {"dna_sequence": {"$update": {"accession": "JX486113.1"}}}}}}}}}, "$insert": {"CARD_short_name": "rmtG"}}, "1383": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1435": {"$update": {"dna_sequence": {"$update": {"accession": "KF958750.1"}}}}}}}}}, "$insert": {"CARD_short_name": "IMI-4"}}, "3827": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-898"}}, "3826": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-899"}}, "3825": {"$insert": {"CARD_short_name": "RanA"}}, "3824": {"$insert": {"CARD_short_name": "RanB"}}, "3823": {"$insert": {"CARD_short_name": "mef(D)"}}, "3822": {"$insert": {"CARD_short_name": "msrH"}}, "3821": {"$insert": {"CARD_short_name": "msrF"}}, "3820": {"$insert": {"CARD_short_name": "AAC(3)-IIg"}}, "5098": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-793"}}, "3327": {"$update": {"ARO_description": "AAC(2')-IIa is a kasugamycin 2' N-acetyltransferase protein found in Burkholderia glumae and Acidovorax avenae isolates."}, "$insert": {"CARD_short_name": "AAC(2')-IIa"}}, "3582": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ERP-1"}}, "3829": {"$update": {"ARO_description": "A blaZ-like beta-lactamase found in S. Aureus.", "model_sequences": {"$update": {"sequence": {"8358": {"dna_sequence": {"partial": "0", "sequence": "TTGAAAAAATTAATAATTTTAGTCGTGTTAGCGTTGATATTAAGTGCTTGTAATAGTAAGAATTCAACTAATAACGACATTGAAAAGATCGAAAAAAAATATGGTGCTAACGTAGGTATGTATGCTCTTAATACTCAAAATGGTAAAGAATTATCATTTAATGAAAATAAGCGTTTTGCATATGCTTCCACATTAAAAACTATAAGTAGCGCAATGCTGCTTGAACAAACACCTTACAACAAATTAGATAAAAAAATTCACATTAATAAAGATGATATTGTTCCATATTCACCAGTGTTAGAAAAATATATTGGCAAAGAGATAACTTTAAAAAAGCTTATAGAAGCTACCATGTTATTTAGCGATAACACGGCTAATAATAAAATTATCGATGAATTGGGAGGATATGGGCAAGTAAAAACGAAACTGATAGATTTAGGCGATACAACGACACATCCATCTAGAAAAGAACCAGACTTAAATTTTTATTCACCAAAGGATAAACGAGATACAAGTACTCCATTAGCCTATGGTAAAACTTTAAAGAAACTTATAGCTGATGGAGATCTTAGCAAAGCAAACAAAGATTTCTTACTTAATCTAATGTTCAAAAATAAAAGTGGCGATACATTAATTAAGGATGGTGCACCTTCAAACTTTAAAGTTATGGATAAGAGCGGTCAAGCACTAACATACGGTTCAAGAAACGATGTTGCGTTTGTTTATCCAGATGGACAAGATAAACCTATAATTCTGGTGATATTTACAAATAAAGATAGAAAAGATGGTAAACCTAATGACAAAATAGTAAGTGAGGTTGCTGAAATTGTACTAAAAAATATTAATGAGTAA", "fmax": "1647", "accession": "FR823292.1", "fmin": "795", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Staphylococcus aureus", "NCBI_taxonomy_id": "1280", "NCBI_taxonomy_cvterm_id": "35508"}, "protein_sequence": {"accession": "CBZ41939.1", "sequence": "MKKLIILVVLALILSACNSKNSTNNDIEKIEKKYGANVGMYALNTQNGKELSFNENKRFAYASTLKTISSAMLLEQTPYNKLDKKIHINKDDIVPYSPVLEKYIGKEITLKKLIEATMLFSDNTANNKIIDELGGYGQVKTKLIDLGDTTTHPSRKEPDLNFYSPKDKRDTSTPLAYGKTLKKLIADGDLSKANKDFLLNLMFKNKSGDTLIKDGAPSNFKVMDKSGQALTYGSRNDVAFVYPDGQDKPIILVIFTNKDRKDGKPNDKIVSEVAEIVLKNINE"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "41361": {"$update": {"category_aro_name": "BlaZ beta-lactamase", "category_aro_description": "BlaZ beta-lactamases are Class A beta-lactamases. These beta-lactamases are responsible for penicillin resistance in Staphylococcus aureus."}}}}}, "$insert": {"CARD_short_name": "mecC-type_BlaZ"}}, "3828": {"$insert": {"CARD_short_name": "GPC-1"}}, "3618": {"$update": {"ARO_description": "From Lahey's list of beta-lactamases, no additional information available.", "model_sequences": {"$update": {"sequence": {"$update": {"5816": {"$update": {"dna_sequence": {"$update": {"accession": "KP681694.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-49"}}, "2768": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MdtEF-TolC"}}, "5007": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-695"}}, "3585": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "FONA-1"}}, "4282": {"$insert": {"CARD_short_name": "ADC-217"}}, "4283": {"$insert": {"CARD_short_name": "ADC-218"}}, "4280": {"$insert": {"CARD_short_name": "ADC-215"}}, "4281": {"$insert": {"CARD_short_name": "ADC-216"}}, "4286": {"$insert": {"CARD_short_name": "ADC-221"}}, "4287": {"$insert": {"CARD_short_name": "ADC-222"}}, "4284": {"$insert": {"CARD_short_name": "ADC-219"}}, "4285": {"$insert": {"CARD_short_name": "ADC-220"}}, "4288": {"$insert": {"CARD_short_name": "ADC-223"}}, "4289": {"$insert": {"CARD_short_name": "ADC-224"}}, "2406": {"$insert": {"CARD_short_name": "rpsJ"}}, "2763": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems)."}, "$insert": {"CARD_short_name": "MdtABC-TolC"}}, "368": {"$update": {"ARO_description": "CARB-14 is a beta-lactamase found in Acinetobacter baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1991": {"$update": {"dna_sequence": {"$update": {"accession": "JQ364968.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-14"}}, "369": {"$update": {"model_sequences": {"$update": {"sequence": {"8259": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAATGCTGGCGCGGGTGGATGCCGGTGACAAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTAGCAAGCGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "861", "accession": "AJ011428.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "CAB37325.2", "sequence": "MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAMLARVDAGDKQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-15"}}, "366": {"$update": {"ARO_description": "Specific mutations in Mycobacterium tuberculosis iniA resulting in resistance to ethambutol.", "model_sequences": {"$update": {"sequence": {"$update": {"2099": {"$update": {"dna_sequence": {"$update": {"accession": "AL123456.1"}}}}}}}}, "ARO_category": {"$update": {"40040": {"$update": {"category_aro_description": "Mutations that occurs on the iniA genes resulting in the resistance to ethambutol."}}}}, "model_name": "Mycobacterium tuberculosis iniA mutant conferring resistance to ethambutol", "ARO_name": "Mycobacterium tuberculosis iniA mutant conferring resistance to ethambutol"}, "$insert": {"CARD_short_name": "Mtub_iniA_EMB"}}, "367": {"$update": {"ARO_description": "CTX-M-25 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"8221": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAGAAAAAGCGTAAGGCGGGCGATGTTAATGACGACAGCCTGTGTTTCGCTGCTGTTGGCCAGTGTGCCGCTGTGTGCCCAGGCGAACGATGTTCAACAAAAGCTCGCGGCGCTGGAGAAAAGCAGCGGGGGACGACTGGGTGTGGCGTTGATTAACACCGCCGATAACACGCAGACGCTCTACCGCGCCGACGAGCGTTTTGCCATGTGCAGCACCAGTAAAGTGATGGCGGTAGCGGCGGTGCTTAAGCAAAGTGAAACGCAAAAGGGCTTGTTGAGTCAGCGGGTTGAAATTAAGCCCTCAGACTTGATTAACTACAACCCCATTGCGGAAAAACACGTCAATGGCACGATGACATTCGGGGAGTTGAGCGCGGCGGCGCTACAGTACAGCGATAATACTGCCATGAATAAGCTGATTGCCCATCTCGGGGGGCCGGATAAAGTGACGGCATTTGCCCGTACGATTGGCGATGACACGTTCCGGCTCGATCGTACCGAGCCGACGCTCAACACCGCGATCCCCGGCGACCCGCGCGATACCACCACGCCGTTAGCGATGGCGCAGGCTCTGCGCAATCTGACGTTGGGCAATGCCCTGGGTGACACTCAGCGTGCGCAGCTGGTGATGTGGCTGAAAGGCAACACCACCGGCGCTGCCAGCATTCAGGCAGGGCTACCCACATCGTGGGTTGTCGGGGATAAAACCGGCAGCGGCGGTTATGGTACGACGAATGATATCGCGGTTATTTGGCCGGAAGGTCGCGCGCCGCTCGTTCTGGTGACTTACTTCACCCAGTCGGAGCCGAAGGCAGAGAGCCGTCGTGACGTGCTCGCTGCTGCCGCCAGAATTGTCACCGACGGTTATTAA", "fmax": "3196", "accession": "AF518567.2", "fmin": "2320", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "AAM70498.1", "sequence": "MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQTLYRADERFAMCSTSKVMAVAAVLKQSETQKGLLSQRVEIKPSDLINYNPIAEKHVNGTMTFGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDPRDTTTPLAMAQALRNLTLGNALGDTQRAQLVMWLKGNTTGAASIQAGLPTSWVVGDKTGSGGYGTTNDIAVIWPEGRAPLVLVTYFTQSEPKAESRRDVLAAAARIVTDGY"}}}}}}, "$insert": {"CARD_short_name": "CTX-M-25"}}, "364": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"959": {"$update": {"dna_sequence": {"$update": {"accession": "JX440351.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-83"}}, "365": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1241": {"$update": {"dna_sequence": {"$update": {"accession": "AY307100.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-122"}}, "362": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1511": {"$update": {"dna_sequence": {"$update": {"accession": "AB916359.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-151"}}, "363": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1323": {"$update": {"dna_sequence": {"$update": {"accession": "DQ679961.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-155"}}, "360": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"397": {"$update": {"dna_sequence": {"$update": {"accession": "AF144880.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Iy"}}, "361": {"$update": {"ARO_description": "OXA-278 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"806": {"$update": {"dna_sequence": {"$update": {"accession": "KC771279.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-278"}}, "5274": {"$insert": {"CARD_short_name": "PDC-137"}}, "2760": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "MexGHI-OpmD"}}, "5275": {"$insert": {"CARD_short_name": "PDC-138"}}, "5637": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"8012": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "RAHN-2"}}, "5276": {"$insert": {"CARD_short_name": "PDC-139"}}, "380": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1272": {"$update": {"dna_sequence": {"$update": {"accession": "KF513180.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-147"}}, "381": {"$update": {"ARO_description": "QnrS1 is a plasmid-mediated quinolone resistance protein found in Shigella flexneri.", "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS1"}}, "382": {"$update": {"ARO_description": "QnrB61 is a plasmid-mediated quinolone resistance protein found in Citrobacter braakii.", "model_sequences": {"$update": {"sequence": {"$update": {"721": {"$update": {"dna_sequence": {"$update": {"accession": "AB734053.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB61"}}, "383": {"$update": {"ARO_description": "Mutations in Pseudomonas aeruginosa PhoQ of the two-component PhoPQ regulatory system. Presence of mutation confers resistance to colistin."}, "$insert": {"CARD_short_name": "Paer_PhoQ_CST"}}, "384": {"$update": {"ARO_description": "APH(2'')-IVa is a chromosomal-encoded aminoglycoside phosphotransferase in E. casseliflavus.", "model_sequences": {"$update": {"sequence": {"$update": {"729": {"$update": {"dna_sequence": {"$update": {"accession": "AF016483.1"}}}}}}}}, "ARO_category": {"$update": {"36267": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 2''."}}}}}, "$insert": {"CARD_short_name": "APH(2'')-IVa"}}, "385": {"$update": {"ARO_description": "OXA-46 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1536": {"$update": {"dna_sequence": {"$update": {"accession": "JX131372.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-46"}}, "386": {"$update": {"ARO_description": "LEN-8 is a beta-lactamase found in Klebsiella pneumoniae.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-8"}}, "387": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"15": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}}}}}}}}, "$insert": {"CARD_short_name": "mdtA"}}, "388": {"$update": {"ARO_description": "QnrB71 is a plasmid-mediated quinolone resistance protein found in Citrobacter braakii.", "model_sequences": {"$update": {"sequence": {"$update": {"406": {"$update": {"dna_sequence": {"$update": {"accession": "KC580660.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB71"}}, "389": {"$insert": {"CARD_short_name": "tetW"}}, "5271": {"$insert": {"CARD_short_name": "PDC-134"}}, "4758": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7133": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "LUT-5"}}, "4759": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7134": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "LUT-6"}}, "5272": {"$insert": {"CARD_short_name": "PDC-135"}}, "4750": {"$insert": {"CARD_short_name": "LHK-5"}}, "4751": {"$insert": {"CARD_short_name": "LHK-6"}}, "4752": {"$insert": {"CARD_short_name": "LRG-1"}}, "4753": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7128": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "LUS-1"}}, "4754": {"$insert": {"CARD_short_name": "LUT-1"}}, "4755": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7130": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "LUT-2"}}, "4756": {"$insert": {"CARD_short_name": "LUT-3"}}, "4757": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7132": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "LUT-4"}}, "5375": {"$insert": {"CARD_short_name": "PDC-237"}}, "5374": {"$insert": {"CARD_short_name": "PDC-236"}}, "3216": {"$update": {"ARO_description": "A chromosomal macrolide 2'-phosphotransferase and resistance gene identified from a Brachybacterium faecium cave isolate."}, "$insert": {"CARD_short_name": "mphH"}}, "5377": {"$insert": {"CARD_short_name": "PDC-239"}}, "3759": {"$update": {"ARO_description": "APH(3')-VIb is a plasmid-encoded aminoglycoside phosphotransferase in K. pneumoniae and S. marcescens.", "ARO_category": {"$update": {"36265": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'."}}}}}, "$insert": {"CARD_short_name": "APH(3')-VIb"}}, "3758": {"$insert": {"CARD_short_name": "VMB-1"}}, "5376": {"$insert": {"CARD_short_name": "PDC-238"}}, "4664": {"$insert": {"CARD_short_name": "GRD23-1"}}, "3751": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6042": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-181"}}, "3750": {"$update": {"ARO_description": "A tetracycline efflux MFS Transporter from Providencia sp. Y14."}, "$insert": {"CARD_short_name": "tet(57)"}}, "3753": {"$update": {"model_name": "TxR"}, "$insert": {"CARD_short_name": "TxR"}}, "3755": {"$update": {"ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "qacEdelta1"}}, "3754": {"$update": {"ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}}, "$insert": {"CARD_short_name": "qacE"}}, "3757": {"$update": {"ARO_description": "IDC-2 is an IDC beta-lactamase and an integron cephalosprinase."}, "$insert": {"CARD_short_name": "IDC-2"}}, "3756": {"$update": {"ARO_description": "IDC-2 is an IDC beta-lactamase and an integron cephalosprinase."}, "$insert": {"CARD_short_name": "IDC-1"}}, "4633": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7008": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-20"}}, "2191": {"$update": {"ARO_description": "AAC(6')-Iaj is a functional acetyltransferase that modifies the amino groups at the 6' positions of aminoglycosides and contributes to aminoglycoside resistance of P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"3379": {"$update": {"dna_sequence": {"$update": {"accession": "AB709942.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Iaj"}}, "2192": {"$update": {"ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "TriA"}}, "2193": {"$update": {"ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "TriB"}}, "2194": {"$update": {"ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "TriC"}}, "2195": {"$update": {"ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "OpmH"}}, "2196": {"$insert": {"CARD_short_name": "Paer_gyrA_FLO"}}, "4634": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-21"}}, "2198": {"$insert": {"CARD_short_name": "Paer_parE_FLO"}}, "253": {"$update": {"ARO_description": "Also known as vanXYG, is a vanXY variant found in the vanG gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"123": {"$update": {"dna_sequence": {"$update": {"accession": "DQ212986.1"}}}}}}}}, "model_name": "vanXY gene in vanG cluster", "ARO_name": "vanXY gene in vanG cluster"}, "$insert": {"CARD_short_name": "vanXY_in_vanG"}}, "250": {"$update": {"ARO_description": "cmr is a plasmid-encoded chloramphenicol exporter that is found in Rhodococcus fascians and Corynebacterium glutamicum.", "model_sequences": {"$update": {"sequence": {"$update": {"663": {"$update": {"dna_sequence": {"$update": {"accession": "Z12001.1"}}}}}}}}}, "$insert": {"CARD_short_name": "Rfas_cmr"}}, "251": {"$update": {"ARO_description": "APH(3')-VIIa is a plasmid-encoded aminoglycoside phosphotransferase in C. jejuni.", "model_sequences": {"$update": {"sequence": {"$update": {"326": {"$update": {"dna_sequence": {"$update": {"accession": "M29953.1"}}}}}}}}, "ARO_category": {"$update": {"36265": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'."}}}}}, "$insert": {"CARD_short_name": "APH(3')-VIIa"}}, "256": {"$update": {"ARO_description": "CMY-21 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"957": {"$update": {"dna_sequence": {"$update": {"accession": "DQ139328.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-21"}}, "257": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1735": {"$update": {"dna_sequence": {"$update": {"accession": "KM926622.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-37"}}, "254": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1923": {"$update": {"dna_sequence": {"$update": {"accession": "GQ853681.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-150"}}, "255": {"$update": {"model_name": "BRP(MBL)"}, "$insert": {"CARD_short_name": "BRP(MBL)"}}, "2200": {"$update": {"ARO_category": {"$update": {"36265": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'."}}}}}, "$insert": {"CARD_short_name": "APH(3')-VI"}}, "2201": {"$update": {"ARO_description": "PvrR is a response regulator that controls the conversion between antibiotic-resistant and antibiotic-susceptible forms of Pseudomonas aeruginosa biofilms through porin deletion/gene absence.", "ARO_category": {"$update": {"40429": {"$update": {"category_aro_description": "Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin)."}}}}}, "$insert": {"CARD_short_name": "PvrR"}}, "2202": {"$update": {"ARO_description": "AAC(3)-Ib/AAC(6')-Ib'' is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa.", "model_param": {"$update": {"40327": {"$update": {"param_description": "A parameter to describe the genes in a fusion protein. The parameter is defined by Cvterm IDs, separated by commas, with the ordering number preceding a colon. If the ordering of one or more parameters is unknown, it is designated as 0. Examples: 1:30003,2:30111 or 0:32224,0:33555."}}}}}, "$insert": {"CARD_short_name": "AAC_3Ib_AAC_6Ib"}}, "2203": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3390": {"$update": {"dna_sequence": {"$update": {"accession": "KP347127.1"}}, "protein_sequence": {"$update": {"accession": "AKF16168.1"}}}}}}}}, "model_name": "MCR-1.1"}, "$insert": {"CARD_short_name": "MCR-1.1"}}, "2205": {"$update": {"ARO_description": "MexJ is the membrane fusion protein of the MexJK multidrug efflux protein.", "ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "model_name": "MexJ"}, "$insert": {"CARD_short_name": "MexJ"}}, "2206": {"$update": {"ARO_description": "MexK is the inner membrane resistance-nodulation-cell division (RND) transporter in the MexJK multidrug efflux protein.", "ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "model_name": "MexK"}, "$insert": {"CARD_short_name": "MexK"}}, "2207": {"$update": {"ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}, "model_name": "MexV"}, "$insert": {"CARD_short_name": "MexV"}}, "2208": {"$update": {"ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}, "model_name": "MexW"}, "$insert": {"CARD_short_name": "MexW"}}, "476": {"$insert": {"CARD_short_name": "amrB"}}, "116": {"$update": {"ARO_description": "QnrB18 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"$update": {"424": {"$update": {"dna_sequence": {"$update": {"accession": "AM919399.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB18"}}, "2790": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "40429": {"$update": {"category_aro_description": "Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin)."}}}}}, "$insert": {"CARD_short_name": "Smar_Omp1"}}, "2428": {"$insert": {"CARD_short_name": "farA"}}, "2429": {"$insert": {"CARD_short_name": "farB"}}, "4812": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-114l"}}, "2421": {"$insert": {"CARD_short_name": "efrA"}}, "2422": {"$insert": {"CARD_short_name": "efrB"}}, "2423": {"$insert": {"CARD_short_name": "msbA"}}, "2424": {"$update": {"ARO_category": {"$update": {"40721": {"$update": {"category_aro_description": "Microcin J25 is a peptide antibiotic that inhibits transcription by bacterial RNA polymerase. MccJ25 is produced by Escherichia coli strains that harbor a plasmid-borne antibiotic-synthesis and antibiotic-export cassette, consisting of a gene for MccJ25 precursor (a 58 residue linear peptide), two genes for factors that process MccJ25 precursor into MccJ25, and one gene for export of MccJ25."}}}}, "model_name": "YojI"}, "$insert": {"CARD_short_name": "YojI"}}, "2425": {"$update": {"ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "hmrM"}}, "2426": {"$insert": {"CARD_short_name": "efmA"}}, "2427": {"$insert": {"CARD_short_name": "efpA"}}, "4329": {"$insert": {"CARD_short_name": "ADC-51"}}, "4810": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-114j"}}, "168": {"$update": {"ARO_description": "VIM-17 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"8239": {"dna_sequence": {"partial": "0", "sequence": "ATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATGATGGCTATTGCGAGTCCGCTCGCTTTTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCGGTCGGGGAGGTCCGGCTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAAAACACAGCGGCACTTCTCGCGGAGATTGAGAAGCAAATTGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCGGCGGCGTTGATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGTAGAGGGGAACGAGATTCCCACGCACTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAACTCTTCTATCCTGGTGCTGCGCATTCGACCGACAACTTAGTTGTGTACGTCCCGTCTGCGAGTGTGCTCTATGGTGGTTGTGCGATTTATGAGTTGTCACGCACGTCTGCGGGGAACGTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCATTGAGCGGATTCAACAACACTACCCGGAAGCACAGTTCGTCATTCCGGGGCACGGCCTGCCGGGCGGTCTAGACTTGCTCAAGCACACAACGAATGTTGTAAAAGCGCACACAAATCGCTCAGTCGTTGAGTAG", "fmax": "1811", "accession": "EU118148.2", "fmin": "1010", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "ABW90721.1", "sequence": "MFKLLSKLLVYLTASMMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-17"}}, "169": {"$update": {"ARO_description": "IMP-33 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"8214": {"dna_sequence": {"partial": "0", "sequence": "ATGAAGAAATTATTTGTTTTATGTGTATGCTTCTTTTGTAGCATTACTGCCGCAGGATCGTCTTTACCTGATTTAAAAATTGAGAAGCTTGAAGAAGGTGTTTTTGTTCATACATCGTTCGAAGAAGTTAACGGTTGGGGGGTTGTTACTAAACACGGTTTGGTGGTGCTTGTAAACACAGACGCCTATCTAATTGACACTCCATTTACTGCTACAGACACTGAAAAATTAGTCAATTGGTTTGTGGAGCGCGGCTATAAAATCAAAGGCACTATTTCATCACATTTCCATAGCGACAGCACAGGAGGAATAGAGTGGCTTAATTCTCAATCTATTCCCACGTATGCATCTGAATTAACAAATGAACTTTTGAAAAAATCCGGTAAGGTACAAGCTAAATATTCATTTAGCGAAGTTAGCTATTGGCTAGTTAAAAATAAAATTGAAGTTTTTTATCCTGGCCCAGGTCACACTCAAGATAACCTAGTGGTTTGGTTGCCTGAAAGTAAAATTTTATTCGGTGGTTGCTTTGTTAAACCTCACGGTCTTGGCAATTTAGGTGACGCAAATTTAGAAGCTTGGCCAAAGTCCGCCAAAATATTAATGTCTAAATATGGCAAAGCAAAGCTTGTTGTTTCAAGTCATAGTGAGAAAGGGGACGCATCACTATTGAAACGTACATGGGAACAAGCTCTTAAAGGGCTTAAAGAAAGTAAAAAAACATCATCACCAAGTAACTAA", "fmax": "2568", "accession": "JN848782.2", "fmin": "1827", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AEU17778.1", "sequence": "MKKLFVLCVCFFCSITAAGSSLPDLKIEKLEEGVFVHTSFEEVNGWGVVTKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKSGKVQAKYSFSEVSYWLVKNKIEVFYPGPGHTQDNLVVWLPESKILFGGCFVKPHGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEKGDASLLKRTWEQALKGLKESKKTSSPSN"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-33"}}, "164": {"$update": {"ARO_description": "VanN is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Ser, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity in Enterococcus faecium.", "model_sequences": {"$update": {"sequence": {"$update": {"684": {"$update": {"dna_sequence": {"$update": {"accession": "JF802084.1"}}}}}}}}, "ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "vanN"}}, "165": {"$update": {"ARO_description": "VIM-29 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"935": {"$update": {"dna_sequence": {"$update": {"accession": "JX311308.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-29"}}, "167": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1099": {"$update": {"dna_sequence": {"$update": {"accession": "AB372224.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-39"}}, "160": {"$update": {"ARO_description": "OXA-236 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1374": {"$update": {"dna_sequence": {"$update": {"accession": "JQ820242.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-236"}}, "161": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1639": {"$update": {"dna_sequence": {"$update": {"accession": "EU586041.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-56"}}, "162": {"$update": {"ARO_description": "KPC-8 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1870": {"$update": {"dna_sequence": {"$update": {"accession": "FJ234412.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-8"}}, "163": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1534": {"$update": {"dna_sequence": {"$update": {"accession": "KF986257.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-376"}}, "4839": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-504"}}, "4838": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-503"}}, "4815": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-114p"}}, "4529": {"$insert": {"CARD_short_name": "CTX-M-200"}}, "4528": {"$insert": {"CARD_short_name": "CTX-M-199"}}, "4527": {"$insert": {"CARD_short_name": "CTX-M-198"}}, "4526": {"$insert": {"CARD_short_name": "CTX-M-197"}}, "4525": {"$insert": {"CARD_short_name": "CTX-M-196"}}, "4524": {"$insert": {"CARD_short_name": "CTX-M-195"}}, "4523": {"$insert": {"CARD_short_name": "CTX-M-194"}}, "4522": {"$insert": {"CARD_short_name": "CTX-M-193"}}, "4521": {"$insert": {"CARD_short_name": "CTX-M-192"}}, "4520": {"$insert": {"CARD_short_name": "CTX-M-191"}}, "4422": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-36"}}, "2518": {"$update": {"model_name": "tetB(58)"}, "$insert": {"CARD_short_name": "tetB(58)"}}, "2519": {"$insert": {"CARD_short_name": "LlmA_23S_CLI"}}, "1842": {"$update": {"ARO_description": "IMI-3 is a beta-lactamase found in Enterobacteriaceae.", "model_sequences": {"$update": {"sequence": {"$update": {"1356": {"$update": {"dna_sequence": {"$update": {"accession": "GU015024.1"}}}}}}}}}, "$insert": {"CARD_short_name": "IMI-3"}}, "2517": {"$update": {"model_name": "tetA(58)"}, "$insert": {"CARD_short_name": "tetA(58)"}}, "1841": {"$update": {"ARO_description": "OXA-76 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1465": {"$update": {"dna_sequence": {"$update": {"accession": "AY949203.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-76"}}, "2734": {"$update": {"ARO_category": {"$update": {"40514": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"45598": {"category_aro_name": "chlorhexidine", "category_aro_cvterm_id": "45598", "category_aro_accession": "3007039", "category_aro_class_name": "Antibiotic", "category_aro_description": "Chlorhexidine is a disinfectant and antiseptic that is used for skin disinfection, including mouthwashes (chlorhexidine gluconate)."}, "43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "PmpM"}}, "1840": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6218": {"$update": {"dna_sequence": {"$update": {"accession": "AB587082.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-59"}}, "2731": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "MexJK-OpmH"}}, "2732": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "MexVW-OprM"}}, "2733": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "TriABC-OpmH"}}, "5296": {"$insert": {"CARD_short_name": "PDC-158"}}, "5297": {"$insert": {"CARD_short_name": "PDC-159"}}, "5294": {"$insert": {"CARD_short_name": "PDC-156"}}, "5295": {"$insert": {"CARD_short_name": "PDC-157"}}, "5292": {"$insert": {"CARD_short_name": "PDC-154"}}, "5293": {"$insert": {"CARD_short_name": "PDC-155"}}, "5290": {"$insert": {"CARD_short_name": "PDC-152"}}, "4427": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-43"}}, "3531": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-466"}}, "3530": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-465"}}, "3533": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-471"}}, "3532": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-470"}}, "5058": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-749"}}, "5059": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-750"}}, "3537": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-475"}}, "3536": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-474"}}, "3539": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-477"}}, "3538": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-476"}}, "5056": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-747"}}, "5057": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-748"}}, "5050": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-741"}}, "5051": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-742"}}, "5052": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-743"}}, "5053": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-744"}}, "1814": {"$update": {"ARO_description": "AAC(6')-Ie-APH(2'')-Ia is an aminoglycoside acetyltransferase encoded by plasmids and transposons in S. aureus, E. faecalis, E. faecium and Staphylococcus warneri.", "ARO_category": {"$update": {"36267": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 2''."}}}}}, "$insert": {"CARD_short_name": "AAC6_Ie_APH2_Ia"}}, "1815": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1964": {"$update": {"dna_sequence": {"$update": {"accession": "JX896165.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-134"}}, "1816": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"932": {"$update": {"dna_sequence": {"$update": {"accession": "X65252.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-8"}}, "1817": {"$update": {"model_sequences": {"$update": {"sequence": {"8145": {"dna_sequence": {"partial": "0", "sequence": "ATGCTTAAAATCGACATGAAGAATGTAAAAAAATATTATGCAGATAAATTAATTTTAAATATAAAAGAACTAAAGATTTATAGTGGGGATAAAATAGGTATTGTAGGTAAGAATGGAGTTGGCAAAACAACACTTTTAAAAATAATAAAAGGACTAATAGAGATTGACGAAGGAAATATAATTATAAGTGAAAAAACAACTATTAAATATATCTCTCAATTAGAAGAACCACATAGTAAGATAATTGATGGAAAATATGCTTCAATATTTCAAGTTGAAAATAAGTGGAATGACAATATGAGTGGTGGTGAAAAAACTAGATTTAAACTAGCAGAGGGATTTCAAGATCAATGTTCTTTAATGCTCGTAGATGAACCTACAAGTAATTTAGATATCGAAGGAATAGAGTTGATAACAAATACTTTTAAAGAGTACCGTGATACTTTTTTGGTAGTATCTCATGATAGAATTTTTTTAGATCAAGTTTGTACAAAAATTTTTGAAATTGAAAATGGATATATTAGAGAATTCATCGGTAATTATACAAACTATATAGAGCAAAAAGAAATGCTTCTACGAAAGCAACAAGAAGAATACGAAAAGTATAATTCTAAAAGAAAGCAATTGGAGCAAGCTATAAAGCTAAAAGAGAATAAGGCGCAAGGAATGATTAAGCCCCCTTCAAAAACAATGGGAACATCTGAATCTAGAATATGGAAAATGCAACATGCTACTAAACAAAAAAAGATGCATAGAAATACGAAATCGTTGGAAACACGAATAGATAAATTAAATCATGTAGAAAAAATAAAAGAGCTTCCTTCTATTAAAATGGATTTACCTAATAGAGAGCAATTTCATGGTCGCAATGTAATTAGTTTAAAAAACTTATCTATAAAATTTAATAATCAATTTCTTTGGAGAGATGCTTCATTTGTCATTAAAGGTGGAGAAAAGGTTGCTATAATTGGTAACAATGGTGTAGGAAAAACAACATTGTTGAAGCTGATTCTAGAAAAAGTAGAATCAGTAATAATATCACCATCAGTTAAAATTGGATACGTCAGTCAAAACTTAGATGTTCTACAATCTCATAAATCTATCTTAGAAAATGTTATGTCTACCTCCATTCAAGATGAAACAATAGCAAGAATTGTTCTAGCAAGATTACATTTTTATCGCAATGATGTTCATAAAGAAATAAATGTTTTGAGTGGTGGAGAACAAATAAAGGTTGCTTTTGCCAAGCTATTTGTTAGCGATTGTAATACATTAATTCTTGATGAACCAACAAACTATTTGGATATCGATGCTGTTGAGGCATTAGAAGAATTGTTAATTACCTATGAAGGTGTTGTGTTATTTGCTTCCCATGATAAAAAATTTATACAAAACCTAGCTGAACAATTGTTAATAATAGAAAATAATAAAGTGAAAAAATTCGAAGGAACATATATAGAATATTTAAAAATTAAAGATAAACCAAAATTAAATACAAATGAAAAAGAACTCAAAGAAAAAAAGATGATACTAGAAATGCAAATTTCATCATTATTAAGTAAAATCTCAATGGAAGAAAATGAAGAAAAAAACAAAGAATTAGATGAAAAGTACAAATTGAAATTAAAAGAATTGAAAAGCCTAAATAAAAATATTTAA", "fmax": "2287", "accession": "U82085.2", "fmin": "628", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Staphylococcus aureus", "NCBI_taxonomy_id": "1280", "NCBI_taxonomy_cvterm_id": "35508"}, "protein_sequence": {"accession": "AAB95639.1", "sequence": "MLKIDMKNVKKYYADKLILNIKELKIYSGDKIGIVGKNGVGKTTLLKIIKGLIEIDEGNIIISEKTTIKYISQLEEPHSKIIDGKYASIFQVENKWNDNMSGGEKTRFKLAEGFQDQCSLMLVDEPTSNLDIEGIELITNTFKEYRDTFLVVSHDRIFLDQVCTKIFEIENGYIREFIGNYTNYIEQKEMLLRKQQEEYEKYNSKRKQLEQAIKLKENKAQGMIKPPSKTMGTSESRIWKMQHATKQKKMHRNTKSLETRIDKLNHVEKIKELPSIKMDLPNREQFHGRNVISLKNLSIKFNNQFLWRDASFVIKGGEKVAIIGNNGVGKTTLLKLILEKVESVIISPSVKIGYVSQNLDVLQSHKSILENVMSTSIQDETIARIVLARLHFYRNDVHKEINVLSGGEQIKVAFAKLFVSDCNTLILDEPTNYLDIDAVEALEELLITYEGVVLFASHDKKFIQNLAEQLLIIENNKVKKFEGTYIEYLKIKDKPKLNTNEKELKEKKMILEMQISSLLSKISMEENEEKNKELDEKYKLKLKELKSLNKNI"}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}}}}, "$insert": {"CARD_short_name": "vgaB"}}, "1810": {"$update": {"ARO_description": "VIM-15 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1164": {"$update": {"dna_sequence": {"$update": {"accession": "EU419745.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-15"}}, "1811": {"$update": {"ARO_description": "CARB-2 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1096": {"$update": {"dna_sequence": {"$update": {"accession": "DQ157752.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-2"}}, "1812": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1557": {"$update": {"dna_sequence": {"$update": {"accession": "AB364006.1"}}}}}}}}, "model_name": "KHM-1", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KHM-1"}}, "1813": {"$update": {"ARO_description": "MOX-4 is a beta-lactamase found in Aeromonas caviae.", "model_sequences": {"$update": {"sequence": {"$update": {"1199": {"$update": {"dna_sequence": {"$update": {"accession": "FJ262599.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MOX-4"}}, "4339": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6714": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "ADC-83"}}, "1818": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2105": {"$update": {"dna_sequence": {"$update": {"accession": "KP096411.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-26"}}, "1819": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-3"}}, "1208": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1390": {"$update": {"dna_sequence": {"$update": {"accession": "KF513178.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-173"}}, "4336": {"$insert": {"CARD_short_name": "ADC-66"}}, "4337": {"$insert": {"CARD_short_name": "ADC-70"}}, "4334": {"$insert": {"CARD_short_name": "ADC-63"}}, "5370": {"$insert": {"CARD_short_name": "PDC-232"}}, "4335": {"$insert": {"CARD_short_name": "ADC-65"}}, "1098": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"107": {"$update": {"dna_sequence": {"$update": {"accession": "KF823969.1"}}}}}}}}, "ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "vanB"}}, "1899": {"$update": {"ARO_description": "Also known as vanYF, is a vanY variant found in the vanF gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"380": {"$update": {"dna_sequence": {"$update": {"accession": "AF155139.1"}}}}}}}}, "model_name": "vanY gene in vanF cluster", "ARO_name": "vanY gene in vanF cluster"}, "$insert": {"CARD_short_name": "vanY_in_vanF_cl"}}, "1099": {"$update": {"ARO_description": "OXA-48 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"8249": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTGTATTAGCCTTATCGGCTGTGTTTTTGGTGGCATCGATTATCGGAATGCCTGCGGTAGCAAAGGAATGGCAAGAAAACAAAAGTTGGAATGCTCACTTTACTGAACATAAATCACAGGGCGTAGTTGTGCTCTGGAATGAGAATAAGCAGCAAGGATTTACCAATAATCTTAAACGGGCGAACCAAGCATTTTTACCCGCATCTACCTTTAAAATTCCCAATAGCTTGATCGCCCTCGATTTGGGCGTGGTTAAGGATGAACACCAAGTCTTTAAGTGGGATGGACAGACGCGCGATATCGCCACTTGGAATCGCGATCATAATCTAATCACCGCGATGAAATATTCAGTTGTGCCTGTTTATCAAGAATTTGCCCGCCAAATTGGCGAGGCACGTATGAGCAAGATGCTACATGCTTTCGATTATGGTAATGAGGACATTTCGGGCAATGTAGACAGTTTCTGGCTCGACGGTGGTATTCGAATTTCGGCCACGGAGCAAATCAGCTTTTTAAGAAAGCTGTATCACAATAAGTTACACGTATCGGAGCGCAGCCAGCGTATTGTCAAACAAGCCATGCTGACCGAAGCCAATGGTGACTATATTATTCGGGCTAAAACTGGATACTCGACTAGAATCGAACCTAAGATTGGCTGGTGGGTCGGTTGGGTTGAACTTGATGATAATGTGTGGTTTTTTGCGATGAATATGGATATGCCCACATCGGATGGTTTAGGGCTGCGCCAAGCCATCACAAAAGAAGTGCTCAAACAGGAAAAAATTATTCCCTAG", "fmax": "2985", "accession": "AY236073.2", "fmin": "2187", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "AAP70012.1", "sequence": "MRVLALSAVFLVASIIGMPAVAKEWQENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGVVKDEHQVFKWDGQTRDIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYGNEDISGNVDSFWLDGGIRISATEQISFLRKLYHNKLHVSERSQRIVKQAMLTEANGDYIIRAKTGYSTRIEPKIGWWVGWVELDDNVWFFAMNMDMPTSDGLGLRQAITKEVLKQEKIIP"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-48"}}, "4330": {"$insert": {"CARD_short_name": "ADC-52"}}, "5558": {"$insert": {"CARD_short_name": "PDC-428"}}, "4331": {"$insert": {"CARD_short_name": "ADC-53"}}, "2803": {"$update": {"ARO_category": {"$update": {"40948": {"$update": {"category_aro_name": "Para-aminosalicylic acid", "category_aro_description": "Para-aminosalicylic acid (PAS) is an anti-tubercular antibiotic agent, often used in conjunction with Isoniazid for treatment of M. tuberculosis infections. PAS diminishes bacterial cell growth by limiting folic acid production."}}}}}, "$insert": {"CARD_short_name": "Mtub_thyA_PAS"}}, "1609": {"$update": {"ARO_description": "QnrC is a plasmid-mediated quinolone resistance protein found in Proteus mirabilis.", "model_sequences": {"$update": {"sequence": {"$update": {"508": {"$update": {"dna_sequence": {"$update": {"accession": "EU917444.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrC"}}, "1608": {"$insert": {"CARD_short_name": "MexT"}}, "4987": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7362": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-674"}}, "1979": {"$update": {"ARO_description": "FosA4 is an enzyme that confers resistance to fosfomycin in Escherichia coli by breaking the epoxide ring of the molecule.", "model_sequences": {"$update": {"sequence": {"$update": {"1439": {"$update": {"dna_sequence": {"$update": {"accession": "AB908992.1"}}}}}}}}}, "$insert": {"CARD_short_name": "FosA4"}}, "1978": {"$update": {"ARO_description": "OXA-200 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1294": {"$update": {"dna_sequence": {"$update": {"accession": "HQ734811.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-200"}}, "1601": {"$update": {"ARO_description": "LRA-1 is a beta-lactamase isolated from soil samples in Alaska.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LRA-1"}}, "1600": {"$insert": {"CARD_short_name": "Paer_PhoP_CST"}}, "1603": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1564": {"$update": {"dna_sequence": {"$update": {"accession": "DQ328802.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-86"}}, "1602": {"$update": {"ARO_description": "AAC(6')-Iai is an aminoglycoside acetyltransferase encoded by plasmids and integrons in P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"708": {"$update": {"dna_sequence": {"$update": {"accession": "EU886977.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Iai"}}, "1605": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1501": {"$update": {"dna_sequence": {"$update": {"accession": "AY227051.1"}}}}}}}}}, "$insert": {"CARD_short_name": "cphA5"}}, "1604": {"$update": {"ARO_description": "CTX-M-84 is a beta-lactamase found in Salmonella enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"1257": {"$update": {"dna_sequence": {"$update": {"accession": "FJ214367.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-84"}}, "1607": {"$update": {"ARO_description": "PBP1a is a penicillin-binding protein found in Streptococcus pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"692": {"$update": {"dna_sequence": {"$update": {"accession": "JN645776.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "40661": {"$update": {"category_aro_description": "Mutations in PBP transpeptidases that change the affinity for penicillin thereby conferring resistance to penicillin antibiotics."}}}}}, "$insert": {"CARD_short_name": "Spne_PBP1a_AMX"}}, "1606": {"$update": {"ARO_description": "CTX-M-16 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"767": {"$update": {"dna_sequence": {"$update": {"accession": "AY029068.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-16"}}, "809": {"$update": {"ARO_description": "lnuB is a plasmid-mediated nucleotidyltransferase found in Streptococcus lutetiensis."}, "$insert": {"CARD_short_name": "lnuB"}}, "808": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1244": {"$update": {"dna_sequence": {"$update": {"accession": "GQ149347.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-171"}}, "803": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1409": {"$update": {"dna_sequence": {"$update": {"accession": "AY227050.1"}}}}}}}}}, "$insert": {"CARD_short_name": "cphA4"}}, "802": {"$update": {"ARO_description": "QnrA3 is a plasmid-mediated quinolone resistance protein found in Shewanella algae.", "model_sequences": {"$update": {"sequence": {"$update": {"510": {"$update": {"dna_sequence": {"$update": {"accession": "DQ058661.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrA3"}}, "801": {"$update": {"ARO_description": "mfpA is a qnr homolog and a pentapeptide repeat protein that confers resistance to fluoroquinolones in Mycolicibacterium smegmatis.", "model_sequences": {"$update": {"sequence": {"$update": {"4588": {"$update": {"dna_sequence": {"$update": {"accession": "AL123456.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "mfpA"}}, "800": {"$update": {"ARO_description": "CTX-M-87 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1479": {"$update": {"dna_sequence": {"$update": {"accession": "EU545409.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-87"}}, "807": {"$update": {"ARO_description": "OKP-B-1 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"8216": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTTATGTTCGCCTGTGCCTTATCTCCCTGATTGCCGCCCTGCCACTGGCGGTATTCGCCAGCCCTCAGCCGCTTGAGCAGATTAAAATCAGCGAAGGTCAGCTGGCGGGCCGGGTGGGCTATGTTGAAATGGATCTGGCCAGCGGCCGCATGCTGGCCGCCTGGCGCGCCAGTGAGCGCTTTCCGCTGATGAGCACCTTTAAAGTGCTGCTCTGCGGCGCGGTGCTGGCCCGGGTGGATGCCGGCGACGAACAGCTGGATCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCCGTCAGCGAAAAACACCTTGCCGACGGGATGACCGTTGGCGAACTCTGCGCCGCCGCCATCACCATGAGCGACAACAGCGCCGGCAATCTGCTGTTGAAGAGCGTCGGCGGCCCCGCGGGATTGACCGCTTTTCTGCGCCAGATCGGTGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTCAATGAGGCGCTTCCCGGCGACGTGCGCGACACCACCACCCCGGCCAGCATGGCCACCACCCTGCGCAAGTTGCTAACCACCCCCTCTCTGAGCGCCCGTTCGCAGCAGCAGCTGCTGCAGTGGATGGTGGACGACCGGGTGGCCGGCCCGTTGATCCGCGCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAAACCGGGGCCGGTGAGCGGGGCTCACGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAAGCGGAGCGTATCGTGGTGATCTATCTGCGGGATACCGCGGCGACCATGGCCGAACGTAACCAGCAGATCGCCGGGATAGGCGCGGCGCTGATCGAGCACTGGCAGCGCTAG", "fmax": "861", "accession": "AJ635402.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAG25813.2", "sequence": "MRYVRLCLISLIAALPLAVFASPQPLEQIKISEGQLAGRVGYVEMDLASGRMLAAWRASERFPLMSTFKVLLCGAVLARVDAGDEQLDRRIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAGNLLLKSVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDVRDTTTPASMATTLRKLLTTPSLSARSQQQLLQWMVDDRVAGPLIRAVLPAGWFIADKTGAGERGSRGIVALLGPDGKAERIVVIYLRDTAATMAERNQQIAGIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-B-1"}}, "806": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1064": {"$update": {"dna_sequence": {"$update": {"accession": "JX121117.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-150"}}, "805": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"52": {"$update": {"dna_sequence": {"$update": {"accession": "U57969.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MexC"}}, "804": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"473": {"$update": {"dna_sequence": {"$update": {"accession": "L20800.1"}}}}}}}}}, "$insert": {"CARD_short_name": "tetB(P)"}}, "2848": {"$update": {"model_name": "MCR-4.1"}, "$insert": {"CARD_short_name": "MCR-4.1"}}, "2849": {"$update": {"model_name": "MCR-5.1"}, "$insert": {"CARD_short_name": "MCR-5.1"}}, "2846": {"$insert": {"CARD_short_name": "BUT-1"}}, "1849": {"$update": {"ARO_description": "Specific mutations that arise in Mycobacterium tuberculosis tlyA resulting in aminoglycosides resistance.", "model_sequences": {"$update": {"sequence": {"$update": {"2076": {"$update": {"dna_sequence": {"$update": {"accession": "AE000516.1"}}}}}}}}, "ARO_category": {"$update": {"40036": {"$update": {"category_aro_description": "tlyA encodes for hemolysin. It Catalyzes the 2'-O-methylation at nucleotides C1409 in 16S rRNA and C1920 in 23S rRNA. Mutation that arise within this gene reduces the binding affinity of aminoglycosides to rRNA."}}}}}, "$insert": {"CARD_short_name": "Mtub_tlyA_AMG"}}, "2844": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5508": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Cereibacter sphaeroides 2.4.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Rsph_ampC_BLA"}}, "2845": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Lhon_ampC_BLA"}}, "2842": {"$update": {"ARO_category": {"$update": {"41452": {"$update": {"category_aro_name": "Subclass B1 Vibrio cholerae varG beta-lactamase"}}}}}, "$insert": {"CARD_short_name": "Vcho_varG"}}, "2843": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}, "model_name": "Escherichia coli ampC beta-lactamase"}, "$insert": {"CARD_short_name": "Ecol_ampC_BLA"}}, "2840": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"4191": {"$update": {"dna_sequence": {"$update": {"accession": "AY027589.1"}}, "protein_sequence": {"$update": {"accession": "AAK14791.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "NPS-1"}}, "2841": {"$update": {"ARO_description": "Point mutation in the 23S rRNA of Escherichia coli shown clinically to confer resistance to chloramphenicol.", "model_sequences": {"$update": {"sequence": {"$update": {"4193": {"$update": {"dna_sequence": {"$update": {"accession": "AE014075.1"}}}}}}}}, "ARO_category": {"$update": {"41350": {"$update": {"category_aro_description": "Point mutations in the 23S rRNA subunit shown clinically to confer resistance to phenicol class antibiotics, including chloramphenicol and florfenicol, by disrupting antibiotic binding-site affinity."}}}}}, "$insert": {"CARD_short_name": "Ecol_23S_CHL"}}, "3320": {"$update": {"ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS10"}}, "3321": {"$update": {"ARO_description": "AAC(3)-IIe is a plasmid-encoded aminoglycoside acetyltransferase in E. coli."}, "$insert": {"CARD_short_name": "AAC(3)-IIe"}}, "5474": {"$insert": {"CARD_short_name": "PDC-344"}}, "3323": {"$update": {"ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS11"}}, "3324": {"$update": {"ARO_description": "Erm(49) is an rRNA methylase gene."}, "$insert": {"CARD_short_name": "Erm(49)"}}, "5473": {"$insert": {"CARD_short_name": "PDC-343"}}, "3326": {"$update": {"ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS15"}}, "5471": {"$insert": {"CARD_short_name": "PDC-341"}}, "3328": {"$insert": {"CARD_short_name": "AAC(6')-Im"}}, "3329": {"$update": {"model_name": "Mycoplasma genitalium parC mutations confers resistance to Moxifloxacin"}, "$insert": {"CARD_short_name": "Mgen_parC_MXF"}}, "5478": {"$insert": {"CARD_short_name": "PDC-349"}}, "5479": {"$insert": {"CARD_short_name": "PDC-35"}}, "1775": {"$update": {"ARO_description": "QnrS7 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"348": {"$update": {"dna_sequence": {"$update": {"accession": "KF730651.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS7"}}, "1774": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1271": {"$update": {"dna_sequence": {"$update": {"accession": "HQ913565.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-106"}}, "1777": {"$update": {"ARO_description": "OXA-177 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"968": {"$update": {"dna_sequence": {"$update": {"accession": "HM113563.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-177"}}, "1776": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1788": {"$update": {"dna_sequence": {"$update": {"accession": "JX121126.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-159"}}, "1771": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"928": {"$update": {"dna_sequence": {"$update": {"accession": "JX042489.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-19"}}, "1770": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1644": {"$update": {"dna_sequence": {"$update": {"accession": "AY368236.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-127"}}, "1773": {"$insert": {"CARD_short_name": "tet(43)"}}, "1772": {"$update": {"ARO_description": "aadA11 is an integron-encoded aminoglycoside nucleotidyltransferase gene in E. coli and P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"13": {"$update": {"dna_sequence": {"$update": {"accession": "AY758206.1"}}}}}}}}, "ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "aadA11"}}, "1779": {"$update": {"ARO_description": "CTX-M-12 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1008": {"$update": {"dna_sequence": {"$update": {"accession": "AF305837.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-12"}}, "1778": {"$update": {"ARO_description": "OKP-A-5 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1598": {"$update": {"dna_sequence": {"$update": {"accession": "AM051143.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-A-5"}}, "3972": {"$update": {"ARO_description": "A beta-lactamase gene found in Klebsiella pneumoniae. Directly submitted to NCBI without publication on 07-NOV-2018.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-217"}}, "3975": {"$update": {"ARO_description": "A beta-lactamase gene found in Klebsiella pneumoniae. Directly submitted to NCBI without publication on 07-NOV-2018.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-202"}}, "3957": {"$update": {"ARO_description": "A beta-lactamase gene found in Klebsiella pneumoniae. Directly submitted to NCBI without publication on 07-NOV-2018.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-214"}}, "3974": {"$update": {"ARO_description": "A beta-lactamase gene found in Klebsiella pneumonia. Directly submitted to NCBI without publication on 07-NOV-2018.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-221"}}, "5142": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-843"}}, "1159": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1796": {"$update": {"dna_sequence": {"$update": {"accession": "AJ746225.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-129"}}, "1158": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1474": {"$update": {"dna_sequence": {"$update": {"accession": "AF117746.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-22"}}, "1155": {"$update": {"ARO_description": "ACT-9 is a beta-lactamase found in Pantoea agglomerans.", "model_sequences": {"$update": {"sequence": {"$update": {"819": {"$update": {"dna_sequence": {"$update": {"accession": "HQ693810.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-9"}}, "1154": {"$update": {"model_sequences": {"$update": {"sequence": {"8177": {"dna_sequence": {"partial": "0", "sequence": "ATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTCCGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCACGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA", "fmax": "861", "accession": "DQ105529.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "AAZ14084.2", "sequence": "MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLPDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSHGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-146"}}, "1157": {"$update": {"ARO_description": "VanG is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Ser, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity in Enterococcus faecalis.", "model_sequences": {"$update": {"sequence": {"$update": {"300": {"$update": {"dna_sequence": {"$update": {"accession": "DQ212986.1"}}}}}}}}, "ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "vanG"}}, "1156": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"249": {"$update": {"dna_sequence": {"$update": {"accession": "AF079138.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}, "37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "Erm(31)"}}, "1151": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1684": {"$update": {"dna_sequence": {"$update": {"accession": "JX089628.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-240"}}, "1150": {"$update": {"ARO_description": "QnrVC5 is an integron-mediated quinolone resistance protein found in Vibrio fluvialis.", "model_sequences": {"$update": {"sequence": {"$update": {"572": {"$update": {"dna_sequence": {"$update": {"accession": "JN408080.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrVC5"}}, "1153": {"$update": {"ARO_description": "KPC-3 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1192": {"$update": {"dna_sequence": {"$update": {"accession": "AF395881.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-3"}}, "1152": {"$update": {"ARO_description": "CTX-M-39 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1431": {"$update": {"dna_sequence": {"$update": {"accession": "AY954516.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-39"}}, "5519": {"$insert": {"CARD_short_name": "PDC-39"}}, "5518": {"$insert": {"CARD_short_name": "PDC-389"}}, "5368": {"$insert": {"CARD_short_name": "PDC-229"}}, "2807": {"$update": {"ARO_description": "Point mutation in the 23S rRNA of Escherichia coli shown clinically to confer resistance to clarithromycin, a macrolide antibiotic."}, "$insert": {"CARD_short_name": "Ecol_23S_CLR"}}, "5511": {"$insert": {"CARD_short_name": "PDC-381"}}, "1555": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6223": {"$update": {"dna_sequence": {"$update": {"accession": "JN051143.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-140"}}, "5513": {"$insert": {"CARD_short_name": "PDC-383"}}, "5512": {"$insert": {"CARD_short_name": "PDC-382"}}, "5515": {"$insert": {"CARD_short_name": "PDC-386"}}, "5514": {"$insert": {"CARD_short_name": "PDC-385"}}, "5517": {"$insert": {"CARD_short_name": "PDC-388"}}, "5516": {"$insert": {"CARD_short_name": "PDC-387"}}, "1551": {"$update": {"ARO_description": "OXA-78 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1616": {"$update": {"dna_sequence": {"$update": {"accession": "AY862132.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-78"}}, "1550": {"$update": {"ARO_description": "smeR is the responder component of a two component signal transduction system that includes smeS.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "smeR"}}, "1553": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"619": {"$update": {"dna_sequence": {"$update": {"accession": "L09756.1"}}}}}}}}}, "$insert": {"CARD_short_name": "tetS"}}, "1552": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1597": {"$update": {"dna_sequence": {"$update": {"accession": "AF441286.1"}}}}}}}}, "model_name": "MUS-1"}, "$insert": {"CARD_short_name": "MUS-1"}}, "59": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1685": {"$update": {"dna_sequence": {"$update": {"accession": "HE616889.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-256"}}, "58": {"$update": {"ARO_description": "QnrB47 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"147": {"$update": {"dna_sequence": {"$update": {"accession": "JX440358.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB47"}}, "1557": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"917": {"$update": {"dna_sequence": {"$update": {"accession": "LN515533.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-187"}}, "1556": {"$update": {"ARO_description": "VIM-13 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1005": {"$update": {"dna_sequence": {"$update": {"accession": "DQ365886.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-13"}}, "55": {"$update": {"ARO_description": "OXA-69 is a beta-lactamase found in A. baumannii.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-69"}}, "54": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1160": {"$update": {"dna_sequence": {"$update": {"accession": "KC292503.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-34"}}, "57": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1637": {"$update": {"dna_sequence": {"$update": {"accession": "AB023477.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-24"}}, "56": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-7"}}, "51": {"$update": {"ARO_description": "AAC(3)-IIIc is an aminoglycoside acetyltransferase in P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"9": {"$update": {"dna_sequence": {"$update": {"accession": "L06161.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(3)-IIIc"}}, "50": {"$update": {"ARO_description": "SME-2 is a beta-lactamase found in Serratia marcescens.", "model_sequences": {"$update": {"sequence": {"$update": {"1396": {"$update": {"dna_sequence": {"$update": {"accession": "AF275256.1"}}}}}}}}}, "$insert": {"CARD_short_name": "SME-2"}}, "53": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1286": {"$update": {"dna_sequence": {"$update": {"accession": "GQ152600.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MOX-5"}}, "52": {"$update": {"ARO_description": "OXY-2-2 is a beta-lactamase found in Klebsiella oxytoca.", "model_sequences": {"$update": {"sequence": {"$update": {"1220": {"$update": {"dna_sequence": {"$update": {"accession": "AF473577.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXY-2-2"}}, "537": {"$update": {"ARO_description": "OXA-120 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1203": {"$update": {"dna_sequence": {"$update": {"accession": "HE963768.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-120"}}, "536": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"933": {"$update": {"dna_sequence": {"$update": {"accession": "AJ308558.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-95"}}, "535": {"$update": {"ARO_description": "Point mutation in Morganella morganii resulting in fluoroquinolone resistance.", "model_name": "Morganella morganii gyrB conferring resistance to fluoroquinolones"}, "$insert": {"CARD_short_name": "Mmor_gyrB_FLO"}}, "534": {"$update": {"ARO_description": "Also known as vanVB, is a vanV variant found in the vanB gene cluster. It is found in some but not all vanB operons in E. faecalis, suggesting the existence of varied gene compositions in vanB operons.", "model_sequences": {"$update": {"sequence": {"$update": {"4564": {"$update": {"dna_sequence": {"$update": {"accession": "AE016830.1"}}}}}}}}, "model_name": "vanV gene in vanB cluster", "ARO_name": "vanV gene in vanB cluster"}, "$insert": {"CARD_short_name": "vanV_in_vanB_cl"}}, "533": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"4562": {"$update": {"dna_sequence": {"$update": {"accession": "HF953351.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-16"}}, "532": {"$update": {"ARO_description": "CTX-M-47 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"825": {"$update": {"dna_sequence": {"$update": {"accession": "AY847143.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-47"}}, "531": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"673": {"$update": {"dna_sequence": {"$update": {"accession": "Z48231.1"}}}}}}}}}, "$insert": {"CARD_short_name": "SAT-3"}}, "530": {"$update": {"ARO_description": "VIM-11 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"8189": {"dna_sequence": {"partial": "0", "sequence": "ATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATCATGGCTATTGCGAGTCCGCTCGCTTTTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCGGTCGGGGAGGTCCGGCTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAAAACACAGCGGCACTTCTCGCGGAGATTGAGAAGCAAATTGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCGGCGGCGTTGATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGTAGAGGGGAGCGAGATTCCCACGCACTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAACTCTTCTATCCTGGTGCTGCGCATTCGACCGACAACTTAGTTGTGTACGTCCCGTCTGCGAGTGTGCTCTATGGTGGTTGTGCGATTTATGAGTTGTCACGCACGTCTGCGGGGAACGTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCATTGAGCGGATTCAACAACACTACCCGGAAGCACAGTTCGTCATTCCGGGGCACGGCCTGCCGGGCGGTCTAGACTTGCTCAAGCACACAACGAATGTTGTAAAAGCGCACACAAATCGCTCAGTCGTTGAGTAG", "fmax": "928", "accession": "AY605049.2", "fmin": "127", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "AAT36613.1", "sequence": "MFKLLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGSEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-11"}}, "539": {"$update": {"ARO_description": "QnrB59 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"$update": {"574": {"$update": {"dna_sequence": {"$update": {"accession": "JX259320.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB59"}}, "3299": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Kpne_KpnH"}}, "4691": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7066": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-64"}}, "5139": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-840"}}, "1558": {"$update": {"model_sequences": {"$update": {"sequence": {"8183": {"dna_sequence": {"partial": "0", "sequence": "TTGCTGATTAAAAAGAATGCTTTATCAATATTAAAAATCGTTTTTCCTATTGCTGTTTTGCTATTTGTTATTTATCAATCGAAAAAAGAACTGACAAATCTGTCATTCAAACGTACGCTCATGGTCATCAACGGACTGGAACGAACGGATTTATTCATGCTTGTGTTGATCGGCTTGCTGGCTGTTGCGGCTATGTCGCTGTATGATTACGTCCTGAAGTACTCACTGCGCCTATCGATCACAAACGGAAAAGTTTTCAGGGTTTCCTGGATCGCCAATTCATTTAATAATGTGTTGGGATTCGGCGGTTTAGCCGGAGTCGGGTTAAGAATGATGTTCTATAAGGAGCATACGAAAGACCATAAGGCACTCGTGAAAGGAATCGCCTGGCTCACATCATCTATGCTGCTCGGATTATCTGTTTTCAGCATTTTCGTTGCTGCGAGAGTGCTGCCAGTTGATGAAGTGATTCATGAGAAGCCTTGGCTGTGGGCGGTCGTTATCGGTTTTGCACTGATATTGCCGTTATCTTTAGCGGTGTCCAAAATAAAAGACCGCAAAGCTGGGGACGAAGAGAATGCGGATAAAGTGAAAAATCCGATTTTCGCATATATTGGAGCTTCAGTTGTTGAATGGCTCATGGCCGGGACCGTCATCTATTTTGCTTTGTTCGCTATGGGCATTCATGCAGATATCAGGTATGTGTTCGGGGTGTTCGTCATTGCGGCGATCGGAGGAATGATCAGCCTCGTGCCGGGCGGCTTCGGCTCGTTTGACCTTTTATTTTTGCTGGGGATGGAGCAGCTTGGCTATCATCAAGAGGCCATCGTTACTTCTATTGTGTTGTACAGGCTCGCCTACTCATTTATCCCATTTATCTTGGGACTGTTCTTTGCCGCCGGCGACCTGACGGAAAATACAATGAAGCGGCTCGAAACGAACCCGCGCATCGCACCGGCAATTGAGACGACAAACGTTCTGCTTGTTGTTCAGCGTGCGGTATTAGTGAGAATTTTGCAAGGCTCGCTTTCCCTTATTGTGTTCGTAGCAGGTCTGATTGTCTTGGCCTCAGTTTCCTTGCCGATTGACAGGCTGACGGTTATACCGCACATTCCGCGCCCGGCGCTTTTGCTGTTCAACGGCCTGTCCTTAAGCTCAGCGCTCATTCTGCTCATTTTGCCGATCGAGCTTTATAAACGGACAAAACGTTCCTACACGATGGCCATTACAGCGCTTGTCGGCGGCTTTGTGTTCAGCTTTTTAAAAGGGCTTAACATCAGCGCGATATTCGTACTGCCGATGATTATCGTATTGCTTGTGCTATTGAAAAAACAATTTGTCCGCGAACAGGCATCCTATACACTGGGACAATTGATATTCGCTGTGGCGCTGTTTACTGTGGCGCTCTTTAACTACAATCTGATCGCGGGCTTTATTTGGGACCGGATGAAGAAGGTGCTGCGTCACGAATATTTCGTCCACAGCACCTCGCATATTACACATGCAACCATCATGGCGATCATCATTGTGCCGCTGTTCTTCTTGATATTTACAGTGGTCTATCATAAGAGAACGAAACCGATCGGAGAGAAAGCTGACCCTGAGCGTCTTGCTGCGTTTCTCAATGAAAAAGGCGGCAACGCGCTGAGCCATCTTGGTTTTCTTGGAGATAAGCGGTTTTATTTTTCTAGCGATGGAAATGCACTGCTTCTGTTTGGGAAAATCGCCAGAAGGCTGGTCGTGCTCGGCGATCCATCTGGCCAAAGAGAATCATTCCCGCTCGTGCTGGAAGAATTTCTGAACGAAGCGCATCAGAAGGGATTCAGTGTTTTGTTCTATCAAATTGAACGAGAGGACATGGCGCTGTATCACGATTTTGGCTACAACTTCTTTAAATTGGGTGAGGAAGCATATGTAGATTTAAATACATTTACCTTGACTGGGAAGAAAAAAGCCGGCCTTCGGGCAATCAATAACCGCTTTGAGCGGGAGGAGTATACTTTCCATGTGGATCATCCCCCATTTTCTGATGCGTTTTTGGAGGAGCTGAAGCAAATCTCAGACGAATGGCTCGGCTCGAAAAAAGAGAAGGGATTCTCGCTCGGATTTTTTGATCCTTCCTATTTACAGAAAGCGCCGATCGCCTATATGAAAAATGCAGAAGGAGAGATCGTTGCATTCGCAAATGTCATGCCGATGTACCAGGAAGGAGAGATATCGGTCGATCTGATGCGCTATCGCGGCGACGCTCCAAATGGCATTATGGACGCATTGTTTATCCGTATGTTTTTATGGGCAAAGGAAGAGGGCTGTACGTCATTTAATATGGGGATGGCACCCTTGGCCAATGTCGGCACTGCCTTTACATCCTTCTGGTCCGAAAGGTTTGCCGCTGTCATTTTTAATAATGTCAGATACATGTACAGTTTCAGCGGCCTAAGAGCCTTTAAAGAAAAATATAAACCGGAGTGGCGAGGGAAATACTTAGCGTATCGGAAAAACAGATCTCTTTCTGTCACCATGTTCCTCGTTACACGTCTGATTGGCAAAAGCAAAAAAGACTCCGTCTAA", "fmax": "919348", "accession": "AL009126.3", "fmin": "916777", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Bacillus subtilis subsp. subtilis str. 168", "NCBI_taxonomy_id": "224308", "NCBI_taxonomy_cvterm_id": "39579"}, "protein_sequence": {"accession": "CAX52582.1", "sequence": "MLIKKNALSILKIVFPIAVLLFVIYQSKKELTNLSFKRTLMVINGLERTDLFMLVLIGLLAVAAMSLYDYVLKYSLRLSITNGKVFRVSWIANSFNNVLGFGGLAGVGLRMMFYKEHTKDHKALVKGIAWLTSSMLLGLSVFSIFVAARVLPVDEVIHEKPWLWAVVIGFALILPLSLAVSKIKDRKAGDEENADKVKNPIFAYIGASVVEWLMAGTVIYFALFAMGIHADIRYVFGVFVIAAIGGMISLVPGGFGSFDLLFLLGMEQLGYHQEAIVTSIVLYRLAYSFIPFILGLFFAAGDLTENTMKRLETNPRIAPAIETTNVLLVVQRAVLVRILQGSLSLIVFVAGLIVLASVSLPIDRLTVIPHIPRPALLLFNGLSLSSALILLILPIELYKRTKRSYTMAITALVGGFVFSFLKGLNISAIFVLPMIIVLLVLLKKQFVREQASYTLGQLIFAVALFTVALFNYNLIAGFIWDRMKKVLRHEYFVHSTSHITHATIMAIIIVPLFFLIFTVVYHKRTKPIGEKADPERLAAFLNEKGGNALSHLGFLGDKRFYFSSDGNALLLFGKIARRLVVLGDPSGQRESFPLVLEEFLNEAHQKGFSVLFYQIEREDMALYHDFGYNFFKLGEEAYVDLNTFTLTGKKKAGLRAINNRFEREEYTFHVDHPPFSDAFLEELKQISDEWLGSKKEKGFSLGFFDPSYLQKAPIAYMKNAEGEIVAFANVMPMYQEGEISVDLMRYRGDAPNGIMDALFIRMFLWAKEEGCTSFNMGMAPLANVGTAFTSFWSERFAAVIFNNVRYMYSFSGLRAFKEKYKPEWRGKYLAYRKNRSLSVTMFLVTRLIGKSKKDSV"}}}}}}, "$insert": {"CARD_short_name": "Bsub_mprF"}}, "5138": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-839"}}, "5605": {"$insert": {"CARD_short_name": "PDC-64"}}, "5604": {"$insert": {"CARD_short_name": "PDC-60"}}, "5607": {"$insert": {"CARD_short_name": "PDC-94"}}, "5606": {"$insert": {"CARD_short_name": "PDC-71"}}, "5601": {"$insert": {"CARD_short_name": "PDC-475"}}, "5600": {"$insert": {"CARD_short_name": "PDC-474"}}, "5603": {"$insert": {"CARD_short_name": "PDC-58"}}, "5602": {"$insert": {"CARD_short_name": "PDC-476"}}, "9": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1584": {"$update": {"dna_sequence": {"$update": {"accession": "LC004922.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-35"}}, "5609": {"$insert": {"CARD_short_name": "PDC-96"}}, "5135": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-833"}}, "3297": {"$insert": {"CARD_short_name": "erm(46)"}}, "1419": {"$update": {"ARO_description": "Assigned by Lahey's list of beta-lactamases, no accessions or other information available.", "model_sequences": {"$update": {"sequence": {"$update": {"2122": {"$update": {"dna_sequence": {"$update": {"accession": "LC037981.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-454"}}, "3290": {"$insert": {"CARD_short_name": "tet(53)"}}, "5132": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7507": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-830"}}, "429": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "mdsA"}}, "428": {"$update": {"ARO_description": "OXY-2-7 is a beta-lactamase found in Klebsiella oxytoca.", "model_sequences": {"$update": {"sequence": {"$update": {"1618": {"$update": {"dna_sequence": {"$update": {"accession": "Z49084.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXY-2-7"}}, "3292": {"$insert": {"CARD_short_name": "tet(54)"}}, "1399": {"$update": {"ARO_description": "OXA-315 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1531": {"$update": {"dna_sequence": {"$update": {"accession": "KF057032.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-315"}}, "1398": {"$update": {"ARO_description": "OXA-108 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1367": {"$update": {"dna_sequence": {"$update": {"accession": "EF650034.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-108"}}, "421": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1724": {"$update": {"dna_sequence": {"$update": {"accession": "X54606.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-2"}}, "420": {"$update": {"ARO_description": "CTX-M-1 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1916": {"$update": {"dna_sequence": {"$update": {"accession": "X92506.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-1"}}, "423": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1012": {"$update": {"dna_sequence": {"$update": {"accession": "KM087852.1"}}}}}}}}}, "$insert": {"CARD_short_name": "DHA-16"}}, "422": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"951": {"$update": {"dna_sequence": {"$update": {"accession": "JX049131.1"}}}}}}}}, "ARO_category": {"$update": {"36206": {"$update": {"category_aro_description": "FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins."}}}}}, "$insert": {"CARD_short_name": "FOX-10"}}, "1393": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1081": {"$update": {"dna_sequence": {"$update": {"accession": "AJ250876.1"}}}}}}}}, "model_name": "THIN-B", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "THIN-B"}}, "1392": {"$update": {"ARO_description": "aadA22 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in S. enterica and E. coli.", "model_sequences": {"$update": {"sequence": {"$update": {"238": {"$update": {"dna_sequence": {"$update": {"accession": "AM261837.1"}}}}}}}}, "ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "aadA22"}}, "427": {"$update": {"ARO_description": "OCH-7 beta-lactamase is an Ambler class C chromosomal-encoded beta-lactamase in Brucella anthropi.", "model_sequences": {"$update": {"sequence": {"$update": {"1900": {"$update": {"dna_sequence": {"$update": {"accession": "AJ295345.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Brucella anthropi"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36233": {"$update": {"category_aro_description": "OCH beta-lactamases are Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi."}}}}}, "$insert": {"CARD_short_name": "OCH-7"}}, "426": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"4533": {"$update": {"dna_sequence": {"$update": {"accession": "AL009126.1"}}}}}}}}, "ARO_category": {"$update": {"36364": {"$update": {"category_aro_description": "Nucelotidylylation of streptomycin at the hydroxyl group at position 6."}}}}}, "$insert": {"CARD_short_name": "aadK"}}, "3812": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ROB-6"}}, "3813": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ROB-7"}}, "3810": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ROB-4"}}, "3811": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ROB-5"}}, "3816": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ROB-10"}}, "3817": {"$insert": {"CARD_short_name": "Tthe_uL3_PLM"}}, "3814": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ROB-9"}}, "3815": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ROB-8"}}, "3818": {"$update": {"ARO_category": {"$update": {"41330": {"$update": {"category_aro_description": "Point mutations in the 23S rRNA subunit may confer resistance to pleuromutilin antibiotics."}}}}}, "$insert": {"CARD_short_name": "Tthe_23S_PLM"}}, "3819": {"$insert": {"CARD_short_name": "dfrA31"}}, "5124": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-821"}}, "3450": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-285"}}, "3627": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-4"}}, "3456": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-293"}}, "3457": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-294"}}, "4299": {"$insert": {"CARD_short_name": "ADC-234"}}, "4298": {"$insert": {"CARD_short_name": "ADC-233"}}, "4295": {"$insert": {"CARD_short_name": "ADC-230"}}, "4294": {"$insert": {"CARD_short_name": "ADC-229"}}, "4297": {"$insert": {"CARD_short_name": "ADC-232"}}, "4296": {"$insert": {"CARD_short_name": "ADC-231"}}, "4291": {"$insert": {"CARD_short_name": "ADC-226"}}, "4290": {"$insert": {"CARD_short_name": "ADC-225"}}, "4293": {"$insert": {"CARD_short_name": "ADC-228"}}, "4292": {"$insert": {"CARD_short_name": "ADC-227"}}, "1503": {"$update": {"ARO_description": "LEN-4 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"5855": {"$update": {"dna_sequence": {"$update": {"accession": "AY130287.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-4"}}, "4695": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-69"}}, "590": {"$update": {"ARO_description": "IND-6 is a beta-lactamase found in Chryseobacterium indologenes.", "model_sequences": {"$update": {"sequence": {"8287": {"dna_sequence": {"partial": "0", "sequence": "ATGAAAAGAAGAATTCAGTTCTTTATGGTTTCAATGATGCTTACCCCATTATTCAGTGCCCAGGTAAAAGATTTTGTAATTGAACCGCCAATAAAAAAGAACTTATATATTTATAAAACTTTCGGAGTGTTCGGGGGAAAAGAATATTCTGCCAATTCAGTGTATCTTGTCACCAAAACCGGGGTTGTTTTATTTGATGTTCCCTGGGAAAAAGCGCAATACCAAAGCCTGATGGATACCATCAAAAAACGTCATAATTTACCTGTTGTTGCGGTATTTGCGACACATTCCCATGATGACCGGGCAGGAGATTTAAGCTTTTTCAATAATAAAGGAATTAAAACCTATGCTACTCCTAAAACCAATCAATTTCTGAAAAGAGACGGAAAGGCTACTTCTACAGAGCTCATTAAGCCCGGAAAACCTTACCGCTTTGGCGGAGAGGAATTTGTAGTGGATTTTCTTGGTGAAGGGCATACTGCCGATAATGTAGTGGTATGGTTTCCAAAATATAAAGTGCTGGATGGCGGCTGCCTTGTAAAAAGCAATTCAGCTACCGATTTAGGGTATATCAAAGAAGCTAATCTAGAGCAATGGCCTAAAACCATGCATAAACTGAAAACAAAATATTCAGAAGCAGTATTAATTATTCCCGGACATGATGAATGGAAAGGCGGCGGGCACGTTGAACATACTTTGGAGCTGCTGGATAAGAAATAA", "fmax": "1011", "accession": "AM087455.2", "fmin": "291", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Chryseobacterium indologenes", "NCBI_taxonomy_id": "253", "NCBI_taxonomy_cvterm_id": "36916"}, "protein_sequence": {"accession": "CAJ32373.2", "sequence": "MKRRIQFFMVSMMLTPLFSAQVKDFVIEPPIKKNLYIYKTFGVFGGKEYSANSVYLVTKTGVVLFDVPWEKAQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATPKTNQFLKRDGKATSTELIKPGKPYRFGGEEFVVDFLGEGHTADNVVVWFPKYKVLDGGCLVKSNSATDLGYIKEANLEQWPKTMHKLKTKYSEAVLIIPGHDEWKGGGHVEHTLELLDKK"}}}}}, "ARO_category": {"$update": {"36199": {"$update": {"category_aro_description": "IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "IND-6"}}, "258": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1926": {"$update": {"dna_sequence": {"$update": {"accession": "FR853176.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-208"}}, "4694": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-67"}}, "5171": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-874"}}, "4749": {"$insert": {"CARD_short_name": "LHK-4"}}, "4748": {"$insert": {"CARD_short_name": "LHK-3"}}, "4743": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-27"}}, "4741": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-82"}}, "4740": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-81"}}, "4747": {"$insert": {"CARD_short_name": "LHK-2"}}, "4746": {"$insert": {"CARD_short_name": "LHK-1"}}, "4745": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-31"}}, "4744": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-28"}}, "3302": {"$insert": {"CARD_short_name": "tet(56)"}}, "4697": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-71"}}, "4715": {"$insert": {"CARD_short_name": "KLUC-2"}}, "2183": {"$update": {"ARO_description": "This inducible cluster confers resistance to vancomycin but organisms remain sensitive to teicoplanin by allowing restructuring of peptidoglycan precursors to end in D-Ala-D-Lac. Sensitivity to teicoplanin is due to lack of binding to the sensor kinase VanS. The vanB gene cluster can be located either on plasmids or on the chromosome. Gene orientation: vanRSYWHBX."}, "$insert": {"CARD_short_name": "vanB_cluster"}}, "2182": {"$update": {"ARO_description": "Homologous to vanA, contains a D-Ala-D-Lac ligase. This cluster is constitutively expressed in the chromosome due to a dysfunctional D-ala-D-ala ligase and confers moderate resistance to both vancomycin and teicoplanin. Gene orientation: vanRSYHDX."}, "$insert": {"CARD_short_name": "vanD_cluster"}}, "2181": {"$update": {"ARO_description": "Homologous to vanA, contains a D-Ala-D-Lac ligase. The vanF gene cluster is inducible and confers high resistance to vancomycin in Paenibacillus popilliae. vanF organisms remain susceptible to teicoplanin. Gene orientation: RSYZHFX."}, "$insert": {"CARD_short_name": "vanF_cluster"}}, "2180": {"$update": {"ARO_description": "Homologous to VanC, contains a D-Ala-D-Ser ligase. The chromosome-located vanL gene cluster is inducible and confers low resistance to vancomycin. vanL organisms remain susceptible to teicoplanin. It is the only van gene cluster with two vanT genes. Gene orientation: vanL(XY)TmTrRS."}, "$insert": {"CARD_short_name": "vanL_cluster"}}, "2186": {"$update": {"ARO_description": "Contains a D-Ala-D-Ser ligase. The vanG gene cluster is inducible and confers low resistance to vancomycin. vanG organisms remain susceptible to teicoplanin. It is the only van gene cluster that contains two vanY genes. Gene orientation: vanRSYWGYT."}, "$insert": {"CARD_short_name": "vanG_cluster"}}, "229": {"$update": {"ARO_description": "Also known as vanTmL, is a vanT variant found in the vanL gene cluster. vanTmL codes for the membrane-binding domain of vanTL.", "model_sequences": {"$update": {"sequence": {"$update": {"301": {"$update": {"dna_sequence": {"$update": {"accession": "EU250284.1"}}}}}}}}, "model_name": "vanTm gene in vanL cluster", "ARO_name": "vanTm gene in vanL cluster"}, "$insert": {"CARD_short_name": "vanTm_in_vanL"}}, "228": {"$update": {"ARO_description": "SdiA is a cell division regulator that is also a positive regulator of AcrAB only when it's expressed from a plasmid. When the sdiA gene is on the chromosome, it has no effect on expression of acrAB.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "sdiA"}}, "227": {"$update": {"ARO_description": "OKP-B-3 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1521": {"$update": {"dna_sequence": {"$update": {"accession": "AM051152.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-B-3"}}, "226": {"$update": {"ARO_description": "OXA-113 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1832": {"$update": {"dna_sequence": {"$update": {"accession": "EF653400.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-113"}}, "225": {"$insert": {"CARD_short_name": "CTX-M-88"}}, "224": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1733": {"$update": {"dna_sequence": {"$update": {"accession": "AY227752.1"}}}}}}}}, "ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-2"}}, "223": {"$update": {"ARO_description": "GES-3 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1708": {"$update": {"dna_sequence": {"$update": {"accession": "AB113580.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-3"}}, "222": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1483": {"$update": {"dna_sequence": {"$update": {"accession": "AY028464.1"}}}}}}}}, "model_name": "JOHN-1", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "JOHN-1"}}, "221": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1194": {"$update": {"dna_sequence": {"$update": {"accession": "KF526113.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-100"}}, "220": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1961": {"$update": {"dna_sequence": {"$update": {"accession": "AF143804.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-92"}}, "2213": {"$update": {"ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "opmE"}}, "2212": {"$update": {"ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "mexQ"}}, "2211": {"$update": {"ARO_description": "MexP is the membrane fusion protein of the MexPQ-OpmE multidrug efflux complex.", "ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "mexP"}}, "2217": {"$insert": {"CARD_short_name": "mexN"}}, "2216": {"$insert": {"CARD_short_name": "mexM"}}, "2215": {"$update": {"model_name": "Pseudomonas aeruginosa gyrA and parC conferring resistance to fluoroquinolones"}, "$insert": {"CARD_short_name": "Paer_ParC_FLO"}}, "2219": {"$update": {"ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "model_name": "MexL"}, "$insert": {"CARD_short_name": "MexL"}}, "2337": {"$insert": {"CARD_short_name": "ADC-4"}}, "5475": {"$insert": {"CARD_short_name": "PDC-345"}}, "5431": {"$insert": {"CARD_short_name": "PDC-300"}}, "864": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1701": {"$update": {"dna_sequence": {"$update": {"accession": "JF460795.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-61"}}, "151": {"$update": {"ARO_description": "OKP-A-15 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1200": {"$update": {"dna_sequence": {"$update": {"accession": "FJ755841.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-A-15"}}, "150": {"$update": {"ARO_description": "catB3 is a plasmid or chromosome-encoded variant of the cat gene found in Salmonella typhimurium, Acinetobacter baumannii and Escherichia coli.", "ARO_category": {"$update": {"36261": {"$update": {"category_aro_description": "Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini."}}}}}, "$insert": {"CARD_short_name": "catB3"}}, "153": {"$insert": {"CARD_short_name": "adeF"}}, "152": {"$insert": {"CARD_short_name": "cpxA"}}, "155": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1402": {"$update": {"dna_sequence": {"$update": {"accession": "JN935137.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-195"}}, "154": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "mgrA"}}, "157": {"$update": {"ARO_description": "dfrA21 is an integron-encoded dihydrofolate reductase found in Salmonella enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"383": {"$update": {"dna_sequence": {"$update": {"accession": "AM932669.1"}}}}}}}}}, "$insert": {"CARD_short_name": "dfrA21"}}, "156": {"$update": {"ARO_description": "AAC(6')-Iaf is an aminoglycoside acetyltransferase encoded by plasmids and integrons in P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"672": {"$update": {"dna_sequence": {"$update": {"accession": "AB462903.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Iaf"}}, "159": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"412": {"$update": {"dna_sequence": {"$update": {"accession": "DQ823382.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}}}}, "$insert": {"CARD_short_name": "vgaALC"}}, "158": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"204": {"$update": {"dna_sequence": {"$update": {"accession": "D16099.1"}}}}}}}}, "ARO_category": {"$update": {"37697": {"$update": {"category_aro_description": "Non-erm 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides."}}}}}, "$insert": {"CARD_short_name": "myrA"}}, "2430": {"$insert": {"CARD_short_name": "hp1181"}}, "2436": {"$update": {"ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "Ddl"}}, "2435": {"$insert": {"CARD_short_name": "lmrP"}}, "2434": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "40429": {"$update": {"category_aro_description": "Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin)."}}}}}, "$insert": {"CARD_short_name": "Kpne_OmpK36"}}, "4922": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-596"}}, "4637": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-24"}}, "4518": {"$insert": {"CARD_short_name": "CTX-M-189"}}, "4519": {"$insert": {"CARD_short_name": "CTX-M-190"}}, "4512": {"$insert": {"CARD_short_name": "CTX-M-183"}}, "4513": {"$insert": {"CARD_short_name": "CTX-M-184"}}, "4510": {"$insert": {"CARD_short_name": "CTX-M-181"}}, "4511": {"$insert": {"CARD_short_name": "CTX-M-182"}}, "4516": {"$insert": {"CARD_short_name": "CTX-M-187"}}, "4517": {"$insert": {"CARD_short_name": "CTX-M-188"}}, "4514": {"$insert": {"CARD_short_name": "CTX-M-185"}}, "4515": {"$insert": {"CARD_short_name": "CTX-M-186"}}, "5289": {"$insert": {"CARD_short_name": "PDC-151"}}, "5288": {"$insert": {"CARD_short_name": "PDC-150"}}, "2724": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems)."}, "$insert": {"CARD_short_name": "MuxABC-OpmB"}}, "2720": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5199": {"$update": {"protein_sequence": {"$update": {"accession": "AAG05914.1"}}}}}}}}}, "$insert": {"CARD_short_name": "MuxC"}}, "5281": {"$insert": {"CARD_short_name": "PDC-144"}}, "5280": {"$insert": {"CARD_short_name": "PDC-143"}}, "5283": {"$insert": {"CARD_short_name": "PDC-146"}}, "5282": {"$insert": {"CARD_short_name": "PDC-145"}}, "5285": {"$insert": {"CARD_short_name": "PDC-148"}}, "5284": {"$insert": {"CARD_short_name": "PDC-147"}}, "2729": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems)."}, "$insert": {"CARD_short_name": "MexJK-OprM"}}, "5286": {"$insert": {"CARD_short_name": "PDC-149"}}, "280": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1588": {"$update": {"dna_sequence": {"$update": {"accession": "AY005110.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-11"}}, "4367": {"$insert": {"CARD_short_name": "AXC-5"}}, "5049": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-740"}}, "5048": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-739"}}, "5047": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-738"}}, "5046": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7421": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-736"}}, "5045": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-735"}}, "5044": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-734"}}, "5043": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-733"}}, "5042": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-732"}}, "5041": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-731"}}, "5040": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-730"}}, "1807": {"$update": {"ARO_description": "OXA-70 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"980": {"$update": {"dna_sequence": {"$update": {"accession": "AY750912.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-70"}}, "1806": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-14"}}, "1805": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1953": {"$update": {"dna_sequence": {"$update": {"accession": "AY436361.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-131"}}, "1804": {"$update": {"ARO_description": "OXA-107 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1289": {"$update": {"dna_sequence": {"$update": {"accession": "EF650033.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-107"}}, "1803": {"$update": {"ARO_description": "QnrVC3 is an integron-mediated quinolone resistance protein found in Vibrio cholerae.", "model_sequences": {"$update": {"sequence": {"$update": {"483": {"$update": {"dna_sequence": {"$update": {"accession": "HM015626.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrVC3"}}, "1802": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1452": {"$update": {"dna_sequence": {"$update": {"accession": "HM488989.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-168"}}, "1801": {"$update": {"ARO_description": "AAC(6')-Ib11 is an integron-encoded aminoglycoside acetyltransferase in S. enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"366": {"$update": {"dna_sequence": {"$update": {"accession": "AY136758.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Ib11"}}, "1800": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1543": {"$update": {"dna_sequence": {"$update": {"accession": "JF812965.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-120"}}, "3788": {"$insert": {"CARD_short_name": "SatA"}}, "3789": {"$insert": {"CARD_short_name": "BLMT"}}, "1809": {"$update": {"ARO_description": "QnrB5 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"256": {"$update": {"dna_sequence": {"$update": {"accession": "DQ303919.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB5"}}, "1808": {"$insert": {"CARD_short_name": "tet(A)"}}, "4996": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-684"}}, "4997": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-685"}}, "4994": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-682"}}, "4995": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-683"}}, "4992": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-679"}}, "4993": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-680"}}, "4990": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-677"}}, "4991": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-678"}}, "4491": {"$insert": {"CARD_short_name": "CTX-M-143"}}, "4998": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-686"}}, "4999": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-687"}}, "5": {"$update": {"ARO_description": "dfrF is a chromosome-encoded dihydrofolate reductase found in Streptococcus pyogenes.", "model_sequences": {"$update": {"sequence": {"$update": {"677": {"$update": {"dna_sequence": {"$update": {"accession": "AF028812.1"}}}}}}}}}, "$insert": {"CARD_short_name": "dfrF"}}, "5436": {"$insert": {"CARD_short_name": "PDC-305"}}, "5561": {"$insert": {"CARD_short_name": "PDC-432"}}, "4684": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-54"}}, "3258": {"$update": {"ARO_description": "A dihydrofolate reductase and trimethoprim resistance gene from non-O1, non-O139 Vibrio cholerae."}, "$insert": {"CARD_short_name": "dfrA27"}}, "1256": {"$update": {"ARO_description": "bmr is an MFS antibiotic efflux pump that confers resistance to multiple drugs including acridine dyes, fluoroquinolone antibiotics, chloramphenicol, and puromycin.", "model_sequences": {"$update": {"sequence": {"$update": {"86": {"$update": {"dna_sequence": {"$update": {"accession": "M33768.1"}}}}}}}}, "ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "bmr"}}, "1948": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"927": {"$update": {"dna_sequence": {"$update": {"accession": "FJ360884.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-167"}}, "1949": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1579": {"$update": {"dna_sequence": {"$update": {"accession": "AY227052.1"}}}}}}}}}, "$insert": {"CARD_short_name": "cphA6"}}, "1525": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1798": {"$update": {"dna_sequence": {"$update": {"accession": "EF136377.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-160"}}, "1942": {"$update": {"model_name": "BJP-1"}, "$insert": {"CARD_short_name": "BJP-1"}}, "1943": {"$update": {"ARO_description": "Specific mutations on the Mycobacterium tuberculosis kasA gene resulting in lowered affinity of isoniazid, resulting in resistance.", "model_sequences": {"$update": {"sequence": {"$update": {"2084": {"$update": {"dna_sequence": {"$update": {"accession": "AL123456.1"}}}}}}}}}, "$insert": {"CARD_short_name": "Mtub_kasA_INH"}}, "1940": {"$update": {"ARO_description": "QnrB30 is a plasmid-mediated quinolone resistance protein found in Citrobacter braakii.", "model_sequences": {"$update": {"sequence": {"$update": {"327": {"$update": {"dna_sequence": {"$update": {"accession": "HM439650.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB30"}}, "1941": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"994": {"$update": {"dna_sequence": {"$update": {"accession": "AM941844.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-98"}}, "1946": {"$update": {"ARO_description": "CTX-M-10 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1995": {"$update": {"dna_sequence": {"$update": {"accession": "AY598759.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-10"}}, "1947": {"$insert": {"CARD_short_name": "CTX-M-160"}}, "3256": {"$update": {"ARO_description": "A dihydrofolate reductase and trimethoprim resistance gene identified from porcine isolates of Esherichia coli."}, "$insert": {"CARD_short_name": "dfrA9"}}, "1945": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1236": {"$update": {"dna_sequence": {"$update": {"accession": "AY288915.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-50"}}, "818": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1634": {"$update": {"dna_sequence": {"$update": {"accession": "JQ388884.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-141"}}, "819": {"$update": {"ARO_description": "CTX-M-68 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1274": {"$update": {"dna_sequence": {"$update": {"accession": "EU177100.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-68"}}, "1527": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1316": {"$update": {"dna_sequence": {"$update": {"accession": "AY289548.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-51"}}, "810": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "mecC"}}, "811": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-26"}}, "812": {"$update": {"ARO_description": "CMY-10 is a beta-lactamase found in Klebsiella aerogenes.", "model_sequences": {"$update": {"sequence": {"$update": {"1114": {"$update": {"dna_sequence": {"$update": {"accession": "AF357597.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-10"}}, "813": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1373": {"$update": {"dna_sequence": {"$update": {"accession": "FR865168.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-216"}}, "814": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1795": {"$update": {"dna_sequence": {"$update": {"accession": "AY589494.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-113"}}, "815": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1110": {"$update": {"dna_sequence": {"$update": {"accession": "AF090141.1"}}}}}}}}, "model_name": "GOB-1", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "GOB-1"}}, "816": {"$update": {"ARO_description": "OXA-3 is a beta-lactamase found in P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1051": {"$update": {"dna_sequence": {"$update": {"accession": "L07945.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-3"}}, "817": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1902": {"$update": {"dna_sequence": {"$update": {"accession": "KM211691.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-158"}}, "2859": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-80"}}, "1991": {"$update": {"ARO_description": "otrC is a tetracycline resistance efflux pump found in Streptomyces rimosus.", "model_sequences": {"$update": {"sequence": {"$update": {"421": {"$update": {"dna_sequence": {"$update": {"accession": "AY509111.1"}}}}}}}}}, "$insert": {"CARD_short_name": "otrC"}}, "3495": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-411"}}, "1522": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1709": {"$update": {"dna_sequence": {"$update": {"accession": "HQ875573.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-38"}}, "1990": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"905": {"$update": {"dna_sequence": {"$update": {"accession": "KJ207203.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-82"}}, "2851": {"$update": {"ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "Ecol_gyrA_TRC"}}, "2850": {"$update": {"ARO_category": {"$update": {"37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "Sent_gyrA_TRC"}}, "2853": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-74"}}, "1523": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"335": {"$update": {"dna_sequence": {"$update": {"accession": "U57969.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MexD"}}, "2855": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-76"}}, "1621": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"834": {"$update": {"dna_sequence": {"$update": {"accession": "AF547625.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-45"}}, "2857": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-78"}}, "2856": {"$update": {"ARO_description": "An AmpC-like beta-lactamase found in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "PDC-77"}}, "5461": {"$insert": {"CARD_short_name": "PDC-331"}}, "5460": {"$insert": {"CARD_short_name": "PDC-330"}}, "5463": {"$insert": {"CARD_short_name": "PDC-333"}}, "5462": {"$insert": {"CARD_short_name": "PDC-332"}}, "1494": {"$update": {"ARO_description": "LAT-1 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1988": {"$update": {"dna_sequence": {"$update": {"accession": "X78117.1"}}}}}}}}}, "$insert": {"CARD_short_name": "LAT-1"}}, "5464": {"$insert": {"CARD_short_name": "PDC-334"}}, "5467": {"$insert": {"CARD_short_name": "PDC-338"}}, "5466": {"$insert": {"CARD_short_name": "PDC-336"}}, "1498": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1731": {"$update": {"dna_sequence": {"$update": {"accession": "AY261375.1"}}}}}}}}}, "$insert": {"CARD_short_name": "cphA8"}}, "1499": {"$update": {"ARO_description": "VEB-6 is a beta-lactamase found in Proteus mirabilis.", "ARO_category": {"$update": {"36182": {"$update": {"category_aro_description": "VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam."}}}}}, "$insert": {"CARD_short_name": "VEB-6"}}, "3339": {"$insert": {"CARD_short_name": "dfrA15b"}}, "3338": {"$update": {"ARO_description": "AAC(6')-Iag is an aminoglycoside acetyltransferase encoded by integrons in Pseudomonas aeruginosa."}, "$insert": {"CARD_short_name": "AAC(6')-Iag"}}, "1395": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"54": {"$update": {"dna_sequence": {"$update": {"accession": "U75641.1"}}}}}}}}, "model_name": "Neisseria gonorrhoeae porin PIB (por)", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Ngon_porin"}}, "1994": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"626": {"$update": {"dna_sequence": {"$update": {"accession": "AJ223970.1"}}}}}}}}, "ARO_category": {"$update": {"37621": {"$update": {"category_aro_description": "Produced by Streptomyces bikiniensis."}}}}}, "$insert": {"CARD_short_name": "gimA"}}, "1700": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1018": {"$update": {"dna_sequence": {"$update": {"accession": "KJ207206.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-28"}}, "1701": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"274": {"$update": {"dna_sequence": {"$update": {"accession": "AY487229.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}, "37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "Erm(39)"}}, "1702": {"$update": {"ARO_description": "MIR-1 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"8186": {"dna_sequence": {"partial": "0", "sequence": "ATGATGACAAAATCCCTAAGCTGTGCCCTGCTGCTCAGCGTCGCCAGTTCTGCATTCGCCGCACCGATGTCCGAAAAACAGCTGGCTGAGGTGGTGGAACGTACCGTTACGCCGCTGATGAACGCGCAGGCCATTCCGGGTATGGCGGTGGCGGTAATTTATCAGGGTCAGCCACACTACTTTACCTTCGGTAAAGCCGATGTTGCGGCGAACAAACCCGTCACCCCGCAAACCCTGTTTGAGCTGGGCTCTATAAGTAAAACCTTCACCGGCGTACTGGGCGGCGATGCCATTGCCCGGGGTGAAATAGCGCTGGGCGATCCGGTAGCAAAATACTGGCCTGAGCTCACGGGCAAGCAGTGGCAGGGCATTCGCATGCTGGATCTGGCAACCTATACCGCAGGCGGTCTGCCGTTACAGGTGCCGGATGAGGTCACGGATACCGCCTCTCTGCTGCGCTTTTATCAAAACTGGCAGCCGCAGTGGAAGCCGGGCACCACGCGTCTTTACGCTAACGCCAGCATCGGTCTTTTTGGTGCGCTGGCGGTTAAACCTTCCGGCATGAGCTATGAGCAGGCCATGACGACGCGGGTCTTTAAACCCCTCAAGCTGGACCATACCTGGATTAACGTCCCGAAAGCGGAAGAGGCGCATTTCGCCTGGGGATACCGTGAGGGTAAAGCGGTCCACGTTTCGCCAGGGATGCTGGACGCGGAAGCCTATGGCGTAAAAACTAACGTGAAGGATATGGCGAGCTGGCTGATAGCCAACATGAAGCCGGATTCTCTTCAGGCTCCCTCACTCAAGCAAGGCATTGCTCTGGCGCAGTCTCGCTACTGGCGCGTGGGGGCTATGTATCAGGGGTTAGGCTGGGAGATGCTCAACTGGCCGGTCGATGCCAAAACCGTCGTCGGAGGCAGTGATAACAAGGTGGCGCTGGCACCATTGCCCGTGGCAGAAGTGAATCCACCCGCGCCGCCGGTCAAGGCCTCCTGGGTCCATAAAACAGGCTCGACGGGCGGGTTTGGCAGCTACGTGGCATTTATTCCTGAAAAGCAGCTCGGCATTGTGATGCTGGCGAATAAAAGCTATCCGAACCCGGCACGCGTTGAGGCGGCATACCGTATCCTCGACGCGCTGCAGTAA", "fmax": "2073", "accession": "M37839.2", "fmin": "927", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "AAD22636.1", "sequence": "MMTKSLSCALLLSVASSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHYFTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQWQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHFAWGYREGKAVHVSPGMLDAEAYGVKTNVKDMASWLIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDAKTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLANKSYPNPARVEAAYRILDALQ"}}}}}, "ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-1"}}, "5264": {"$insert": {"CARD_short_name": "PDC-128"}}, "1704": {"$update": {"ARO_description": "CMY-57 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1283": {"$update": {"dna_sequence": {"$update": {"accession": "HQ285243.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-57"}}, "1705": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1230": {"$update": {"dna_sequence": {"$update": {"accession": "AB372881.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-111"}}, "1706": {"$update": {"ARO_description": "OXA-142 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1204": {"$update": {"dna_sequence": {"$update": {"accession": "EU358785.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-142"}}, "1707": {"$update": {"ARO_description": "QnrB4 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"8184": {"dna_sequence": {"partial": "0", "sequence": "ATGACTCTGGCGTTAGTTGGCGAAAAAATTGACAGAAACAGGTTCACCGGTGAAAAAGTTGAAAATAGCACATTTTTCAACTGTGATTTTTCGGGTGCCGACCTTAGCGGCACTGAATTTATTGGCTGCCAGTTTTATGATCGAGAAAGTCAGAAAGGATGTAATTTTAGTCGCGCTAACCTGAAAGATGCCATTTTCAAAAGTTGTGATCTCTCCATGGCTGATTTCAGGAATATCAATGCGCTGGGAATCGAAATTCGCCACTGCCGGGCACAAGGGTCAGATTTTCGCGGCGCAAGTTTTATGAATATGATCACCACCCGCACCTGGTTTTGTAGCGCCTATATCACCAATACCAACTTAAGCTACGCCAACTTTTCAAAAGTCGTACTGGAAAAGTGCGAGCTGTGGGAAAACCGCTGGATGGGTACTCAGGTGCTGGGCGCAACGTTCAGTGGATCAGACCTCTCTGGCGGCGAGTTTTCATCCTTCGACTGGCGAGCAGCAAACGTTACGCACTGTGATTTGACCAATTCGGAACTGGGCGATTTAGATATCCGCGGGGTTGATTTGCAAGGCGTCAAACTGGACAGCTACCAGGCATCGTTGCTCCTGGAACGTCTTGGTATCGCTGTCATGGGTTAA", "fmax": "648", "accession": "DQ303921.2", "fmin": "3", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "ABC17630.3", "sequence": "MTLALVGEKIDRNRFTGEKVENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRANLKDAIFKSCDLSMADFRNINALGIEIRHCRAQGSDFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGTQVLGATFSGSDLSGGEFSSFDWRAANVTHCDLTNSELGDLDIRGVDLQGVKLDSYQASLLLERLGIAVMG"}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB4"}}, "1708": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"374": {"$update": {"dna_sequence": {"$update": {"accession": "AJ514254.1"}}}}}}}}}, "$insert": {"CARD_short_name": "tet36"}}, "425": {"$update": {"ARO_description": "TEM-182 is a beta-lactamase found in clinical isolates of H. parainfluenzae.", "model_sequences": {"$update": {"sequence": {"$update": {"1570": {"$update": {"dna_sequence": {"$update": {"accession": "HQ317449.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-182"}}, "1996": {"$update": {"ARO_description": "Also known as vanXM, is a vanX variant found in the vanM gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"717": {"$update": {"dna_sequence": {"$update": {"accession": "FJ349556.1"}}}}}}}}, "model_name": "vanX gene in vanM cluster", "ARO_name": "vanX gene in vanM cluster"}, "$insert": {"CARD_short_name": "vanX_in_vanM_cl"}}, "4572": {"$insert": {"CARD_short_name": "CTX-M-244"}}, "5269": {"$insert": {"CARD_short_name": "PDC-132"}}, "424": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1392": {"$update": {"dna_sequence": {"$update": {"accession": "AF467947.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-36"}}, "4573": {"$insert": {"CARD_short_name": "CTX-M-73"}}, "1391": {"$update": {"ARO_description": "CTX-M-92 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1967": {"$update": {"dna_sequence": {"$update": {"accession": "GU127598.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-92"}}, "3658": {"$update": {"ARO_description": "New Delhi class B metallo-beta-lactamase-16 variant of NDM-1.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "NDM-16"}}, "1390": {"$update": {"ARO_category": {"$update": {"43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "arlR"}}, "5188": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-891"}}, "3659": {"$update": {"ARO_description": "A class B New Delhi metallo-beta-lactamase and NDM-1 variant.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "NDM-18"}}, "1128": {"$update": {"ARO_description": "OXA-23 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"885": {"$update": {"dna_sequence": {"$update": {"accession": "AY795964.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-23"}}, "1129": {"$update": {"ARO_description": "CMY-19 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"761": {"$update": {"dna_sequence": {"$update": {"accession": "AB194410.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-19"}}, "5189": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-892"}}, "4576": {"$insert": {"CARD_short_name": "DHA-23"}}, "1120": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2107": {"$update": {"dna_sequence": {"$update": {"accession": "KM103296.1"}}}}}}}}}, "$insert": {"CARD_short_name": "IMI-7"}}, "1121": {"$update": {"ARO_description": "APH(3')-VIa is a plasmid-encoded aminoglycoside phosphotransferase in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"368": {"$update": {"dna_sequence": {"$update": {"accession": "X07753.1"}}}}}}}}, "ARO_category": {"$update": {"36265": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'."}}}}}, "$insert": {"CARD_short_name": "APH(3')-VIa"}}, "1122": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1293": {"$update": {"dna_sequence": {"$update": {"accession": "HM570036.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-180"}}, "1123": {"$update": {"ARO_description": "FOX-8 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1434": {"$update": {"dna_sequence": {"$update": {"accession": "HM565917.1"}}}}}}}}, "ARO_category": {"$update": {"36206": {"$update": {"category_aro_description": "FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins."}}}}}, "$insert": {"CARD_short_name": "FOX-8"}}, "1124": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1883": {"$update": {"dna_sequence": {"$update": {"accession": "JN227084.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-186"}}, "1125": {"$update": {"ARO_description": "OKP-B-11 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"877": {"$update": {"dna_sequence": {"$update": {"accession": "AM051161.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-B-11"}}, "1126": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1604": {"$update": {"dna_sequence": {"$update": {"accession": "JQ396378.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-184"}}, "1127": {"$update": {"ARO_description": "CTX-M-64 is a beta-lactamase found in Shigella sonnei.", "model_sequences": {"$update": {"sequence": {"8154": {"dna_sequence": {"partial": "0", "sequence": "ATGGTTAAAAAATCACTGCGCCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACGGCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAAATACTTTATCGTGCTGATGAGCGCTTTCCAATGTGCAGTACCAGTAAAGTTATGGCGGCCGCGGCGGTGCTTAAGCAGAGTGAAACGCAAAAGCAGCTGCTTAATCAGCCTGTCGAGATCAAGCCTGCCGATCTGGTTAACTACAATCCGATTGCCGAAAAACACGTCAACGGCACAATGACGCTGGCAGAACTGAGCGCGGCCGCGTTGCAGTACAGCGACAATACCGCCATGAACAAATTGATTGCCCAGCTCGGTGGCCCGGGAGGCGTGACGGCTTTTGCCCGCGCGATCGGCGATGAGACGTTTCGTCTGGATCGCACTGAACCTACGCTGAATACCGCCATTCCCGGCGACCCGAGAGACACCACCACGCCGCGGGCGATGGCGCAGACGTTGCGTCAGCTTACGCTGGGTCATGCGCTGGGCGAAACCCAGCGGGCGCAGTTGGTGACGTGGCTCAAAGGCAATACGACCGGCGCAGCCAGCATTCGGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGCGGTGGCTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAACCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA", "fmax": "1101", "accession": "AB284167.2", "fmin": "225", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Shigella sonnei", "NCBI_taxonomy_id": "624", "NCBI_taxonomy_cvterm_id": "36790"}, "protein_sequence": {"accession": "BAF63422.1", "sequence": "MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPASWVVGDKTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL"}}}}}}, "$insert": {"CARD_short_name": "CTX-M-64"}}, "4578": {"$insert": {"CARD_short_name": "DHA-25"}}, "5096": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-788"}}, "5437": {"$insert": {"CARD_short_name": "PDC-307"}}, "3024": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-24"}}, "3651": {"$insert": {"CARD_short_name": "Mtub_16S_CAP"}}, "524": {"$update": {"ARO_description": "dfrA25 is an integron-encoded dihydrofolate reductase found in Salmonella agona.", "model_sequences": {"$update": {"sequence": {"$update": {"49": {"$update": {"dna_sequence": {"$update": {"accession": "DQ267940.1"}}}}}}}}}, "$insert": {"CARD_short_name": "dfrA25"}}, "525": {"$update": {"ARO_description": "CMY-13 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"8156": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACGTTTGCCTCCGCCAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCATTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGGTCGGTCAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCAGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTACTGATAAAGCCGCATTACTGCGTTTTTATCAAAACTGGCAGCCGCAATGGGCCCCGGGCGCTAAGCGTCTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACAGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAACCTGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAACGTTACCGATATGGCACGCTGGGTTCAGGTCAACATGGACGCCAGCCGCGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGTAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCGGCAGTGAAAGCCTCATGGGTGCATAAAACGGGATCCACTGGAGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA", "fmax": "4786", "accession": "AY339625.2", "fmin": "3640", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "AAQ16660.2", "sequence": "MMKKSLCCALLLTASFSTFASAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSNVTDMARWVQVNMDASRVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}}}, "$insert": {"CARD_short_name": "CMY-13"}}, "526": {"$update": {"ARO_description": "ACT-2 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1812": {"$update": {"dna_sequence": {"$update": {"accession": "AM076977.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-2"}}, "527": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1561": {"$update": {"dna_sequence": {"$update": {"accession": "AY079099.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-38"}}, "1018": {"$update": {"ARO_description": "APH(3')-IIc is a chromosomal-encoded aminoglycoside phosphotransferase in S. maltophilia.", "model_sequences": {"$update": {"sequence": {"$update": {"194": {"$update": {"dna_sequence": {"$update": {"accession": "HQ424460.1"}}}}}}}}, "ARO_category": {"$update": {"36265": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'."}}}}}, "$insert": {"CARD_short_name": "APH(3')-IIc"}}, "521": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"4559": {"$update": {"dna_sequence": {"$update": {"accession": "KF986254.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-386"}}, "522": {"$update": {"ARO_description": "floR is a plasmid or chromosome-encoded chloramphenicol exporter that is found in Bordetella bronchiseptica, Escherichia coli, Klebsiella pneumoniae, Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 and Vibrio cholerae.", "model_sequences": {"$update": {"sequence": {"8160": {"dna_sequence": {"partial": "0", "sequence": "ATGACCACCACACGCCCCGCGTGGGCCTATACGCTGCCGGCAGCACTGCTGCTGATGGCTCCTTTCGACATCCTCGCTTCACTGGCGATGGATATTTATCTCCCTGTCGTTCCAGCGATGCCCGGCATCCTGAACACGACGCCCGCTATGATCCAACTCACGTTGAGCCTCTATATGGTGATGCTCGGCGTGGGCCAGGTGATTTTTGGTCCGCTCTCAGACAGAATCGGGCGACGGCCAATTCTACTTGCGGGCGCAACGGCTTTCGTCATTGCGTCTCTGGGAGCAGCTTGGTCTTCAACTGCACCGGCCTTTGTCGCTTTCCGTCTACTTCAAGCAGTGGGCGCGTCGGCCATGCTGGTGGCGACGTTCGCGACGGTTCGCGACGTTTATGCCAACCGTCCTGAGGGTGTCGTCATCTACGGCCTTTTCAGTTCGGTGCTGGCGTTCGTGCCTGCGCTCGGCCCTATCGCCGGAGCATTGATCGGCGAGTTCTTGGGATGGCAGGCGATATTCATTACTTTGGCTATACTGGCGATGCTCGCACTCCTAAATGCGGGTTTCAGGTGGCACGAAACCCGCCCTCTGGATCAAGTCAAGACGCGCCGATCTGTCTTGCCGATCTTCGCGAGTCCGGCTTTTTGGGTTTACACTGTCGGCTTTAGCGCCGGTATGGGCACCTTCTTCGTCTTCTTCTCGACGGCTCCCCGTGTGCTCATAGGCCAAGCGGAATATTCCGAGATCGGATTCAGCTTTGCCTTCGCCACTGTCGCGCTTGTAATGATCGTGACAACCCGTTTCGCGAAGTCCTTTGTCGCCAGATGGGGCATCGCAGGATGCGTGGCGCGTGGGATGGCGTTGCTTGTTTGCGGAGCGGTCCTGTTGGGGATCGGCGAACTTTACGGCTCGCCGTCATTCCTCACCTTCATCCTACCGATGTGGGTTGTCGCGGTCGGTATTGTCTTCACGGTGTCCGTTACCGCGAACGGCGCTTTGGCAGAGTTCGACGACATCGCGGGATCAGCGGTCGCGTTCTACTTCTGCGTTCAAAGCCTGATAGTCAGCATTGTCGGGACATTGGCGGTGGCACTTTTAAACGGTGACACAGCGTGGCCCGTGATCTGTTACGCCACGGCGATGGCGGTACTGGTTTCGTTGGGGCTGGTGCTCCTTCGGCTCCGTGGGGCTGCCACCGAGAAGTCGCCAGTCGTCTAA", "fmax": "4522", "accession": "AF231986.2", "fmin": "3307", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "AAG16656.1", "sequence": "MTTTRPAWAYTLPAALLLMAPFDILASLAMDIYLPVVPAMPGILNTTPAMIQLTLSLYMVMLGVGQVIFGPLSDRIGRRPILLAGATAFVIASLGAAWSSTAPAFVAFRLLQAVGASAMLVATFATVRDVYANRPEGVVIYGLFSSVLAFVPALGPIAGALIGEFLGWQAIFITLAILAMLALLNAGFRWHETRPLDQVKTRRSVLPIFASPAFWVYTVGFSAGMGTFFVFFSTAPRVLIGQAEYSEIGFSFAFATVALVMIVTTRFAKSFVARWGIAGCVARGMALLVCGAVLLGIGELYGSPSFLTFILPMWVVAVGIVFTVSVTANGALAEFDDIAGSAVAFYFCVQSLIVSIVGTLAVALLNGDTAWPVICYATAMAVLVSLGLVLLRLRGAATEKSPVV"}}}}}}, "$insert": {"CARD_short_name": "floR"}}, "523": {"$update": {"ARO_description": "OXA-75 is a beta-lactamase found in A. baumannii.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-75"}}, "1014": {"$update": {"model_sequences": {"$update": {"sequence": {"8205": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCGCCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCCGCCGCCATTACCGTGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "861", "accession": "AF208796.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "AAF37209.2", "sequence": "MRYIRLCIISLLAALPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITVSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-25"}}, "1015": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "evgA"}}, "1016": {"$update": {"ARO_description": "OXA-255 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"8157": {"dna_sequence": {"partial": "0", "sequence": "ATGAAAAAATTTATACTTCCTATCTTCAGCATTTCTACTCTACTTTCTCTCAGTGCATGCTCAACTATTCAAAATAAATTTGAAAAAACTTCTGATATTTCTGATCAGCAACATGAAAAAGCCATTAAAAGCTATTTTGATGAAGCTCAAACACAAGGTGTAATAATTATTAAAGAGGGAAAGAATATTAGAATCTATGGTAATAACCTGGTACGAGCACATACAGAATATGTCCCTGCGTCAACATTTAAGATGCTAAATGCCTTAATTGGATTAGAAAATCATAAAGCTACAACAACTGAGATTTTCAAATGGGATGGTAAAAAAAGATCTTATCCTATGTGGGAAAAAGATATGACTTTAGGTGATGCCATGGCACTTTCAGCAGTTCCTGTATATCAAGAACTTGCAAGACGGACTGGCTTAGATCTAATGCAAAAAGAAGTTAAACGGGTTGGTTTTGGTAATATGAGCATCGGGACACAAGTTAATAACTTCTGGTTAGTTGGCCCCCTCAAGATTACACCAATACAAGAGGCTAATTTTGCCGATGATCTTGCGAATAATCGATTACCCTTTAAATTAGAAACTCAAGAAGAAGTAAAAAAAATGCTTCTGATTAAAGAAGTCAATGGTAGTAAAATTTATGCGAAAAGTGGATGGGGAATGGATGTGACCCCTCAAGTAGGTTGGTTAACAGGTTGGGTAGAAAAATCTAATGGCGAAAAAGTTCCCTTTTCTCTAAACCTAGAAATGAAGCAAGGAATGTCTGGTTCTATTCGTAATGAAATTACTTATAAATCATTAGAAAATTTAGGGATTATATAA", "fmax": "1496", "accession": "KC479325.2", "fmin": "668", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Acinetobacter pittii", "NCBI_taxonomy_id": "48296", "NCBI_taxonomy_cvterm_id": "36787"}, "protein_sequence": {"accession": "AGK07369.1", "sequence": "MKKFILPIFSISTLLSLSACSTIQNKFEKTSDISDQQHEKAIKSYFDEAQTQGVIIIKEGKNIRIYGNNLVRAHTEYVPASTFKMLNALIGLENHKATTTEIFKWDGKKRSYPMWEKDMTLGDAMALSAVPVYQELARRTGLDLMQKEVKRVGFGNMSIGTQVNNFWLVGPLKITPIQEANFADDLANNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMDVTPQVGWLTGWVEKSNGEKVPFSLNLEMKQGMSGSIRNEITYKSLENLGII"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-255"}}, "1017": {"$update": {"ARO_description": "CTX-M-86 is a beta-lactamase found in Salmonella enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"1413": {"$update": {"dna_sequence": {"$update": {"accession": "FJ214369.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-86"}}, "1010": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1001": {"$update": {"dna_sequence": {"$update": {"accession": "KF240808.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-209"}}, "529": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2023": {"$update": {"dna_sequence": {"$update": {"accession": "KM233164.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-185"}}, "1012": {"$update": {"model_sequences": {"$update": {"sequence": {"8232": {"dna_sequence": {"partial": "0", "sequence": "ATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCTGGCTTTTCTGCCACCGCGCTGACCAACCTCGTCGCGGAACCATTCGCTAAACTCGAACAGGACTTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGTTACCGCGCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCTGTGCTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTGGACACACCCATCCGTTACGGCAAAAATGCGCTGGTTCGGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTGGCGGAGCTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTGAAGGAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTCATGCGCTCTATCGGCGATACCACGTTCCGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGATACCTCATCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTGGCTGCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTAAAGGGAAACACGACCGGCAACCACCGCATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGAGTGTATGGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTGTTGGCCGTCTACACCCGGGCGCCTAACAAGGATGACAAGCACAGCGAGGCCGTCATCGCCGCTGCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGGCAGTAA", "fmax": "3041", "accession": "EU400222.2", "fmin": "2159", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "ABY91240.1", "sequence": "MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVRWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "KPC-5"}}, "1013": {"$update": {"ARO_description": "APH(2'')-IIIa is a plasmid-encoded aminoglycoside phosphotransferase in Enterococcus gallinarum.", "model_sequences": {"$update": {"sequence": {"$update": {"181": {"$update": {"dna_sequence": {"$update": {"accession": "U51479.1"}}}}}}}}, "ARO_category": {"$update": {"36267": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 2''."}}}}}, "$insert": {"CARD_short_name": "APH(2'')-IIIa"}}, "1234": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1348": {"$update": {"dna_sequence": {"$update": {"accession": "KM087862.1"}}}}}}}}, "ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-13"}}, "1235": {"$insert": {"CARD_short_name": "AAC(6')-Ib'"}}, "1236": {"$update": {"ARO_description": "CMY-53 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"958": {"$update": {"dna_sequence": {"$update": {"accession": "HQ336940.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-53"}}, "1237": {"$insert": {"CARD_short_name": "Mtub_rpoB_RIF"}}, "1230": {"$update": {"ARO_description": "CTX-M-33 is a beta-lactamase found in Salmonella enterica."}, "$insert": {"CARD_short_name": "CTX-M-33"}}, "1231": {"$insert": {"CARD_short_name": "mel"}}, "1232": {"$insert": {"CARD_short_name": "cmeR"}}, "1233": {"$insert": {"CARD_short_name": "tet32"}}, "4196": {"$insert": {"CARD_short_name": "ADC-123"}}, "4197": {"$insert": {"CARD_short_name": "ADC-125"}}, "4194": {"$insert": {"CARD_short_name": "ADC-121"}}, "4195": {"$insert": {"CARD_short_name": "ADC-122"}}, "1238": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1535": {"$update": {"dna_sequence": {"$update": {"accession": "KM087865.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-397"}}, "1239": {"$update": {"model_sequences": {"$update": {"sequence": {"8204": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACATCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCAGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAGCGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACCCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "886", "accession": "AM176556.2", "fmin": "25", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAJ47136.2", "sequence": "MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGSPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-81"}}, "4190": {"$insert": {"CARD_short_name": "ADC-116"}}, "4191": {"$insert": {"CARD_short_name": "ADC-117"}}, "5670": {"$insert": {"CARD_short_name": "TER-1"}}, "5671": {"$insert": {"CARD_short_name": "TER-2"}}, "5672": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"8047": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "TTU-1"}}, "5673": {"$update": {"ARO_category": {"$update": {"36182": {"$update": {"category_aro_description": "VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam."}}}}}, "$insert": {"CARD_short_name": "VEB-10"}}, "4358": {"$insert": {"CARD_short_name": "ALG11-1"}}, "5675": {"$update": {"ARO_category": {"$update": {"36182": {"$update": {"category_aro_description": "VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam."}}}}}, "$insert": {"CARD_short_name": "VEB-12"}}, "5676": {"$update": {"ARO_category": {"$update": {"36182": {"$update": {"category_aro_description": "VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam."}}}}}, "$insert": {"CARD_short_name": "VEB-13"}}, "5677": {"$update": {"ARO_category": {"$update": {"36182": {"$update": {"category_aro_description": "VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam."}}}}}, "$insert": {"CARD_short_name": "VEB-14"}}, "4354": {"$insert": {"CARD_short_name": "ADC-98"}}, "4355": {"$insert": {"CARD_short_name": "ADC-99"}}, "4356": {"$update": {"ARO_category": {"$update": {"43848": {"$update": {"category_aro_description": "AFM beta-lactamases are class B1 beta-lactamases found in proteobacteria like Pseudomonas aeruginosa."}}}}}, "$insert": {"CARD_short_name": "AFM-1"}}, "4357": {"$update": {"ARO_category": {"$update": {"43848": {"$update": {"category_aro_description": "AFM beta-lactamases are class B1 beta-lactamases found in proteobacteria like Pseudomonas aeruginosa."}}}}}, "$insert": {"CARD_short_name": "AFM-2"}}, "4350": {"$insert": {"CARD_short_name": "ADC-94"}}, "4351": {"$insert": {"CARD_short_name": "ADC-95"}}, "4352": {"$insert": {"CARD_short_name": "ADC-96"}}, "4353": {"$insert": {"CARD_short_name": "ADC-97"}}, "833": {"$update": {"ARO_description": "CfxA5 beta-lactamase is a class A beta-lactamase found in Bacteroides distasonis.", "model_sequences": {"$update": {"sequence": {"$update": {"1669": {"$update": {"dna_sequence": {"$update": {"accession": "AY769934.1"}}}}}}}}, "ARO_category": {"$update": {"39434": {"$update": {"category_aro_description": "CfxA beta-lactamases are class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "CfxA5"}}, "1564": {"$update": {"ARO_description": "QnrB16 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii.", "model_sequences": {"$update": {"sequence": {"$update": {"349": {"$update": {"dna_sequence": {"$update": {"accession": "EU136183.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB16"}}, "_version": "3.2.0", "4901": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-575"}}, "438": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"936": {"$update": {"dna_sequence": {"$update": {"accession": "AY165025.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-6"}}, "439": {"$update": {"model_sequences": {"$update": {"sequence": {"8139": {"dna_sequence": {"partial": "1", "sequence": "AAGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGGATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "861", "accession": "AM176558.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAJ47138.2", "sequence": "KRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-83"}}, "436": {"$update": {"ARO_description": "OXY-4-1 is a beta-lactamase found in Klebsiella oxytoca.", "model_sequences": {"$update": {"sequence": {"$update": {"1939": {"$update": {"dna_sequence": {"$update": {"accession": "AY077481.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXY-4-1"}}, "437": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1317": {"$update": {"dna_sequence": {"$update": {"accession": "DQ174308.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-69"}}, "434": {"$update": {"ARO_description": "LEN-16 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1347": {"$update": {"dna_sequence": {"$update": {"accession": "AY743416.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-16"}}, "435": {"$update": {"ARO_description": "OKP-A-9 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1919": {"$update": {"dna_sequence": {"$update": {"accession": "AM051148.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-A-9"}}, "433": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"861": {"$update": {"dna_sequence": {"$update": {"accession": "KJ207208.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-25"}}, "430": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"981": {"$update": {"dna_sequence": {"$update": {"accession": "DQ348075.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-87"}}, "431": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2097": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "ARO_name": "Escherichia coli AcrAB-TolC with MarR mutations conferring resistance to ciprofloxacin and tetracycline"}, "$insert": {"CARD_short_name": "Ecol_MarR_MULT"}}, "4902": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-576"}}, "3809": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ROB-3"}}, "3808": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ROB-2"}}, "3805": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "ParS"}}, "3804": {"$insert": {"CARD_short_name": "cprS"}}, "3807": {"$insert": {"CARD_short_name": "rsmA"}}, "3806": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "ParR"}}, "3801": {"$update": {"ARO_description": "A novel aminoglycoside resistance gene identified from Cupriavidus gilardii; AAC(3)-IVb / aacC10 is an aminoglycoside-3-N-acetyltransferase gene which confers resistance to gentamicin and tobramycin."}, "$insert": {"CARD_short_name": "AAC(3)-IVb"}}, "3800": {"$update": {"ARO_description": "A class D OXA-like beta-lactamase described in the emerging pathogen Cupriavidus gilardii.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-837"}}, "3803": {"$insert": {"CARD_short_name": "cprR"}}, "3802": {"$update": {"ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "ANT(3'')-Ib"}}, "4907": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-581"}}, "5425": {"$insert": {"CARD_short_name": "PDC-295"}}, "473": {"$update": {"ARO_description": "mphF is a macrolide phosphotransferase and resistance gene identified on the IncP plasmid pRSB111."}, "$insert": {"CARD_short_name": "mphF"}}, "559": {"$update": {"ARO_description": "Also known as vanXY, is a vanXY variant found in the vanE gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"106": {"$update": {"dna_sequence": {"$update": {"accession": "FJ872411.1"}}}}}}}}, "model_name": "vanXY gene in vanE cluster", "ARO_name": "vanXY gene in vanE cluster"}, "$insert": {"CARD_short_name": "vanXY_in_vanE"}}, "4849": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7224": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-514"}}, "4670": {"$insert": {"CARD_short_name": "IMI-16"}}, "558": {"$update": {"ARO_description": "qacB is a subunit of the qac multidrug efflux pump.", "model_sequences": {"$update": {"sequence": {"$update": {"307": {"$update": {"dna_sequence": {"$update": {"accession": "AF535087.1"}}}}}}}}}, "$insert": {"CARD_short_name": "qacB"}}, "5708": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-59"}}, "5709": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-60"}}, "5704": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-55"}}, "5705": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-56"}}, "5706": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-57"}}, "5707": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-58"}}, "5700": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-51"}}, "5701": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-52"}}, "5702": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-53"}}, "5703": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-54"}}, "555": {"$update": {"ARO_description": "OXA-133 is a beta-lactamase found in A. radioresistens.", "model_sequences": {"$update": {"sequence": {"$update": {"1833": {"$update": {"dna_sequence": {"$update": {"accession": "EU571228.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-133"}}, "3797": {"$insert": {"CARD_short_name": "Tet(X6)"}}, "554": {"$update": {"ARO_description": "OXA-163 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1045": {"$update": {"dna_sequence": {"$update": {"accession": "HQ700343.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-163"}}, "4685": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-58"}}, "4776": {"$insert": {"CARD_short_name": "MYO-1"}}, "4777": {"$insert": {"CARD_short_name": "MYX-1"}}, "4774": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MOX-13"}}, "4775": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MOX-14"}}, "4772": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MOX-11"}}, "4773": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MOX-12"}}, "4770": {"$insert": {"CARD_short_name": "MOR-2"}}, "4771": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MOX-10"}}, "4076": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6449": {"$update": {"dna_sequence": {"$update": {"accession": "NG_065436.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-825"}}, "4778": {"$update": {"ARO_description": "A class B New Delhi metallo-beta-lactamase and NDM-1 variant.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "NDM-26"}}, "4779": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "NDM-30"}}, "4174": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-84"}}, "4175": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-87"}}, "4176": {"$insert": {"CARD_short_name": "ADC-100"}}, "4177": {"$insert": {"CARD_short_name": "ADC-101"}}, "4170": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-80"}}, "4171": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-81"}}, "4172": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-82"}}, "4173": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-83"}}, "1961": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1071": {"$update": {"dna_sequence": {"$update": {"accession": "AF516720.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-105"}}, "4178": {"$insert": {"CARD_short_name": "ADC-102"}}, "4179": {"$insert": {"CARD_short_name": "ADC-103"}}, "4824": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7199": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-159"}}, "470": {"$update": {"ARO_description": "OXA-4 is a beta-lactamase found in Enterobacteriaceae and P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1690": {"$update": {"dna_sequence": {"$update": {"accession": "JN129451.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-4"}}, "5065": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-756"}}, "5064": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-755"}}, "4619": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-36"}}, "4618": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-35"}}, "996": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1739": {"$update": {"dna_sequence": {"$update": {"accession": "JX440353.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-77"}}, "238": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1388": {"$update": {"dna_sequence": {"$update": {"accession": "HQ661363.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-137"}}, "239": {"$update": {"ARO_description": "OXA-83 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1937": {"$update": {"dna_sequence": {"$update": {"accession": "DQ309277.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-83"}}, "5026": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-714"}}, "234": {"$update": {"ARO_description": "QnrS8 is a plasmid-mediated quinolone resistance protein found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"387": {"$update": {"dna_sequence": {"$update": {"accession": "KF730652.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS8"}}, "235": {"$update": {"ARO_description": "OXA-181 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1371": {"$update": {"dna_sequence": {"$update": {"accession": "JN205800.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-181"}}, "236": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1583": {"$update": {"dna_sequence": {"$update": {"accession": "KF992029.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-19"}}, "237": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Cmen_BlaB"}}, "230": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"892": {"$update": {"dna_sequence": {"$update": {"accession": "KM433671.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-422"}}, "231": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1046": {"$update": {"dna_sequence": {"$update": {"accession": "HM113564.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-178"}}, "232": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1808": {"$update": {"dna_sequence": {"$update": {"accession": "AJ548797.1"}}}}}}}}}, "$insert": {"CARD_short_name": "imiH"}}, "233": {"$update": {"ARO_description": "LEN-21 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"8266": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTTATGTTCGCCTGTGTGTTATCTCCCTGTTAGCCACCCTGCCACTGGCGGTAGACGCCGGTCCACAGCCGCTTGAGCAGATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTGGGGATGGTGGAAATGGATCTGGCCAGCGGCCGCACGCTGGCCGCCTGGCGCGCCGATGAACGCTTTCCCATGGTGAGCACCTTTAAAGTGCTGCTGTGCGGCGCGGTGCTGGCGCGGGTGGATGCAGGGGTCGAACAACTGGTTCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCGGTCAGCGAAAAACACCTTGTCGACGGGATGACGATCGGCGAACTCTGCGCCGCCGCCATCACCCTGAGCGATAACAGCGCTGGCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCGGGATTAACTGCCTTTCTGCGCCAGATCGGTGACAACGTCACCCGTCTTGACCGCTGGGAAACGGCACTGAATGAGGCGCTTCCCGGCGACGCGCGCGACACCACCACCCCGGCCAGCATGGCCGCCACGCTGCGCAAACTACTGACCGCGCAGCATCTGAGCGCCCGTTCGCAACAGCAACTCCTGCAGTGGATGGTGGACGATCGGGTTGCCGGCCCGCTGATCCGCGCCGTGCTGCCGGCGGGCTGGTTTATCGCCGACAAAACCGGGGCTGGCGAACGGGGTGCGCGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAACCGGAGCGCATTGTGGTGATCTATCTGCGGGATACCCCGGCGAGTATGGCCGAGCGTAATCAACATATCGCCGGGATCGGCGCAGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "861", "accession": "AM850911.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAP12349.2", "sequence": "MRYVRLCVISLLATLPLAVDAGPQPLEQIKQSESQLSGRVGMVEMDLASGRTLAAWRADERFPMVSTFKVLLCGAVLARVDAGVEQLVRRIHYRQQDLVDYSPVSEKHLVDGMTIGELCAAAITLSDNSAGNLLLATVGGPAGLTAFLRQIGDNVTRLDRWETALNEALPGDARDTTTPASMAATLRKLLTAQHLSARSQQQLLQWMVDDRVAGPLIRAVLPAGWFIADKTGAGERGARGIVALLGPDGKPERIVVIYLRDTPASMAERNQHIAGIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-21"}}, "3953": {"$update": {"ARO_description": "Beta-lactamase gene from Klebsiella pneumoniae. Directly submitted to NCBI without publication on 07-NOV-2018.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-219"}}, "4680": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-23"}}, "2228": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3429": {"$update": {"dna_sequence": {"$update": {"accession": "KP109677.1"}}, "protein_sequence": {"$update": {"accession": "AJP77059.1"}}}}}}}}}, "$insert": {"CARD_short_name": "PEDO-1"}}, "2229": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3428": {"$update": {"dna_sequence": {"$update": {"accession": "KP109678.1"}}, "protein_sequence": {"$update": {"accession": "AJP77071.1"}}}}}}}}}, "$insert": {"CARD_short_name": "PEDO-2"}}, "2227": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3430": {"$update": {"dna_sequence": {"$update": {"accession": "KT818596.1"}}, "protein_sequence": {"$update": {"accession": "ALU64000.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VCC-1"}}, "2224": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "Paer_oprD_IPM"}}, "5149": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-852"}}, "2222": {"$update": {"ARO_category": {"$update": {"36182": {"$update": {"category_aro_description": "VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam."}}}}}, "$insert": {"CARD_short_name": "VEB-1b"}}, "2223": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}, "model_name": "MexZ"}, "$insert": {"CARD_short_name": "MexZ"}}, "1": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1619": {"$update": {"dna_sequence": {"$update": {"accession": "FJ666067.1"}}}}}}}}}, "$insert": {"CARD_short_name": "PDC-4"}}, "4880": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7255": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-551"}}, "2704": {"$update": {"ARO_description": "The MexEF\u2013OprN efflux pump in P. aeruginosa is overexpressed with MexT mutation conferring resistance to chloramphenicol and ciprofloxacin.", "model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems)."}, "$insert": {"CARD_short_name": "Paer_MexT_MULT"}}, "5255": {"$insert": {"CARD_short_name": "PDC-12"}}, "4882": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7257": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-553"}}, "146": {"$update": {"ARO_description": "OXA-98 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1769": {"$update": {"dna_sequence": {"$update": {"accession": "AM279652.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-98"}}, "5458": {"$insert": {"CARD_short_name": "PDC-329"}}, "144": {"$update": {"ARO_description": "IMP-12 is a beta-lactamase found in Pseudomonas putida.", "model_sequences": {"$update": {"sequence": {"$update": {"1824": {"$update": {"dna_sequence": {"$update": {"accession": "AJ420864.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-12"}}, "145": {"$update": {"ARO_description": "OXA-229 is a beta-lactamase found in A. bereziniae.", "model_sequences": {"$update": {"sequence": {"$update": {"804": {"$update": {"dna_sequence": {"$update": {"accession": "JQ422052.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-229"}}, "142": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"587": {"$update": {"dna_sequence": {"$update": {"accession": "L06940.1"}}}}}}}}}, "$insert": {"CARD_short_name": "tet(E)"}}, "143": {"$insert": {"CARD_short_name": "cphA7"}}, "140": {"$update": {"ARO_description": "AAC(6')-IIb is an integron-encoded aminoglycoside acetyltransferase in P. fluorescens.", "model_sequences": {"$update": {"sequence": {"$update": {"497": {"$update": {"dna_sequence": {"$update": {"accession": "L06163.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-IIb"}}, "5459": {"$insert": {"CARD_short_name": "PDC-33"}}, "5069": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-760"}}, "5355": {"$insert": {"CARD_short_name": "PDC-218"}}, "148": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1793": {"$update": {"dna_sequence": {"$update": {"accession": "DQ836922.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-92"}}, "149": {"$update": {"ARO_description": "aadA12 is an integron-encoded aminoglycoside nucleotidyltransferase gene in E. coli, Yersinia enterocolitica and S. enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"57": {"$update": {"dna_sequence": {"$update": {"accession": "FJ381668.1"}}}}}}}}, "ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "aadA12"}}, "4505": {"$insert": {"CARD_short_name": "CTX-M-176"}}, "4504": {"$insert": {"CARD_short_name": "CTX-M-175"}}, "4507": {"$insert": {"CARD_short_name": "CTX-M-178"}}, "4506": {"$insert": {"CARD_short_name": "CTX-M-177"}}, "4501": {"$insert": {"CARD_short_name": "CTX-M-172"}}, "4500": {"$insert": {"CARD_short_name": "CTX-M-171"}}, "4503": {"$insert": {"CARD_short_name": "CTX-M-174"}}, "4502": {"$insert": {"CARD_short_name": "CTX-M-173"}}, "4874": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-545"}}, "1995": {"$update": {"ARO_description": "AAC(6')-Iz is a chromosomal-encoded aminoglycoside acetyltransferase in S. maltophilia.", "model_sequences": {"$update": {"sequence": {"$update": {"205": {"$update": {"dna_sequence": {"$update": {"accession": "AF140221.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Iz"}}, "2797": {"$insert": {"CARD_short_name": "AxyX"}}, "4509": {"$insert": {"CARD_short_name": "CTX-M-180"}}, "4508": {"$insert": {"CARD_short_name": "CTX-M-179"}}, "5352": {"$insert": {"CARD_short_name": "PDC-215"}}, "3401": {"$insert": {"CARD_short_name": "Tet(X3)"}}, "2088": {"$update": {"ARO_description": "Point mutations in the helix 44 region of the 16S rRNA rrsB gene of Mycolicibacterium smegmatis can confer resistance to streptomycin.", "model_name": "Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to streptomycin"}, "$insert": {"CARD_short_name": "Msme_16rrsB_STR"}}, "5351": {"$insert": {"CARD_short_name": "PDC-214"}}, "3400": {"$update": {"ARO_description": "vga(E) gene variant that confers resistance to pleuromutilins, lincosamides and streptogramin A antibiotics in staphylococci.", "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}}}}, "$insert": {"CARD_short_name": "Scoh_vga(E)"}}, "2083": {"$update": {"ARO_description": "Point mutation in Mycoplasma hominis parC resulting in fluoroquinolone resistance.", "model_name": "Mycoplasma hominis parC conferring resistance to fluoroquinolones"}, "$insert": {"CARD_short_name": "Mhom_23S_FLO"}}, "2080": {"$update": {"ARO_description": "Point mutations in the 3' major domain of the rrsH 16S rRNA gene of Escherichia coli can confer resistance to spectinomycin.", "model_sequences": {"$update": {"sequence": {"$update": {"3228": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "model_name": "Escherichia coli 16S rRNA (rrsH) mutation conferring resistance to spectinomycin"}, "$insert": {"CARD_short_name": "Ecol_16rrsH_SPT"}}, "2081": {"$insert": {"CARD_short_name": "patA"}}, "2086": {"$update": {"ARO_description": "Point mutations in the 3' major domain of the rrnB 16S rRNA gene of Escherichia coli can confer resistance to tetracycline.", "model_sequences": {"$update": {"sequence": {"$update": {"3236": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "model_name": "Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to tetracycline"}, "$insert": {"CARD_short_name": "Ecol_16S_TET"}}, "2087": {"$update": {"ARO_description": "aadA13 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in Pseudomonas rettgeri, P. aeruginosa, Y. enterocolitica and E. coli.", "ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "aadA13"}}, "2084": {"$update": {"ARO_description": "Point mutations in the 16S rRNA of Mycobacteroides abscessus conferring resistance to amikacin."}, "$insert": {"CARD_short_name": "Mabs_16S_AMK"}}, "2085": {"$update": {"ARO_description": "Point mutations in the 3' major domain of helix 35, in the rrnB gene operon for 16S rRNA of Escherichia coli can confer resistance to spectinomycin.", "model_sequences": {"$update": {"sequence": {"$update": {"3239": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "model_name": "Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to spectinomycin"}, "$insert": {"CARD_short_name": "Ecol_16S_SPT"}}, "3342": {"$update": {"ARO_description": "A dihydrofolate reductase that confers resistance to trimethoprim.", "model_sequences": {"$update": {"sequence": {"8345": {"dna_sequence": {"partial": "0", "sequence": "ATGACTAAACAAGCAATATTTGCCGTAGCCGAGAACCTAGCCTTCGGGCTAGGTGGGGGTCTCCCTTGGGATACGCTGAAAGACGACTTACAATTCTTTAAGAGGCTAACTGAAGGGACTGACTTAGTAATGGGAGCCTCCACGTACAGAACGCTGCCATTGTTACCAACCAATAACAGACAGTTTATTGTGGTAAGCAATACTGAGGAGCCTAGCCTTAATGTTCATGTGGTATCTCCAGAACACTTCAAGGCTTTCCTTAGCAAAACTTCCAGAAACCTTACTATTATCGGGGGCAGCTCGTTACTAACGGTAGATATATTATCAAAAATGGATAAGATAATTATGACTACGGTGTATGGAAGTTTTGATGCAGATGTATACTTACCTACTGAAGTAGTAAGTTATGTTACTGGCAAAGCTTCAAACGCCACATTATTTAATAACTCGGACGCAAAGATGGCAGTTTATTATGGATAA", "fmax": "6095", "accession": "AY162283.2", "fmin": "5615", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Citrobacter freundii", "NCBI_taxonomy_id": "546", "NCBI_taxonomy_cvterm_id": "36915"}, "protein_sequence": {"accession": "AAN85115.1", "sequence": "MTKQAIFAVAENLAFGLGGGLPWDTLKDDLQFFKRLTEGTDLVMGASTYRTLPLLPTNNRQFIVVSNTEEPSLNVHVVSPEHFKAFLSKTSRNLTIIGGSSLLTVDILSKMDKIIMTTVYGSFDADVYLPTEVVSYVTGKASNATLFNNSDAKMAVYYG"}}}}}}, "$insert": {"CARD_short_name": "dfrA3b"}}, "3402": {"$insert": {"CARD_short_name": "Tet(X4)"}}, "3343": {"$update": {"ARO_description": "dfrA6 is a dihydrofolate reductase that confers resistance to trimethoprim. Found in Proteus mirabilis."}, "$insert": {"CARD_short_name": "Pmir_dfrA6"}}, "3405": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-402"}}, "3340": {"$update": {"ARO_description": "aacA43 is an aminoglycoside acetyltransferase encoded by integrons found in Klebsiella pneumoniae, Escherichia coli, and Enterobacter cloaecae."}, "$insert": {"CARD_short_name": "aacA43"}}, "2712": {"$update": {"ARO_description": "MexXY-OprA is a multidrug efflux protein expressed in Pseudomonas aeruginosa. MexY is the membrane fusion protein; MexX is the RND-type membrane protein; and OprA is the outer membrane channel. MexXY-OprA is associated with resistance to aminoglycosides.", "model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems)."}, "$insert": {"CARD_short_name": "MexXY-OprA"}}, "2713": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "43746": {"$update": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}, "$delete": ["36193"]}}, "$insert": {"CARD_short_name": "MexXY-OprM"}}, "3341": {"$update": {"ARO_description": "A 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(K) [Alkalihalobacillus halodurans].", "model_sequences": {"$update": {"sequence": {"$update": {"5470": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Alkalihalobacillus halodurans"}}}}}}}}}, "$insert": {"CARD_short_name": "Erm(K)"}}, "2716": {"$insert": {"CARD_short_name": "OpmB"}}, "2717": {"$insert": {"CARD_short_name": "MuxA"}}, "3346": {"$update": {"ARO_description": "AQU-2 is a chromosomally-encoded AQU class C beta-lactamase and cephalosporinase from Aeromonas."}, "$insert": {"CARD_short_name": "AQU-2"}}, "2718": {"$insert": {"CARD_short_name": "MuxB"}}, "3406": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-140"}}, "5329": {"$insert": {"CARD_short_name": "PDC-190"}}, "3347": {"$update": {"ARO_description": "AQU-3 is a chromosomally-encoded AQU class C beta-lactamase and cephalosporinase from."}, "$insert": {"CARD_short_name": "AQU-3"}}, "130": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1818": {"$update": {"dna_sequence": {"$update": {"accession": "JF274246.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-112"}}, "3409": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-123"}}, "5078": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-769"}}, "5079": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-770"}}, "3344": {"$insert": {"CARD_short_name": "dfrI"}}, "3408": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-122"}}, "5072": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-763"}}, "5073": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-764"}}, "5070": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-761"}}, "5071": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-762"}}, "5076": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-767"}}, "5077": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-768"}}, "5074": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-765"}}, "5075": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-766"}}, "1832": {"$update": {"ARO_description": "QnrS2 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"145": {"$update": {"dna_sequence": {"$update": {"accession": "DQ485530.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrS2"}}, "1833": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1379": {"$update": {"dna_sequence": {"$update": {"accession": "KF986255.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-374"}}, "1830": {"$update": {"model_sequences": {"$update": {"sequence": {"8275": {"dna_sequence": {"partial": "0", "sequence": "TTGAATCGAACTAATATTTTTTTTGGTGAATCGCATTCTGACTGGTTGCCTGTCAGAGGCGGAGAATCTGGTGATTTTGTTTTTCGACGTGGTGACGGGCATGCCTTCGCGAAAATCGCACCTGCTTCCCGCCGCGGTGAGCTCGCTGGAGAGCGTGACCGCCTCATTTGGCTCAAAGGTCGAGGTGTGGCTTGCCCCGAGGTGATCAACTGGCAGGAGGAACAGGAGGGTGCATGCTTGGTGATAACGGCAATTCCGGGAGTACCGGCGGCTGATCTGTCTGGAGCGGATTTGCTCAAAGCGTGGCCGTCAATGGGGCAGCAACTTGGCGCTGTTCACAGCCTATTGGTTGATCAATGTCCGTTTGAGCGCAGGCTGTCGCGAATGTTCGGACGCGCCGTTGATGTGGTGTCCCGCAATGCCGTCAATCCCGACTTCTTACCGGACGAGGACAAGAGTACGCCGCAGCTCGATCTTTTGGCTCGTGTCGAACGAGAGCTACCGGTGCGGCTCGACCAAGAGCGCACCGATATGGTTGTTTGCCATGGTGATCCCTGCATGCCGAACTTCATGGTGGACCCTAAAACTCTTCAATGCACGGGTCTGATCGACCTTGGGCGGCTCGGAACAGCAGATCGCTATGCCGATTTGGCACTCATGATTGCTAACGCCGAAGAGAACTGGGCAGCGCCAGATGAAGCAGAGCGCGCCTTCGCTGTCCTATTCAATGTATTGGGGATCGAAGCCCCCGACCGCGAACGCCTTGCCTTCTATCTGCGATTGGACCCTCTGACTTGGGGTTGA", "fmax": "16397", "accession": "AF313472.2", "fmin": "15593", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "ABK33456.1", "sequence": "MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRRGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPSMGQQLGAVHSLLVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLLARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"}}}}}, "ARO_category": {"$update": {"36266": {"$update": {"category_aro_description": "Phosphorylation of streptomycin on the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "APH(3'')-Ib"}}, "1831": {"$update": {"ARO_description": "AAC(6')-Iid is a chromosomal-encoded aminoglycoside acetyltransferase in Enterococcus durans.", "model_sequences": {"$update": {"sequence": {"8166": {"dna_sequence": {"partial": "0", "sequence": "ATGATTATCAGTGAGTTTGATCGTGAGAATATTGTCTTGCGAGATCAGCTTGCAGATCTTTTAAGATTGACTTGGCCTGATGAGTATGGAACAGAGCCGATGAAAGAAGTCGAACAGTTGATGGCTCCAGAACGGATTGCTGTATCGGCGATTGAAGGGGAGGAATTGGTCGGTTTTGTTGGAGCGATCCCTCAATATGGCAAAACAGGGTGGGAGTTACATCCTTTGGTAGTAGCAAGCACACATCGCAAACAACAAATCGGGACACGATTGGTTTCCTACCTGGAAAAAGAAGTCGCTTCATATGGTGGCCTGGTCATCTATCTAGGGACAGATGATGTTGAAGGACAAACAAATTTAGTTGAAACGGATTTATTTGAAGATACCTTTGCAAAGTTACAAGAAATCAAAAATATCAATCATCATCCCTATACATTTTATGAGAAACTTGGCTATCAGATCATCGGTGTGATCCCAGATGCGAATGGGTGGAACCAGCCTGATATTTGGTTAGCAAAACGAGTGGCCAAACGAGAGCCAACGGAATAA", "fmax": "582", "accession": "AJ584700.2", "fmin": "33", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Enterococcus hirae", "NCBI_taxonomy_id": "1354", "NCBI_taxonomy_cvterm_id": "39521"}, "protein_sequence": {"accession": "CAE50925.1", "sequence": "MIISEFDRENIVLRDQLADLLRLTWPDEYGTEPMKEVEQLMAPERIAVSAIEGEELVGFVGAIPQYGKTGWELHPLVVASTHRKQQIGTRLVSYLEKEVASYGGLVIYLGTDDVEGQTNLVETDLFEDTFAKLQEIKNINHHPYTFYEKLGYQIIGVIPDANGWNQPDIWLAKRVAKREPTE"}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Iid"}}, "1836": {"$update": {"ARO_description": "OXA-201 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1372": {"$update": {"dna_sequence": {"$update": {"accession": "HQ734812.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-201"}}, "3798": {"$insert": {"CARD_short_name": "Tet(X5)"}}, "1834": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"852": {"$update": {"dna_sequence": {"$update": {"accession": "AJ318094.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-94"}}, "1835": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"537": {"$update": {"dna_sequence": {"$update": {"accession": "AY825285.1"}}}}}}}}}, "$insert": {"CARD_short_name": "tet(38)"}}, "3795": {"$insert": {"CARD_short_name": "ArnT"}}, "3794": {"$update": {"ARO_category": {"$update": {"43251": {"$update": {"category_aro_description": "LpsB is involved in lipopolysaccharide synthesis. It provides intrinsic resistance to colistin and other peptide antibiotics such as polymyxins."}}}}}, "$insert": {"CARD_short_name": "LpsA"}}, "1838": {"$update": {"ARO_description": "ACT-5 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1893": {"$update": {"dna_sequence": {"$update": {"accession": "FJ237369.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-5"}}, "1839": {"$update": {"ARO_description": "aadA14 is a plasmid-encoded aminoglycoside nucleotidyltransferase gene in Pasteurella multocida.", "ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "aadA14"}}, "3791": {"$insert": {"CARD_short_name": "eptB"}}, "3790": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MecI_rep"}}, "3793": {"$update": {"ARO_category": {"$update": {"43251": {"$update": {"category_aro_description": "LpsB is involved in lipopolysaccharide synthesis. It provides intrinsic resistance to colistin and other peptide antibiotics such as polymyxins."}}}}}, "$insert": {"CARD_short_name": "LpsB"}}, "3792": {"$insert": {"CARD_short_name": "CrcB"}}, "4981": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-661"}}, "4980": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-660"}}, "2156": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "NDM-14"}}, "2157": {"$update": {"ARO_description": "Point mutations in the 3' minor domain of helix 44, in the rrsB 16S rRNA gene of Escherichia coli can confer resistance to gentamicin C.", "model_sequences": {"$update": {"sequence": {"$update": {"3233": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "model_name": "Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to gentamicin C"}, "$insert": {"CARD_short_name": "Ecol_16S_GENC"}}, "4985": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"7360": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-669"}}, "2403": {"$insert": {"CARD_short_name": "Sent_gyrA_FLO"}}, "2400": {"$update": {"ARO_description": "RND efflux pump conferring resistance to fluoroquinolone."}, "$insert": {"CARD_short_name": "oqxB"}}, "4986": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-670"}}, "4989": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-676"}}, "4988": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-675"}}, "931": {"$update": {"ARO_description": "OXA-316 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1609": {"$update": {"dna_sequence": {"$update": {"accession": "KF057033.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-316"}}, "2158": {"$update": {"ARO_description": "Sequence variants of Escherichia coli elongation factor Tu that confer resistance to Pulvomycin."}, "$insert": {"CARD_short_name": "Ecol_EFTu_PLV"}}, "936": {"$update": {"ARO_description": "OKP-A-13 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1040": {"$update": {"dna_sequence": {"$update": {"accession": "FJ534513.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-A-13"}}, "935": {"$update": {"ARO_description": "OXA-314 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1458": {"$update": {"dna_sequence": {"$update": {"accession": "KF057031.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-314"}}, "934": {"$update": {"ARO_description": "IMP-8 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"8171": {"dna_sequence": {"partial": "0", "sequence": "ATGAAGAAATTATTTGTTTTATGTGTATGCTTCCTTTGTAGCATTACTGCCGCAGGAGCGGCTTTGCCTGATTTAAAAATCGAGAAGCTTGAAGAAGGTGTTTATGTTCATACATCGTTCGAAGAAGTTAACGGTTGGGGTGTTGTTTCTAAACACGGTTTGGTGGTTCTTGTAAACACTGACGCCTATCTGATTGACACTCCATTTACTGCTACAGATACTGAAAAGTTAGTCAATTGGTTTGTGGAGCGCGGCTATAAAATCAAAGGCACTATTTCCTCACATTTCCATAGCGACAGCACAGGGGGAATAGAGTGGCTTAATTCTCAATCTATTCCCACGTATGCATCTGAATTAACAAATGAACTTCTTAAAAAAGACGGTAAGGTGCAAGCTAAAAACTCATTTAGCGGAGTTAGTTATTGGCTAGTTAAAAATAAAATTGAAGTTTTTTATCCCGGCCCGGGGCACACTCAAGATAACGTAGTGGTTTGGTTACCTGAAAAGAAAATTTTATTCGGTGGTTGTTTTGTTAAACCGGACGGTCTTGGTAATTTGGGTGACGCAAATTTAGAAGCTTGGCCAAAGTCCGCCAAAATATTAATGTCTAAATATGGTAAAGCAAAACTGGTTGTTTCAAGTCATAGTGAAATTGGGGACGCATCACTCTTGAAACGTACATGGGAACAGGCTGTTAAAGGGCTAAATGAAAGTAAAAAACCATCACAGCCAAGTAACTAA", "fmax": "2822", "accession": "AF322577.2", "fmin": "2081", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "AAK13430.1", "sequence": "MKKLFVLCVCFLCSITAAGAALPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPSQPSN"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-8"}}, "5380": {"$insert": {"CARD_short_name": "PDC-242"}}, "5381": {"$insert": {"CARD_short_name": "PDC-243"}}, "5382": {"$insert": {"CARD_short_name": "PDC-244"}}, "5383": {"$insert": {"CARD_short_name": "PDC-245"}}, "5384": {"$insert": {"CARD_short_name": "PDC-246"}}, "5385": {"$insert": {"CARD_short_name": "PDC-247"}}, "5386": {"$insert": {"CARD_short_name": "PDC-248"}}, "5387": {"$insert": {"CARD_short_name": "PDC-249"}}, "5388": {"$insert": {"CARD_short_name": "PDC-25"}}, "5389": {"$insert": {"CARD_short_name": "PDC-250"}}, "2015": {"$update": {"ARO_description": "DHA-3 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1631": {"$update": {"dna_sequence": {"$update": {"accession": "AY494945.1"}}}}}}}}}, "$insert": {"CARD_short_name": "DHA-3"}}, "136": {"$update": {"ARO_description": "CMY-9 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1363": {"$update": {"dna_sequence": {"$update": {"accession": "AB061794.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-9"}}, "1955": {"$update": {"ARO_description": "OXA-29 is a beta-lactamase found in Legionella gormanii.", "model_sequences": {"$update": {"sequence": {"$update": {"973": {"$update": {"dna_sequence": {"$update": {"accession": "AJ400619.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-29"}}, "1954": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1243": {"$update": {"dna_sequence": {"$update": {"accession": "FJ807656.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-154"}}, "1957": {"$update": {"ARO_description": "VIM-18 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1407": {"$update": {"dna_sequence": {"$update": {"accession": "AM778091.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-18"}}, "1956": {"$update": {"ARO_description": "IMI-1 is a beta-lactamase found in Enterobacter cloacae.", "model_sequences": {"$update": {"sequence": {"$update": {"1190": {"$update": {"dna_sequence": {"$update": {"accession": "U50278.1"}}}}}}}}}, "$insert": {"CARD_short_name": "IMI-1"}}, "1951": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1887": {"$update": {"dna_sequence": {"$update": {"accession": "AF190694.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-76"}}, "1950": {"$update": {"ARO_description": "arr-1 is a chromosome-encoded ribosyltransferase found in Mycolicibacterium smegmatis.", "model_sequences": {"$update": {"sequence": {"$update": {"393": {"$update": {"dna_sequence": {"$update": {"accession": "AF001493.1"}}}}}}}}}, "$insert": {"CARD_short_name": "arr-1"}}, "1953": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1472": {"$update": {"dna_sequence": {"$update": {"accession": "JX121122.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-155"}}, "1952": {"$update": {"ARO_description": "OXA-1 is a beta-lactamase found in E. coli.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-1"}}, "4408": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6783": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "CAR-1"}}, "1959": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"759": {"$update": {"dna_sequence": {"$update": {"accession": "FJ237368.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-7"}}, "1958": {"$update": {"ARO_description": "VIM-33 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1331": {"$update": {"dna_sequence": {"$update": {"accession": "JX258134.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-33"}}, "4409": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-11"}}, "5545": {"$insert": {"CARD_short_name": "PDC-416"}}, "4872": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-538"}}, "4404": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-8"}}, "829": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1089": {"$update": {"dna_sequence": {"$update": {"accession": "KM087850.1"}}}}}}}}}, "$insert": {"CARD_short_name": "DHA-17"}}, "828": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1249": {"$update": {"dna_sequence": {"$update": {"accession": "AF427129.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-83"}}, "4405": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-9"}}, "825": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1314": {"$update": {"dna_sequence": {"$update": {"accession": "AF117744.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-20"}}, "824": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"179": {"$update": {"dna_sequence": {"$update": {"accession": "AY082011.1"}}}}}}}}, "ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "vanD"}}, "827": {"$update": {"ARO_description": "QnrB55 is a plasmid-mediated quinolone resistance protein found in Raoultella terrigena.", "model_sequences": {"$update": {"sequence": {"$update": {"389": {"$update": {"dna_sequence": {"$update": {"accession": "KF730650.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB55"}}, "826": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"563": {"$update": {"dna_sequence": {"$update": {"accession": "FJ768952.1"}}}}}}}}, "model_name": "TolC", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "TolC"}}, "821": {"$update": {"ARO_description": "Specific mutations that occurs on Mycobacterium tuberculosis embB causing it to be rifampicin resistant.", "model_sequences": {"$update": {"sequence": {"$update": {"3327": {"$update": {"dna_sequence": {"$update": {"accession": "AE000516.1"}}}}}}}}, "model_name": "Mycobacterium tuberculosis embB with mutation conferring resistance to rifampicin"}, "$insert": {"CARD_short_name": "Mtub_embB_RIF"}}, "820": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"215": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}}}}}}}}, "$insert": {"CARD_short_name": "mdtB"}}, "822": {"$update": {"ARO_description": "QnrD1 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica.", "model_sequences": {"$update": {"sequence": {"$update": {"746": {"$update": {"dna_sequence": {"$update": {"accession": "FJ228229.1"}}}}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrD1"}}, "4259": {"$insert": {"CARD_short_name": "ADC-194"}}, "4407": {"$insert": {"CARD_short_name": "BUT-2"}}, "4258": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6633": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "ADC-193"}}, "2409": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "40661": {"$update": {"category_aro_description": "Mutations in PBP transpeptidases that change the affinity for penicillin thereby conferring resistance to penicillin antibiotics."}}}}}, "$insert": {"CARD_short_name": "Nmen_PBP2_BLA"}}, "4400": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6775": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-39"}}, "4312": {"$insert": {"CARD_short_name": "ADC-246"}}, "4401": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-5"}}, "1483": {"$update": {"ARO_description": "AAC(3)-Xa is a chromosomal-encoded aminoglycoside acetyltransferase in Streptomyces griseus."}, "$insert": {"CARD_short_name": "AAC(3)-Xa"}}, "1482": {"$update": {"ARO_description": "SME-1 is a beta-lactamase found in Serratia marcescens.", "model_sequences": {"$update": {"sequence": {"$update": {"1319": {"$update": {"dna_sequence": {"$update": {"accession": "Z28968.1"}}}}}}}}}, "$insert": {"CARD_short_name": "SME-1"}}, "1481": {"$update": {"ARO_description": "OXY-1-4 is a beta-lactamase found in Klebsiella oxytoca.", "model_sequences": {"$update": {"sequence": {"$update": {"896": {"$update": {"dna_sequence": {"$update": {"accession": "AY077483.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXY-1-4"}}, "1480": {"$update": {"ARO_description": "Class A beta-lactamase found in Streptomyces albus G.", "model_sequences": {"$update": {"sequence": {"$update": {"3292": {"$update": {"dna_sequence": {"$update": {"accession": "M28303.1"}}}}}}}}, "model_name": "EXO-1", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "EXO-1"}}, "5498": {"$insert": {"CARD_short_name": "PDC-368"}}, "5499": {"$insert": {"CARD_short_name": "PDC-369"}}, "1485": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1519": {"$update": {"dna_sequence": {"$update": {"accession": "JX173956.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MOX-8"}}, "1484": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"941": {"$update": {"dna_sequence": {"$update": {"accession": "KJ207209.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-27"}}, "5494": {"$insert": {"CARD_short_name": "PDC-364"}}, "5495": {"$insert": {"CARD_short_name": "PDC-365"}}, "5496": {"$insert": {"CARD_short_name": "PDC-366"}}, "5497": {"$insert": {"CARD_short_name": "PDC-367"}}, "5490": {"$insert": {"CARD_short_name": "PDC-360"}}, "3303": {"$insert": {"CARD_short_name": "ermZ"}}, "3300": {"$insert": {"CARD_short_name": "clcD"}}, "3301": {"$update": {"ARO_description": "LnuP is a lincosamide nucleotidyltransferase major efflux facilitator."}, "$insert": {"CARD_short_name": "LnuP"}}, "1713": {"$update": {"ARO_description": "Also known as vanYM, is a vanY variant found in the vanM gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"479": {"$update": {"dna_sequence": {"$update": {"accession": "FJ349556.1"}}}}}}}}, "model_name": "vanY gene in vanM cluster", "ARO_name": "vanY gene in vanM cluster"}, "$insert": {"CARD_short_name": "vanY_in_vanM_cl"}}, "1712": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1970": {"$update": {"dna_sequence": {"$update": {"accession": "AB753458.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-41"}}, "5250": {"$insert": {"CARD_short_name": "PDC-112"}}, "794": {"$update": {"ARO_description": "Point mutations that occurs in Staphylococcus aureus rpoC resulting in resistance to daptomycin."}, "$insert": {"CARD_short_name": "Saur_rpoC_DAP"}}, "793": {"$update": {"model_sequences": {"$update": {"sequence": {"8228": {"dna_sequence": {"partial": "0", "sequence": "ATGAGCAAGTTATCTGTATTCTTTATATTTTTGTTTTGCAGCATTGCTACCGCAGCAGAGTCTTTGCCAGATTTAAAAATTGAAAAGCTTGATGAAGGCGTTTATGTTCATACTTCGTTTGAAGAAGTTAACGGGTGGGGCGTTGTTCCTAAACATGGTTTGGTGGTTCTTGTAAATGCTGAGGCTTATTTAATTGACACTCCATTTACGGCTAAAGATACTGAAAAGTTAGTCACTTGGTTTGTGGAGCGTGGCTATAAAATAAAAGGCAGTATTTCCTCTCATTTTCATAGCGACAGCACGGGCGGAATAGGGTGGCTTAATTCTCGATCTATCCCCACGTATGCATCTGAATTAACAAATGAACTGCTTAAAAAAGACGGTAAGGTTCAAGCCACAAATTCATTTAGCGGAGTTAACTATTGGCTAGTTAAAAATAAAATTGAAGTTTTTTATCCAGGCCCGGGACACACTCCAGATAACGTAGTGGTTTGGCTGCCTGAAAGGAAAATATTATTCGGTGGTTGTTTTATTAAACCGTACGGTTTAGGCAATTTGGGTGACGCAAATATAGAAGCTTGGCCAAAGTCCGCCAAATTATTAAAGTCCAAATATGGTAAGGCAAAACTGGTTGTTCCAAGTCACAGTGAAGTTGGAGACGCATCACTCTTGAAACTTACATTAGAGCAGGCGGTTAAAGGATTAAACGAAAGTAAAAAACCATCAAAACCAAGCAACTAA", "fmax": "27966", "accession": "AB715422.2", "fmin": "27225", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella oxytoca", "NCBI_taxonomy_id": "571", "NCBI_taxonomy_cvterm_id": "36788"}, "protein_sequence": {"accession": "BAP75826.1", "sequence": "MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIGWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-34"}}, "792": {"$update": {"ARO_description": "OXY-1-1 is a beta-lactamase found in Klebsiella oxytoca.", "model_sequences": {"$update": {"sequence": {"$update": {"1938": {"$update": {"dna_sequence": {"$update": {"accession": "Z30177.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXY-1-1"}}, "791": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1471": {"$update": {"dna_sequence": {"$update": {"accession": "AF226622.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-14"}}, "790": {"$update": {"ARO_description": "CMY-32 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1858": {"$update": {"dna_sequence": {"$update": {"accession": "EU496815.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-32"}}, "1719": {"$update": {"ARO_description": "ceoA is a periplasmic linker subunit of the CeoAB-OpcM efflux pump.", "model_sequences": {"$update": {"sequence": {"$update": {"302": {"$update": {"dna_sequence": {"$update": {"accession": "U97042.1"}}}}}}}}}, "$insert": {"CARD_short_name": "ceoA"}}, "1718": {"$update": {"ARO_description": "Dutch imipenemase or DIM-1 is an integron-encoded metallo-beta-lactamase from Pseudomonas stutzeri.", "model_sequences": {"$update": {"sequence": {"8218": {"dna_sequence": {"partial": "0", "sequence": "ATGAGAACACATTTTACAGCGTTATTACTTCTATTCAGCTTGTCTTCGCTTGCTAACGACGAGGTACCTGAGCTAAGAATCGAGAAAGTAAAAGAGAACATCTTTTTGCACACATCATACAGTCGTGTGAATGGGTTTGGTTTGGTCAGTTCAAACGGCCTTGTTGTCATAGATAAGGGTAATGCTTTCATTGTTGATACACCTTGGTCAGACCGAGATACAGAAACGCTCGTACATTGGATTCGTAAAAATGGTTATGAGCTACTGGGGAGTGTTTCTACTCATTGGCATGAGGATAGAACCGCAGGAATTAAATGGCTTAATGACCAATCAATTTCTACGTATGCCACGACTTCAACCAACCATCTCTTGAAAGAAAATAAAAAAGAGCCAGCGAAATACACCTTGAAAGGAAATGAGTCCACATTGGTTGACGGCCTTATCGAAGTATTTTATCCAGGAGGTGGTCATACAATAGACAACGTAGTGGTGTGGTTGCCAAAGTCGAAAATCTTATTTGGCGGCTGTTTTGTGCGTAGCCTTGATTCCGAGGGGTTAGGCTACACTGGTGAAGCCCATATTGATCAATGGTCCCGATCAGCTCAGAATGCTCTGTCTAGGTACTCAGAAGCCCAGATAGTAATTCCTGGCCATGGGAAAATCGGGGATATAGCGCTGTTAAAACACACCAAAAGTCTGGCTGAGACAGCCTCTAACAAATCAATCCAGCCGAACGCTAACGCGTCGGCTGATTGA", "fmax": "796", "accession": "KC004136.2", "fmin": "40", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Enterobacter sp. SL1", "NCBI_taxonomy_id": "1284354", "NCBI_taxonomy_cvterm_id": "39662"}, "protein_sequence": {"accession": "AGC92784.1", "sequence": "MRTHFTALLLLFSLSSLANDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPNANASAD"}}}}}, "model_name": "DIM-1"}, "$insert": {"CARD_short_name": "DIM-1"}}, "799": {"$update": {"ARO_description": "CTX-M-31 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"786": {"$update": {"dna_sequence": {"$update": {"accession": "AJ567481.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-31"}}, "798": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"492": {"$update": {"dna_sequence": {"$update": {"accession": "AB894099.1"}}}}}}}}}, "$insert": {"CARD_short_name": "cmeC"}}, "612": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1849": {"$update": {"dna_sequence": {"$update": {"accession": "FJ666070.1"}}}}}}}}}, "$insert": {"CARD_short_name": "PDC-7"}}, "2144": {"$update": {"ARO_description": "Point mutations that occur within Mycobacterium tuberculosis variant bovis embB gene resulting in resistance to ethambutol.", "model_sequences": {"$update": {"sequence": {"$update": {"3355": {"$update": {"dna_sequence": {"$update": {"accession": "BX248333.1"}}}}}}}}, "model_name": "Mycobacterium tuberculosis variant bovis embB with mutation conferring resistance to ethambutol"}, "$insert": {"CARD_short_name": "Mbov_embB_EMB"}}, "4319": {"$insert": {"CARD_short_name": "ADC-253"}}, "4978": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-658"}}, "1272": {"$update": {"ARO_description": "CTX-M-67 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1187": {"$update": {"dna_sequence": {"$update": {"accession": "EF581888.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-67"}}, "4979": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-659"}}, "1139": {"$update": {"ARO_description": "dfrA12 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae."}, "$insert": {"CARD_short_name": "dfrA12"}}, "1138": {"$insert": {"CARD_short_name": "tet(D)"}}, "4386": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6761": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-25"}}, "1133": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"985": {"$update": {"dna_sequence": {"$update": {"accession": "EU418913.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-109"}}, "1132": {"$update": {"ARO_description": "OXA-88 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1058": {"$update": {"dna_sequence": {"$update": {"accession": "DQ392963.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-88"}}, "1131": {"$update": {"ARO_description": "AAC(3)-Ic is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"47": {"$update": {"dna_sequence": {"$update": {"accession": "AJ511268.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(3)-Ic"}}, "1130": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2018": {"$update": {"dna_sequence": {"$update": {"accession": "FJ666072.1"}}}}}}}}}, "$insert": {"CARD_short_name": "PDC-9"}}, "1137": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1804": {"$update": {"dna_sequence": {"$update": {"accession": "AF351241.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-90"}}, "1136": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"764": {"$update": {"dna_sequence": {"$update": {"accession": "JQ664733.1"}}}}}}}}, "ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-6"}}, "1135": {"$update": {"ARO_description": "Point mutation in Staphylococcus aureus parE resulting in aminocoumarin resistance."}, "$insert": {"CARD_short_name": "Saur_parE_AMU"}}, "1275": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"367": {"$update": {"dna_sequence": {"$update": {"accession": "M64090.1"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}, "37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "ErmT"}}, "4974": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-654"}}, "4257": {"$insert": {"CARD_short_name": "ADC-192"}}, "2793": {"$update": {"model_name": "Chlamydomonas reinhardtii 23S rRNA with mutation conferring resistance to erythromycin"}, "$insert": {"CARD_short_name": "Crei_23S_ERY"}}, "3378": {"$update": {"ARO_description": "A 16S rRNA mathyltransferase gene with a single nucleotide mutation compared to rmtE.", "model_sequences": {"$update": {"sequence": {"8350": {"dna_sequence": {"partial": "0", "sequence": "ATGAATATTGATGAAATGGCTGCAGAGGTTCTGTCGAGCAAAAAATATACAAGCGTTGACCCTGCTGTTGTTAGGCGTGTTTGTATGGAAACAGCACCTAAATATCCGAAGAAAAAAGAAGCAATAAAAGCGGTAAAAAATGAACTGCATATCATCCATGAGGTTTTTTTGCAAAACGAATGTTACAAAAATGCGCTTTCATTTTTATCACAGCTATCCTTAGATTTTAATAATGCGCAATTGATCGATATTACTATGCAAATCATGCAATCACATACATCAACCAAAGAGAGATTAGGCGACATTGAAGCGGTTTGTTCATTCTTAAGCACCCATATATCCAAAGAGGGTTCCGTGATGGACATCGGTTGTGGCTTCAATCCATTTGCGTTGCCATTACTGCACGAGTTCCCGGCAACGTATTATGCTTATGATATATGTTCAGAAGGAATTAACATCCTAAACAAATATTTCTCCATCCTAAAAAAAGGAGAATATAGAGCGGAGCTACTTGATGCCGTGTCTGTTACGCCGAAAGAAAAGGTGGATGTTGCCCTCCTATTCAAGCTATTACCTTTGTTGCAGCAACAGAAAAAAGGTCGAGGTTTCAGCATTTTAGAAGAACTGGACTTTGACAAAGCAATTGTATCTTTTCCAATAAAAAGCTTGGGAGGAAAGCAAAAAGGAATGGAAACCTTTTATTCGAATTTGTTTGAAGAAAACCTGCCTTCCTCATTGGAAATCATTGAGAAGCAGACTTTTTCAAATGAGATGTTCTATGTGATACAAAACAAAACCAAAAACGGAGGAAATCAATCATGA", "fmax": "2668", "accession": "KT428293.1", "fmin": "1846", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "ALD03565.1", "sequence": "MNIDEMAAEVLSSKKYTSVDPAVVRRVCMETAPKYPKKKEAIKAVKNELHIIHEVFLQNECYKNALSFLSQLSLDFNNAQLIDITMQIMQSHTSTKERLGDIEAVCSFLSTHISKEGSVMDIGCGFNPFALPLLHEFPATYYAYDICSEGINILNKYFSILKKGEYRAELLDAVSVTPKEKVDVALLFKLLPLLQQQKKGRGFSILEELDFDKAIVSFPIKSLGGKQKGMETFYSNLFEENLPSSLEIIEKQTFSNEMFYVIQNKTKNGGNQS"}}}}}}, "$insert": {"CARD_short_name": "rmtE2"}}, "4256": {"$insert": {"CARD_short_name": "ADC-191"}}, "4976": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-656"}}, "4977": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-657"}}, "3013": {"$update": {"ARO_description": "A class C carbapenemase and extended-spectrum beta-lactamase identified from Acinetobacter baumannii."}, "$insert": {"CARD_short_name": "ADC-68"}}, "3014": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-55"}}, "3015": {"$update": {"ARO_description": "An IMP class B metallo-beta-lactamase enzyme identified from carbapenem-resistant Pseudomonas aeruginosa.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-56"}}, "519": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1963": {"$update": {"dna_sequence": {"$update": {"accession": "FR748153.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-26"}}, "518": {"$update": {"ARO_description": "Also known as vanXYN, is a vanXY variant found in the vanN gene cluster.", "model_sequences": {"$update": {"sequence": {"8149": {"dna_sequence": {"partial": "0", "sequence": "ATGCATAATTTTTATTTACAGCTTGTAAACCAACAACACCCTTGGAAATCATTTAATCATTCGCCACAGCTTGTTCAAGCGACCTATGCGGAAGAAAAGATTTTAATAGATTCCAAGGTTAACCATCAATTCAATCAGTTACTTGAAACACTACAATTAACTGATCGCATCATGATCGTTGATGGTCATCGAACGGTTGCTGAGCAAAAACATTTGTGGAACTATTCTTTAAACGCACATGGGGTGAATTATACAAAAAGTTATGTAGCATCTCCTGGCTGTAGTGAACATCATACGGGACTAGCAATTGATCTCGGTCTACGAAAGACAGAACATGATCTCATTGCGCCACGCTTCGAGGGACCAGAAGCCGAACTGTTTTTACAACATATGAAAGATTATGGATTTATTTTACGCTATCCTAAAAATAAGCAAAAAATTACAGGAATTGCTTATGAGCCTTGGCATTTTCGCTATGTAGGTACCCCTCATAGTCAAATCATCATGGACCACGGATGGACCTTAGAAGAGTATATTGAATTTTTAAAACATCAAATTGAGGCGGTCTCATGA", "fmax": "2165", "accession": "JF802084.2", "fmin": "1592", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Enterococcus faecium", "NCBI_taxonomy_id": "1352", "NCBI_taxonomy_cvterm_id": "36779"}, "protein_sequence": {"accession": "AEP40501.1", "sequence": "MHNFYLQLVNQQHPWKSFNHSPQLVQATYAEEKILIDSKVNHQFNQLLETLQLTDRIMIVDGHRTVAEQKHLWNYSLNAHGVNYTKSYVASPGCSEHHTGLAIDLGLRKTEHDLIAPRFEGPEAELFLQHMKDYGFILRYPKNKQKITGIAYEPWHFRYVGTPHSQIIMDHGWTLEEYIEFLKHQIEAVS"}}}}}, "model_name": "vanXY gene in vanN cluster", "ARO_name": "vanXY gene in vanN cluster"}, "$insert": {"CARD_short_name": "vanXY_in_vanN"}}, "4972": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-651"}}, "1009": {"$update": {"ARO_description": "IND-1 is a beta-lactamase found in Chryseobacterium indologenes.", "model_sequences": {"$update": {"sequence": {"$update": {"1595": {"$update": {"dna_sequence": {"$update": {"accession": "AF099139.1"}}}}}}}}, "ARO_category": {"$update": {"36199": {"$update": {"category_aro_description": "IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "IND-1"}}, "1008": {"$update": {"ARO_description": "BEL-1 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1193": {"$update": {"dna_sequence": {"$update": {"accession": "DQ089809.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BEL-1"}}, "1007": {"$update": {"ARO_description": "OKP-A-8 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1830": {"$update": {"dna_sequence": {"$update": {"accession": "AM051147.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-A-8"}}, "510": {"$update": {"ARO_description": "CTX-M-9 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1706": {"$update": {"dna_sequence": {"$update": {"accession": "AF174129.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-9"}}, "513": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1019": {"$update": {"dna_sequence": {"$update": {"accession": "KJ934267.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-19"}}, "1004": {"$update": {"ARO_description": "Also known as vanRD, is a mutated vanR variant found in the vanD gene cluster that caused constitutive expression of vanD peptidoglycan synthesis.", "model_sequences": {"$update": {"sequence": {"$update": {"122": {"$update": {"dna_sequence": {"$update": {"accession": "AY082011.1"}}}}}}}}, "model_name": "vanR gene in vanD cluster", "ARO_name": "vanR gene in vanD cluster"}, "$insert": {"CARD_short_name": "vanR_in_vanD_cl"}}, "1003": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1206": {"$update": {"dna_sequence": {"$update": {"accession": "U85514.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-18"}}, "1002": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"401": {"$update": {"dna_sequence": {"$update": {"accession": "AF445082.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Ib4"}}, "1001": {"$update": {"ARO_description": "Point mutations that occur within Staphylococcus aureus mprF gene resulting in resistance to daptomycin.", "model_sequences": {"$update": {"sequence": {"$update": {"3542": {"$update": {"dna_sequence": {"$update": {"accession": "HM140977.1"}}, "protein_sequence": {"$update": {"accession": "ADJ67256.1"}}}}}}}}, "model_name": "Staphylococcus aureus mprF with mutation conferring resistance to daptomycin"}, "$insert": {"CARD_short_name": "Saur_mprF_DAP"}}, "1000": {"$update": {"ARO_description": "AAC(6')-Ib-Hangzhou is an aminoglycoside acetyltransferase in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"29": {"$update": {"dna_sequence": {"$update": {"accession": "FJ503047.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC6_IB_HZ"}}, "1227": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3404": {"$update": {"dna_sequence": {"$update": {"accession": "AF156486.1"}}}}}}}}, "ARO_category": {"$update": {"41439": {"$update": {"category_aro_description": "Nucleotidylylation of streptomycin at the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "aadA2"}}, "4188": {"$insert": {"CARD_short_name": "ADC-114"}}, "1225": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1492": {"$update": {"dna_sequence": {"$update": {"accession": "X97254.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-178"}}, "620": {"$update": {"ARO_description": "OXA-320 is a beta-lactamase found in Proteus mirabilis.", "model_sequences": {"$update": {"sequence": {"$update": {"1840": {"$update": {"dna_sequence": {"$update": {"accession": "KF151169.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-320"}}, "1223": {"$update": {"ARO_description": "vph is a phosphotransferase that confers resistance to viomycin in Streptomyces vinaceus.", "model_sequences": {"$update": {"sequence": {"$update": {"62": {"$update": {"dna_sequence": {"$update": {"accession": "X02393.1"}}}}}}}}, "model_name": "vph"}, "$insert": {"CARD_short_name": "vph"}}, "626": {"$update": {"ARO_description": "Also known as vanHB, is a vanH variant in the vanB gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"3452": {"$update": {"dna_sequence": {"$update": {"accession": "U35369.1"}}}}}}}}, "model_name": "vanH gene in vanB cluster", "ARO_name": "vanH gene in vanB cluster"}, "$insert": {"CARD_short_name": "vanH_in_vanB_cl"}}, "625": {"$update": {"ARO_description": "QnrB46 is a plasmid-mediated quinolone resistance protein found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"8169": {"dna_sequence": {"partial": "0", "sequence": "ATGACGCCATTACTGTATAAGAAAACAGGAACAAATATGGCTCTAGCGCTCGTGGGCGAAAAAATTGACAGAAACCGTTTCACCGGTGAAAAAATTGAAAATAGTACATTTTTTAACTGTGATTTTTCAGGAGCGGACCTGAGCGGCACTGAGTTTATCGGCTGCCAATTTTATGATCGTGAAAGCCAGAAAGGCTGTAATTTTAGCCGTGCGATGTTAAAGGATGCTATTTTTAAAAGCTGCGATTTATCCATGGCCGATTTTCGCAATGCAAGCGCCCTGGGTATTGAGATTCGTCATTGTAGGGCTCAGGGTGCAGATTTTCGCGGCGCAAGCTTTATGAACATGATTACCACGCGAACTTGGTTCTGCAGCGCGTATATCACGAATACGAATCTGTCTTATGCCAATTTTTCGAAAGCAGTGTTGGAGAAGTGTGAATTATGGGAAAACCGTTGGATGGGTGCCCAGGTACTGGGCGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCAACTTTCGACTGGCGAGCAGCAAACTTTACACATTGCGATCTCACAAATTCGGAGTTGGGTGACTTAGATATTCGTCGGGTTGATTTACAAGGCGTTAAGTTGGACAACTACCAGGCTTCGTTGCTCATGGAGCGACTTGGCATCGCGATAATTGGATGA", "fmax": "681", "accession": "HQ704413.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "ADW54092.1", "sequence": "MTPLLYKKTGTNMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNASALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKAVLEKCELWENRWMGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRRVDLQGVKLDNYQASLLMERLGIAIIG"}}}}}, "ARO_category": {"$update": {"36558": {"$update": {"category_aro_description": "Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics."}}}}}, "$insert": {"CARD_short_name": "QnrB46"}}, "1220": {"$update": {"ARO_description": "OCH-5 beta-lactamase is an Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi.", "model_sequences": {"$update": {"sequence": {"$update": {"1734": {"$update": {"dna_sequence": {"$update": {"accession": "AJ295343.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Brucella anthropi"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36233": {"$update": {"category_aro_description": "OCH beta-lactamases are Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi."}}}}}, "$insert": {"CARD_short_name": "OCH-5"}}, "4181": {"$insert": {"CARD_short_name": "ADC-105"}}, "4180": {"$insert": {"CARD_short_name": "ADC-104"}}, "629": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"854": {"$update": {"dna_sequence": {"$update": {"accession": "JF900599.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-28"}}, "628": {"$update": {"ARO_description": "catB10 is an integron-encoded variant of the cat gene found in P. aeruginosa.", "ARO_category": {"$update": {"36261": {"$update": {"category_aro_description": "Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini."}}}}}, "$insert": {"CARD_short_name": "catB10"}}, "4185": {"$insert": {"CARD_short_name": "ADC-110"}}, "4184": {"$insert": {"CARD_short_name": "ADC-109"}}, "1229": {"$update": {"ARO_description": "CTX-M-6 is a beta-lactamase found in Salmonella typhimurium.", "model_sequences": {"$update": {"sequence": {"$update": {"1863": {"$update": {"dna_sequence": {"$update": {"accession": "AJ005044.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-6"}}, "1228": {"$update": {"model_sequences": {"$update": {"sequence": {"8164": {"dna_sequence": {"partial": "0", "sequence": "ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAA", "fmax": "1143", "accession": "EF685372.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Escherichia coli", "NCBI_taxonomy_id": "562", "NCBI_taxonomy_cvterm_id": "35914"}, "protein_sequence": {"accession": "ABS12249.1", "sequence": "MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHGSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ"}}}}}}, "$insert": {"CARD_short_name": "CMY-30"}}, "5663": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"8038": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "SPU-1"}}, "5662": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"8037": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "SPS-1"}}, "5661": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"8036": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "SPR-1"}}, "5660": {"$insert": {"CARD_short_name": "SPN79-1"}}, "5666": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"8041": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "STA-1"}}, "4349": {"$insert": {"CARD_short_name": "ADC-93"}}, "4348": {"$insert": {"CARD_short_name": "ADC-92"}}, "4347": {"$insert": {"CARD_short_name": "ADC-91"}}, "4346": {"$insert": {"CARD_short_name": "ADC-90"}}, "4345": {"$insert": {"CARD_short_name": "ADC-89"}}, "4344": {"$insert": {"CARD_short_name": "ADC-88"}}, "4343": {"$insert": {"CARD_short_name": "ADC-87"}}, "4342": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6717": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "ADC-86"}}, "4341": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6716": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "ADC-85"}}, "4340": {"$insert": {"CARD_short_name": "ADC-84"}}, "2882": {"$insert": {"CARD_short_name": "tet(W/N/W)"}}, "2880": {"$insert": {"CARD_short_name": "QepA4"}}, "2881": {"$insert": {"CARD_short_name": "tet(59)"}}, "2886": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "40661": {"$update": {"category_aro_description": "Mutations in PBP transpeptidases that change the affinity for penicillin thereby conferring resistance to penicillin antibiotics."}}}}}, "$insert": {"CARD_short_name": "Hinf_PBP3_BLA"}}, "2884": {"$update": {"ARO_category": {"$update": {"41636": {"$update": {"category_aro_description": "A family of class A beta-lactamase enzymes, RSA beta-lactamases show carbapenemase and cephalosporinase activity."}}}}}, "$insert": {"CARD_short_name": "RSA-1"}}, "2885": {"$update": {"ARO_category": {"$update": {"41636": {"$update": {"category_aro_description": "A family of class A beta-lactamase enzymes, RSA beta-lactamases show carbapenemase and cephalosporinase activity."}}}}}, "$insert": {"CARD_short_name": "RSA-2"}}, "2888": {"$update": {"ARO_description": "A class A beta-lactamase with penicillinase activity described in Atlantibacter (Escherichia) hermannii.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "HERA-1"}}, "2889": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "41644": {"$update": {"category_aro_description": "A class C beta-lactamase endogenous to Aeromonas enteropelogenes (tructi)."}}}}}, "$insert": {"CARD_short_name": "TRU-1"}}, "2": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1188": {"$update": {"dna_sequence": {"$update": {"accession": "GQ343019.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CblA-1"}}, "1081": {"$update": {"ARO_description": "IMP-30 is a beta-lactamase found in Pseudomonas aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"1174": {"$update": {"dna_sequence": {"$update": {"accession": "DQ522237.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "IMP-30"}}, "4392": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-30"}}, "3878": {"$insert": {"CARD_short_name": "PDC-69"}}, "3879": {"$update": {"ARO_category": {"$update": {"36265": {"$update": {"category_aro_description": "Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'."}}}}}, "$insert": {"CARD_short_name": "APH(3')-XV"}}, "1561": {"$update": {"ARO_description": "Also known as vanTG, is a vanT variant found in the vanG gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"217": {"$update": {"dna_sequence": {"$update": {"accession": "DQ212986.1"}}}}}}}}, "model_name": "vanT gene in vanG cluster", "ARO_name": "vanT gene in vanG cluster"}, "$insert": {"CARD_short_name": "vanT_in_vanG_cl"}}, "3870": {"$insert": {"CARD_short_name": "PDC-61"}}, "3871": {"$insert": {"CARD_short_name": "PDC-45"}}, "3872": {"$insert": {"CARD_short_name": "PDC-49"}}, "3873": {"$insert": {"CARD_short_name": "PDC-50"}}, "3874": {"$insert": {"CARD_short_name": "PDC-48"}}, "3875": {"$insert": {"CARD_short_name": "PAC-1"}}, "3876": {"$insert": {"CARD_short_name": "PDC-53"}}, "3877": {"$insert": {"CARD_short_name": "PDC-72"}}, "1286": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1235": {"$update": {"dna_sequence": {"$update": {"accession": "AY036620.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-34"}}, "5434": {"$insert": {"CARD_short_name": "PDC-303"}}, "11": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"162": {"$update": {"dna_sequence": {"$update": {"accession": "AY234334.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Alkalihalobacillus clausii"}}}}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}, "37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}}, "$insert": {"CARD_short_name": "Erm(34)"}}, "10": {"$update": {"ARO_description": "CARB-5 is a beta-lactamase found in Acinetobacter calcoaceticus.", "model_sequences": {"$update": {"sequence": {"$update": {"1661": {"$update": {"dna_sequence": {"$update": {"accession": "AF135373.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CARB-5"}}, "13": {"$update": {"ARO_description": "LRA-12 is a beta-lactamase isolated from soil samples in Alaska.", "model_sequences": {"$update": {"sequence": {"$update": {"1445": {"$update": {"dna_sequence": {"$update": {"accession": "EU408351.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LRA-12"}}, "12": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1567": {"$update": {"dna_sequence": {"$update": {"accession": "AY628199.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-126"}}, "15": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"931": {"$update": {"dna_sequence": {"$update": {"accession": "AF062386.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-59"}}, "14": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1651": {"$update": {"dna_sequence": {"$update": {"accession": "AF157553.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-72"}}, "17": {"$update": {"ARO_description": "Tet45 is a tetracycline efflux pump found in Bhargavaea cecembensis strain previously isolated from a poultry-litter-impacted soil."}, "$insert": {"CARD_short_name": "tet(45)"}}, "5718": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-69"}}, "5717": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-68"}}, "5716": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-67"}}, "5715": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-66"}}, "5714": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-65"}}, "5713": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-64"}}, "5712": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-63"}}, "5711": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-62"}}, "5710": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-61"}}, "3272": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "PNGM-1"}}, "3904": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6265": {"$update": {"dna_sequence": {"$update": {"accession": "NG_065862.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-165"}}, "3905": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6266": {"$update": {"dna_sequence": {"$update": {"accession": "NG_065863.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-166"}}, "3906": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6267": {"$update": {"dna_sequence": {"$update": {"accession": "NG_054682.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-149"}}, "3907": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6268": {"$update": {"dna_sequence": {"$update": {"accession": "NG_048807.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-139"}}, "3900": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6261": {"$update": {"dna_sequence": {"$update": {"accession": "NG_060523.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-162"}}, "3270": {"$update": {"ARO_description": "A trimethoprim-resistant dihydrofolate reductase identified from Vibrio cholerae."}, "$insert": {"CARD_short_name": "dfrA18"}}, "3902": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6263": {"$update": {"dna_sequence": {"$update": {"accession": "NG_065422.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-164"}}, "3903": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6264": {"$update": {"dna_sequence": {"$update": {"accession": "NG_057479.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-161"}}, "3271": {"$update": {"ARO_description": "A chromosomally-encoded colistin resistance phosphoethanolamine (PEtN) transferase of Moraxella osloensis. ICR-Mo represents the closest known ortholog to the colistin resistance MCR-1 and MCR-2 PEtN transferases."}, "$insert": {"CARD_short_name": "ICR-Mo"}}, "3908": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6269": {"$update": {"dna_sequence": {"$update": {"accession": "NG_054681.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-148"}}, "3909": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6270": {"$update": {"dna_sequence": {"$update": {"accession": "NG_060564.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-163"}}, "2743": {"$update": {"ARO_description": "AcrR is a repressor of the AcrAB-TolC multidrug efflux complex. AcrR mutations result in high level antibiotic resistance. The mutations associated with this model are specific to E. coli.", "model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems).", "ARO_id": "40492", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$delete": ["35977", "35954"], "$insert": {"35997": {"category_aro_name": "antibiotic target alteration", "category_aro_cvterm_id": "35997", "category_aro_accession": "0001001", "category_aro_class_name": "Resistance Mechanism", "category_aro_description": "Mutational alteration or enzymatic modification of antibiotic target which results in antibiotic resistance."}, "43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}, "36590": {"category_aro_name": "protein(s) and two-component regulatory system modulating antibiotic efflux", "category_aro_cvterm_id": "36590", "category_aro_accession": "3000451", "category_aro_class_name": "Efflux Regulator", "category_aro_description": "Protein(s) and two component regulatory systems that directly or indirectly change rates of antibiotic efflux."}}}, "ARO_accession": "3003807"}, "$insert": {"CARD_short_name": "Ecol_AcrR_MULT"}}, "4761": {"$insert": {"CARD_short_name": "MAL-2"}}, "4760": {"$insert": {"CARD_short_name": "MAL-1"}}, "4763": {"$update": {"ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-18"}}, "4762": {"$insert": {"CARD_short_name": "MBL1b"}}, "4765": {"$update": {"ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-20"}}, "4764": {"$update": {"ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-19"}}, "4767": {"$update": {"ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-22"}}, "4766": {"$update": {"ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-21"}}, "4769": {"$insert": {"CARD_short_name": "MOC-1"}}, "4768": {"$update": {"ARO_category": {"$update": {"36197": {"$update": {"category_aro_description": "MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams."}}}}}, "$insert": {"CARD_short_name": "MIR-7"}}, "5372": {"$insert": {"CARD_short_name": "PDC-234"}}, "4167": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-77"}}, "4166": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-76"}}, "4165": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-75"}}, "4164": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-74"}}, "4163": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-73"}}, "4162": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-72"}}, "4161": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-70"}}, "4160": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-69"}}, "4268": {"$insert": {"CARD_short_name": "ADC-203"}}, "4169": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-79"}}, "4168": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-78"}}, "678": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1385": {"$update": {"dna_sequence": {"$update": {"accession": "FJ666073.1"}}}}}}}}}, "$insert": {"CARD_short_name": "PDC-10"}}, "1534": {"$update": {"ARO_description": "PER-5 is a beta-lactamase found in the Enterobacteriaceae family.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "PER-5"}}, "4321": {"$insert": {"CARD_short_name": "ADC-255"}}, "201": {"$update": {"ARO_description": "OCH-3 beta-lactamase is an Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi.", "model_sequences": {"$update": {"sequence": {"$update": {"1582": {"$update": {"dna_sequence": {"$update": {"accession": "AJ295341.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Brucella anthropi"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36233": {"$update": {"category_aro_description": "OCH beta-lactamases are Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi."}}}}}, "$insert": {"CARD_short_name": "OCH-3"}}, "200": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5873": {"$update": {"dna_sequence": {"$update": {"accession": "AY265889.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "LEN-14"}}, "203": {"$update": {"ARO_description": "OXY-2-8 is a beta-lactamase found in Klebsiella oxytoca.", "model_sequences": {"$update": {"sequence": {"$update": {"1695": {"$update": {"dna_sequence": {"$update": {"accession": "AY055205.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXY-2-8"}}, "202": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1620": {"$update": {"dna_sequence": {"$update": {"accession": "EU155018.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-101"}}, "205": {"$update": {"ARO_description": "APH(4)-Ia is a plasmid-encoded aminoglycoside phosphotransferase in E. coli.", "model_sequences": {"$update": {"sequence": {"$update": {"221": {"$update": {"dna_sequence": {"$update": {"accession": "V01499.1"}}}}}}}}, "ARO_category": {"$update": {"36294": {"$update": {"category_aro_description": "Phosphorylation of hygromycin on the hydroxyl group at position 4."}}}}}, "$insert": {"CARD_short_name": "APH(4)-Ia"}}, "204": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2129": {"$update": {"dna_sequence": {"$update": {"accession": "KP096412.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-43"}}, "207": {"$update": {"ARO_description": "GES-12 is a beta-lactamase found in Acinetobacter baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1823": {"$update": {"dna_sequence": {"$update": {"accession": "FN554543.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-12"}}, "206": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"614": {"$update": {"dna_sequence": {"$update": {"accession": "AB016934.1"}}}}}}}}}, "$insert": {"CARD_short_name": "FomA"}}, "209": {"$update": {"ARO_description": "AAC(3)-Ib/AAC(6')-Ib'' is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"$update": {"271": {"$update": {"dna_sequence": {"$update": {"accession": "AF355189.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC_3Ib_AAC_6Ib"}}, "208": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1623": {"$update": {"dna_sequence": {"$update": {"accession": "KJ207205.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-105"}}, "4717": {"$insert": {"CARD_short_name": "KLUC-4"}}, "3901": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6262": {"$update": {"dna_sequence": {"$update": {"accession": "NG_050943.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-140"}}, "3476": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-342"}}, "679": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"899": {"$update": {"dna_sequence": {"$update": {"accession": "HM751100.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-108"}}, "1573": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1143": {"$update": {"dna_sequence": {"$update": {"accession": "HQ877615.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-110"}}, "3477": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-343"}}, "1572": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1682": {"$update": {"dna_sequence": {"$update": {"accession": "JF800667.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-205"}}, "4320": {"$insert": {"CARD_short_name": "ADC-254"}}, "3470": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5664": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Acinetobacter gerneri DSM 14967 = CIP 107464 = MTCC 9824"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-308"}}, "948": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "mecI"}}, "1571": {"$update": {"ARO_description": "Also known as vanSE, is a vanS variant found in the vanE gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"649": {"$update": {"dna_sequence": {"$update": {"accession": "FJ872411.1"}}}}}}}}, "model_name": "vanS gene in vanE cluster", "ARO_name": "vanS gene in vanE cluster"}, "$insert": {"CARD_short_name": "vanS_in_vanE_cl"}}, "3471": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-336"}}, "1570": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"315": {"$update": {"dna_sequence": {"$update": {"accession": "AB639410.1"}}}}}}}}, "model_name": "OprA"}, "$insert": {"CARD_short_name": "OprA"}}, "3472": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-337"}}, "2231": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3431": {"$update": {"dna_sequence": {"$update": {"accession": "KP109675.1"}}, "protein_sequence": {"$update": {"accession": "AJP77054.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CPS-1"}}, "2230": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5834": {"$update": {"dna_sequence": {"$update": {"accession": "KP109679.1"}}, "protein_sequence": {"$update": {"accession": "AJP77076.1"}}}}}}}}}, "$insert": {"CARD_short_name": "PEDO-3"}}, "2233": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3433": {"$update": {"dna_sequence": {"$update": {"accession": "KP109676.1"}}, "protein_sequence": {"$update": {"accession": "AJP77057.1"}}}}}}}}}, "$insert": {"CARD_short_name": "MSI-1"}}, "2232": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3432": {"$update": {"dna_sequence": {"$update": {"accession": "KP109681.1"}}, "protein_sequence": {"$update": {"accession": "AJP77085.1"}}}}}}}}}, "$insert": {"CARD_short_name": "ESP-1"}}, "2235": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5827": {"$update": {"dna_sequence": {"$update": {"accession": "KP109680.1"}}, "protein_sequence": {"$update": {"accession": "AJP77080.1"}}}}}}}}}, "$insert": {"CARD_short_name": "SPG-1"}}, "2234": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"3434": {"$update": {"dna_sequence": {"$update": {"accession": "KP109676.1"}}, "protein_sequence": {"$update": {"accession": "AJP77058.1"}}}}}}}}}, "$insert": {"CARD_short_name": "MSI-OXA"}}, "1576": {"$update": {"model_sequences": {"$update": {"sequence": {"8356": {"dna_sequence": {"partial": "0", "sequence": "ATGAAAACATTTGCCGCATATGTAATTATCGCGTGTCTTTCGAGTACGGCATTAGCTGGTTCAATTACAGAAAATACGTCTTGGAACAAAGAGTTCTCTGCCGAAGCCGTCAATGGTGTCTTCGTGCTTTGTAAAAGTAGCAGTAAATCCTGCGCTACCAATGACTTAGCTCGTGCATCAAAGGAATATCTTCCAGCATCAACATTTAAGATCCCCAGCGCAATTATCGGCCTAGAAACTGGTGTCATAAAGAATGAGCATCAGGTTTTCAAATGGGACGGAAAGCCAAGAGCCATGAAGCAATGGGAAAGAGACTTGACCTTAAGAGGGGCAATACAAGTTTCAGCTGTTCCCGTATTTCAACAAATCGCCAGAGAAGTTGGCGAAGTAAGAATGCAGAAATACCTTAAAAAATTTTCCTATGGCAACCAGAATATCAGTGGTGGCATTGACAAATTCTGGTTGGAAGGCCAGCTTAGAATTTCCGCAGTTAATCAAGTGGAGTTTCTAGAGTCTCTATATTTAAATAAATTGTCAGCATCTAAAGAAAACCAGCTAATAGTAAAAGAGGCTTTGGTAACGGAGGCGGCACCTGAATATCTAGTGCATTCAAAAACTGGTTTTTCTGGTGTGGGAACTGAGTCAAATCCTGGTGTCGCATGGTGGGTTGGGTGGGTTGAGAAGGAGACAGAGGTTTACTTTTTCGCCTTTAACATGGATATAGACAACGAAAGTAAGTTGCCGCTAAGAAAATCCATTCCCACCAAAATCATGGAAAGTGAGGGCATCATTGGTGGCTAA", "fmax": "3517", "accession": "DQ902344.1", "fmin": "2716", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "ABI63579.1", "sequence": "MKTFAAYVIIACLSSTALAGSITENTSWNKEFSAEAVNGVFVLCKSSSKSCATNDLARASKEYLPASTFKIPSAIIGLETGVIKNEHQVFKWDGKPRAMKQWERDLTLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGIDKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQLIVKEALVTEAAPEYLVHSKTGFSGVGTESNPGVAWWVGWVEKETEVYFFAFNMDIDNESKLPLRKSIPTKIMESEGIIGG"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-17"}}, "5090": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-782"}}, "1575": {"$update": {"ARO_description": "OXA-91 is a beta-lactamase found in A. baumannii.", "model_sequences": {"$update": {"sequence": {"$update": {"1383": {"$update": {"dna_sequence": {"$update": {"accession": "DQ519086.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-91"}}, "5091": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-783"}}, "1574": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2085": {"$update": {"dna_sequence": {"$update": {"accession": "AL123456.1"}}}}}}}}, "ARO_category": {"$update": {"43060": {"$update": {"category_aro_description": "Genes with mutations in inhA which confer resistance to isoniazid class antibiotics."}}}}}, "$insert": {"CARD_short_name": "Mtub_inhA_INH"}}, "5092": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-784"}}, "5093": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-785"}}, "2185": {"$update": {"ARO_description": "Homologous to vanA, contains a D-Ala-D-Lac ligase. The plasmid-located vanM gene cluster is inducible and confers high resistance to vancomycin and teicoplanin. Gene orientation: RSYHMX."}, "$insert": {"CARD_short_name": "vanM_cluster"}}, "3498": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-414"}}, "3499": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-416"}}, "3496": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-412"}}, "3497": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-413"}}, "3494": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-409"}}, "2184": {"$update": {"ARO_description": "Confers low vancomycin resistance by engineering peptidoglycan precursors ending in D-Ala-D-Ser in an inducible or constitutive manner. The vanC cluster is intrinsic to the Enterococcus gallinarum chromosome. vanC organisms remain susceptible to teicoplanin. Gene orientation: vanC(XY)TRS."}, "$insert": {"CARD_short_name": "vanC_cluster"}}, "3492": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-407"}}, "3493": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-408"}}, "3490": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-405"}}, "3491": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-406"}}, "4570": {"$insert": {"CARD_short_name": "CTX-M-241"}}, "4571": {"$insert": {"CARD_short_name": "CTX-M-242"}}, "2097": {"$update": {"ARO_description": "Point mutations in the 3' minor domain of helix 44, in the rrsB 16S rRNA gene of Escherichia coli can confer resistance to paromomycin.", "model_sequences": {"$update": {"sequence": {"$update": {"3238": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "model_name": "Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to paromomycin"}, "$insert": {"CARD_short_name": "Ecol_16rrsB_PAR"}}, "2096": {"$update": {"ARO_description": "Point mutations in the 3' minor, 3' major, and central domains in the rrsC 16S rRNA gene of Escherichia coli can confer resistance to kasugamicin.", "model_sequences": {"$update": {"sequence": {"$update": {"3229": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "model_name": "Escherichia coli 16S rRNA (rrsC) mutation conferring resistance to kasugamicin"}, "$insert": {"CARD_short_name": "Ecol_16rrsC_KAS"}}, "2091": {"$update": {"ARO_description": "Point mutations in the 16S rRNA of Mycobacteroides chelonae can confer resistance to gentamicin C."}, "$insert": {"CARD_short_name": "Mche_16S_GENC"}}, "2090": {"$update": {"ARO_description": "Point mutations in the 16S rRNA of Mycobacteroides abscessus conferring resistance to kanamycin."}, "$insert": {"CARD_short_name": "Mabs_16S_KAN"}}, "2093": {"$update": {"ARO_description": "Point mutation in the 16S rRNA helix 34 region of Chlamydophila psittaci can confer resistance against spectinomycin."}, "$insert": {"CARD_short_name": "Cpsi_16S_SPT"}}, "4607": {"$update": {"ARO_category": {"$update": {"36206": {"$update": {"category_aro_description": "FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins."}}}}}, "$insert": {"CARD_short_name": "FOX-17"}}, "3654": {"$update": {"ARO_description": "Point mutation in Neisseria gonorrhoea gyrase B decreases affinity to zoliflodacin antibiotic.", "model_sequences": {"$update": {"sequence": {"8367": {"dna_sequence": {"partial": "0", "sequence": "ATGACTGAACAAAAACACGAAGAATACGGCGCCGACAGCATCCAGGTGCTCGAAGGCTTGGAAGCGGTACGCAAACGCCCCGGCATGTACATCGGCGACACGCAGGACGGCAGCGGGCTGCACCATATGGTGTTTGAAGTATTGGACAACGCCATCGACGAAGCACTCGCCGGACATTGCGACAAAATCACGGTAACGATACACGCCGACCATTCCGTCAGCGTCGCCGACAACGGGCGCGGTATGCCCACCGGCATCCACCCGAAAGAAGGGCGTTCCGCCGCCGAAGTCATCATGACCGTCTTGCACGCGGGCGGCAAATTCGACAACAACAGCTACAAAATCTCCGGCGGCCTGCACGGCGTGGGCGTATCCGTCGTCAACGCGCTGTCCGACTGGGTAACGCTGACCATCTACCGCGACGGCAAAGAACACTTCGTCCGCTTCGTACGCGGCGAAACCGAAGAGCCGCTGAAAATTGTCGGCGATTCCGACAAAAAAGGCACGACCGTGCGCTTCCTCGCCGGCACGGAAACCTTCGGCAATATCGAATACAGCTTCGACATCCTCGCCAAACGTATTCGCGAACTTTCGTTCCTAAACAACGGCGTGGACATCGAATTGACCGACGAGCGCGACGGCAAGCACGAAAGCTTCGCCCTTTCCGGCGGCGTGGCGGGCTTCGTGCAATACATGAACCGCAAAAAAACGCCCTTGCACGAAAAAATCTTCTATGCGTTCGGCGAGAAAGACGGCATGAGCGTCGAATGCGCAATGCAATGGAACGACAGCTATCAGGAAAGCGTGCAGTGCTTCACCAACAACATCCCTCAGCGCGACGGCGGTACGCACCTGACCGCGCTGCGCCAAGTGATGACGCGCACCATCAACAGCTACATCGAAGCTAACGAAGTCGCCAAAAAAGCCAAAGTGGAAACCGCCGGCGACGATATGCGCGAAGGTTTGACCTGCGTGTTGTCCGTCAAACTGCCCGACCCCAAATTCTCATCCCAAACCAAAGACAAACTGGTTTCCGGCGAAATCGGCCCCGTTGTCAACGAAGTCATCAACCAAGCACTAACCGACTTCCTCGAAGAAAATCCGAACGAAGCCAAAATCATCACCGGCAAAATCGTCGATGCCGCCCGCGCACGCGAAGCCGCCCGCAAAGCCCGCGAAATCCCCCGCCGCAAAGGCGTGATGGACGGCTTGGGACTGCCCGGCAAACTCGCCGACTGCCAAGAAAAAGACCCTGCCCTGTCTGAACTCTACCTCGTCGAGGGCGACTCCGCAGGCGGTTCCGCCATGCAGGGCCGCGACCGCAAATTCCAAGCGATTTTGCCGCTCAAAGGTAAAATTTTGAACGTCGAAAAAGCACGTTTTGAAAAAATGCTCGCCAGCCAAGAGGTCGCCACCCTGATTACCGCGCTGGGTGCAGGCATCGGCAAAGAAGAGTTCAACCCTGAAAAACTACGCTACCACCGCATCATCATCATGACCGATGCCGACGTGGACGGTGCGCACATCCGCACCCTGCTCCTGACCTTCTTCTACCGCCAAATGCCCGAACTGGTCGAGCGCGGCTACATTTACATCGCCCAGCCGCCGCTCTACAAAGCCAAATACGGCAAGCAGGAGCGTTACCTCAAAGACGAACTGGAAAAAGACCAATGGCTGCTCGGCCTTGCCTTGGAAAAAGCCAAAATCGTTTCAGACGGCCGCACCATCGAAGGCGCAGAACTTGCCGACACCGCCAAACAATTCTTGTTGGCGAAAACCGTCATCGAACAGGAAAGCCGCTTCGTGGACGAACTCGTCCTGCGTGCCATGCTGCACGCGTCGCCCATTGATTTGACGTCGTCTGAAAACGCCGATAAAGCCGTTGCCGAACTTTCCGGTTTGCTTGACGAAAAAGAAGCCGCCCTCGAACGCATCGAAGGTCATGAAGGACACCAGTTCATCAAAATCACGCGCAAGCTGCACGGCAACGTCATGGTCAGCTACATCGAACCCAAGTTCCTCAACAGCAAAGCCTACCAAACCCTCACCCAAACCGCCGCCGCGCTCAAAGGCTTGGTCGGCGAGGGCGCCAAGCTCTACAAAGGCGAGAACGAGTACGACGCGGACAGCTTTGAAACCGCTTTGGACATCTTGATGAGCGTTGCCCAAAAAGGTATGTCCATCCAACGATACAAAGGTTTGGGCGAGATGAACCCCGAGCAGCTTTGGGAAACCACGATGGATCCCACCGTGCGCCGCCTGTTGAAAGTGCGCATCGAAGATGCCATTGCCGCCGACGAAGTGTTCGTTACCCTGATGGGCGACGAGGTCGAACCGCGCCGCGCCTTTATCGAAAACAATGCGCTGATTGCGCAAAATATCGACGCATAA", "fmax": "48284", "accession": "CQOZ01000008.1", "fmin": "45893", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Neisseria gonorrhoeae", "NCBI_taxonomy_id": "485", "NCBI_taxonomy_cvterm_id": "36806"}, "protein_sequence": {"accession": "CNT74515.1", "sequence": "MTEQKHEEYGADSIQVLEGLEAVRKRPGMYIGDTQDGSGLHHMVFEVLDNAIDEALAGHCDKITVTIHADHSVSVADNGRGMPTGIHPKEGRSAAEVIMTVLHAGGKFDNNSYKISGGLHGVGVSVVNALSDWVTLTIYRDGKEHFVRFVRGETEEPLKIVGDSDKKGTTVRFLAGTETFGNIEYSFDILAKRIRELSFLNNGVDIELTDERDGKHESFALSGGVAGFVQYMNRKKTPLHEKIFYAFGEKDGMSVECAMQWNDSYQESVQCFTNNIPQRDGGTHLTALRQVMTRTINSYIEANEVAKKAKVETAGDDMREGLTCVLSVKLPDPKFSSQTKDKLVSGEIGPVVNEVINQALTDFLEENPNEAKIITGKIVDAARAREAARKAREIPRRKGVMDGLGLPGKLADCQEKDPALSELYLVEGDSAGGSAMQGRDRKFQAILPLKGKILNVEKARFEKMLASQEVATLITALGAGIGKEEFNPEKLRYHRIIIMTDADVDGAHIRTLLLTFFYRQMPELVERGYIYIAQPPLYKAKYGKQERYLKDELEKDQWLLGLALEKAKIVSDGRTIEGAELADTAKQFLLAKTVIEQESRFVDELVLRAMLHASPIDLTSSENADKAVAELSGLLDEKEAALERIEGHEGHQFIKITRKLHGNVMVSYIEPKFLNSKAYQTLTQTAAALKGLVGEGAKLYKGENEYDADSFETALDILMSVAQKGMSIQRYKGLGEMNPEQLWETTMDPTVRRLLKVRIEDAIAADEVFVTLMGDEVEPRRAFIENNALIAQNIDA"}}}}}, "model_param": {"$update": {"snp": {"$update": {"param_value": {"12583": "K450T", "12582": "K450N", "12584": "D429N"}, "clinical": {"12583": "K450T", "12582": "K450N", "12584": "D429N"}}}}}}, "$insert": {"CARD_short_name": "Ngon_gyrB_ZOL"}}, "4579": {"$insert": {"CARD_short_name": "DHA-26"}}, "3656": {"$update": {"model_sequences": {"$update": {"sequence": {"8366": {"dna_sequence": {"partial": "0", "sequence": "ATGGATCAATTCGCCAAAGAGACCCTGCCCACCTCCCTCGAGGAGGAAATGCGCCGTTCGTATCTCGATTACGCGATGAGCGTGATCGTCGGACGTGCCCTTCCGGATGTCCGCGATGGCCTGAAGCCCGTGCACCGGCGCGTACTGTTCGCGATGCACGAACTGAACAACGACTGGAACCGCGCGTACAAGAAATCGGCGCGTATCGTCGGCGACGTGATCGGTAAGTACCACCCGCACGGCGACACGGCGGTCTACGACACGATCGTGCGGATGGCGCAGGACTTCTCGCTGCGCTACATGCTGATCGACGGGCAGGGCAACTTCGGCTCGATCGACGGCGACAATGCGGCGGCGATGCGGTACACCGAAATTCGCATGGCGAAGATCGGGCACGAGCTGCTCGCCGACATCGACAAGGAAACGGTCGATTTCGAGCCGAACTACGACGGCAACGAAACGCAGCCGTCGGTCCTGCCGTCGCGGATCCCGAACCTGCTGATCAACGGCTCGTCGGGCATCGCCGTCGGCATGGCGACCAACATTCCGCCGCACAACCTGAACGAAGTCGTCGACGCGTGCCAGCACCTGCTGAGCAACCCCGACGCGACGGTCGACGAACTGATCGAGATCATCCCGGCGCCGGATTTCCCGACGGCCGGCATCATCTACGGCGTCGCCGGCGTGCGCGACGGCTACCGCACCGGCCGCGGCCGCGTCGTGATGCGCGCGGCCACGCACTTCGAGGAGATCGACCGCGGCCAGCGGATGGCGATCATCGTCGACGAGCTGCCGTACCAGGTCAACAAGCGCTCGCTGCTCGAGCGGATCGCCGAGCTCGTCAACGAGAAGAAGCTCGAAGGCATTTCCGATATCCGCGACGAATCCGACAAGAGCGGCATGCGGGTCGTGATCGAGCTCAAGCGCGGCGAAGTGCCGGAAGTGGTGCTGAACAACCTGTACAAGGCGACGCAGCTGCAGGACACGTTCGGCATGAACATGGTCGCGCTCGTCGACGGCCAGCCGAAGCTGCTGAACCTGAAGGAAATCCTGCAGTGCTTCCTGTCGCACCGGCGCGAAGTGCTGACGCGCCGCACGATCTACGAACTGCGCAAGGCGCGCGAGCGCGGCCACGTGCTCGAAGGTCTCGCGGTCGCGCTCGCGAACATCGACGAGTTCATCGCGATCATCAAGGCCGCGCCGACGCCGCCGATCGCGAAGCAGGAGCTGATGACGAAGTCGTGGGATTCGTCGCTCGTACGCGAGATGCTGACGCGCGCCGAATCCGAGAACGCGGCGGCGGGCGGCCGTGCCGCGTACCGTCCGGAAGGGCTGAATCCGGCGTACGGGATGCAGGCCGACGGGCTGTACAGGTTGTCCGACACGCAGGCGCAGGAAATCCTGCAGATGCGTCTGCAGCGCCTGACCGGCCTCGAGCAGGACAAGATCATCGGCGAGTATCGCGAAGTGATGGCGCAGATCGCCGATCTGCTCGACATCCTCGCGCGCCCGGAGCGCATCACGACGATGATCGGCGACGAGCTGACGACGGTGAAGGCCGAATTCGGCGATGCGCGCCGCTCGCGGATCGAGCTGAACGCGACCGAACTGAATACCGAAGACCTGATCACGCCGCAGGACATGGTCGTCACGATGTCGCATGCCGGCTACGTGAAGTCGCAGCCGCTGTCGGAGTACCGCGCGCAGAAGCGCGGCGGCCGCGGCAAGCAGGCGACGCAGATGAAGGAAGACGACTGGATCGAGACGCTCTTCATCGCGAATACGCACGACTACATGCTGTGCTTCTCGAACCGCGGTCGCGTGTACTGGATCAAGGTCTACGAGGTGCCGCAAGGTTCGCGCAACTCGCGCGGCCGTCCGATCGTCAACATGTTCCCGCTGCAGGAAGGCGAGAAGATCAACGTCGTGCTGCCGGTGAAGGAATTCTCGGCCGACAAGTTCGTGTTCATGGCGACGTCGCTCGGCACGGTCAAGAAGACGCCGCTCGAAGCGTTCAGCCGTCCGATGAAGAAGGGCATCATCGCGGTCGGCCTCGACGAGGGCGACTATCTGATCGGCGCGTCGATCACCGACGGCGCGCACGACGTGATGCTGTTCTCCGATTCGGGCAAGGCCGTGCGCTTCGACGAGAACGACGTGCGTCCGATGGGCCGCGAAGCGCGCGGCGTGCGCGGCATGCAGCTCGAGGACGGGCAGCAGGTCATCGCGCTGCTGGTCGCGGGCAGCGAGGAGCAGTCCGTGCTCACCGCAACCGAGAACGGCTTCGGCAAGCGTACGCCGATCACCGAGTACACGCGTCACGGCCGCGGCACGAAGGGTATGATCGCGATCCAGACCTCCGAGCGTAACGGCAAGGTCGTCGCTGCGACGCTCGTCGATCCGGAAGATCAGATCATGCTGATCACGACGGCCGGCGTGTTGATTCGCACGCGCGTTTCCGAGATCCGCGAGATGGGACGGGCGACGCAAGGTGTTACACTCATCAGTCTCGATGAGGGTACGAAGCTTTCGGGTCTGCAGCAGATTGCCGAGGCCGAAGAGGGCGATGGCGAAGCCGACGAGGCGTCGGACGGCGAAGCCTGA", "fmax": "2301346", "accession": "CP009795.1", "fmin": "2298742", "strand": "-"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Burkholderia dolosa AU0158", "NCBI_taxonomy_id": "350701", "NCBI_taxonomy_cvterm_id": "42997"}, "protein_sequence": {"accession": "AJY14066.1", "sequence": "MDQFAKETLPTSLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELNNDWNRAYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRYMLIDGQGNFGSIDGDNAAAMRYTEIRMAKIGHELLADIDKETVDFEPNYDGNETQPSVLPSRIPNLLINGSSGIAVGMATNIPPHNLNEVVDACQHLLSNPDATVDELIEIIPAPDFPTAGIIYGVAGVRDGYRTGRGRVVMRAATHFEEIDRGQRMAIIVDELPYQVNKRSLLERIAELVNEKKLEGISDIRDESDKSGMRVVIELKRGEVPEVVLNNLYKATQLQDTFGMNMVALVDGQPKLLNLKEILQCFLSHRREVLTRRTIYELRKARERGHVLEGLAVALANIDEFIAIIKAAPTPPIAKQELMTKSWDSSLVREMLTRAESENAAAGGRAAYRPEGLNPAYGMQADGLYRLSDTQAQEILQMRLQRLTGLEQDKIIGEYREVMAQIADLLDILARPERITTMIGDELTTVKAEFGDARRSRIELNATELNTEDLITPQDMVVTMSHAGYVKSQPLSEYRAQKRGGRGKQATQMKEDDWIETLFIANTHDYMLCFSNRGRVYWIKVYEVPQGSRNSRGRPIVNMFPLQEGEKINVVLPVKEFSADKFVFMATSLGTVKKTPLEAFSRPMKKGIIAVGLDEGDYLIGASITDGAHDVMLFSDSGKAVRFDENDVRPMGREARGVRGMQLEDGQQVIALLVAGSEEQSVLTATENGFGKRTPITEYTRHGRGTKGMIAIQTSERNGKVVAATLVDPEDQIMLITTAGVLIRTRVSEIREMGRATQGVTLISLDEGTKLSGLQQIAEAEEGDGEADEASDGEA"}}}}}}, "$insert": {"CARD_short_name": "Bdol_gyrA_FLO"}}, "3657": {"$update": {"ARO_description": "New Delhi metallo-beta-lactamase-15 variant of NDM-1.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "NDM-15"}}, "2099": {"$update": {"ARO_description": "Point mutations in the helix 44 region of the 16S rRNA rrsB gene of Mycolicibacterium smegmatis can confer resistance to kanamycin A.", "model_name": "Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to kanamycin A"}, "$insert": {"CARD_short_name": "Msme_16rrsB_KAN"}}, "2098": {"$update": {"model_name": "Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to viomycin"}, "$insert": {"CARD_short_name": "Msme_16rrsB_VIO"}}, "3652": {"$update": {"ARO_category": {"$update": {"40636": {"$update": {"category_aro_description": "A fifth generation cephalosporin antibiotic."}}}}}, "$insert": {"CARD_short_name": "CMY-136"}}, "3653": {"$update": {"ARO_description": "Narrow-spectrum beta-lactamase isolated from several Acinetobacter spp. isolates from Argentina, as well as E. Coli. Hydrolyzes penicillins at a high level and cephalosporins and carbapenems at a very low level.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SCO-1"}}, "2525": {"$insert": {"CARD_short_name": "AAC(6')-34"}}, "2524": {"$insert": {"CARD_short_name": "AAC(2')-IIb"}}, "2527": {"$insert": {"CARD_short_name": "mphI"}}, "2526": {"$update": {"ARO_category": {"$update": {"37022": {"$update": {"category_aro_name": "pristinamycin IC", "category_aro_description": "Pristinamycin IC is a class B streptogramin derived from virginiamycin S1."}}, "36722": {"$update": {"category_aro_description": "Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains."}}}}, "model_name": "vgbC"}, "$insert": {"CARD_short_name": "vgbC"}}, "2521": {"$insert": {"CARD_short_name": "BahA"}}, "2520": {"$update": {"ARO_category": {"$update": {"36261": {"$update": {"category_aro_description": "Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini."}}}}}, "$insert": {"CARD_short_name": "CatU"}}, "2523": {"$update": {"ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}}}}, "$insert": {"CARD_short_name": "VatI"}}, "2522": {"$insert": {"CARD_short_name": "TaeA"}}, "4602": {"$update": {"ARO_category": {"$update": {"36206": {"$update": {"category_aro_description": "FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins."}}}}}, "$insert": {"CARD_short_name": "FOX-12"}}, "2529": {"$update": {"ARO_category": {"$update": {"41421": {"$update": {"category_aro_description": "Acetyltransferases of the cpa family confer resistance to capreomycin, an aminoglycoside antibiotic."}}}}}, "$insert": {"CARD_short_name": "cpaA"}}, "2528": {"$insert": {"CARD_short_name": "rphB"}}, "4603": {"$update": {"ARO_category": {"$update": {"36206": {"$update": {"category_aro_description": "FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins."}}}}}, "$insert": {"CARD_short_name": "FOX-13"}}, "472": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1720": {"$update": {"dna_sequence": {"$update": {"accession": "AY368237.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-128"}}, "4600": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6975": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "EVM-1"}}, "5639": {"$insert": {"CARD_short_name": "RSD2-1"}}, "2791": {"$insert": {"CARD_short_name": "Smit_CdsA_DAP"}}, "5575": {"$insert": {"CARD_short_name": "PDC-447"}}, "4601": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6976": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}}, "$insert": {"CARD_short_name": "FIA-1"}}, "4888": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-559"}}, "4889": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-560"}}, "5067": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-758"}}, "5066": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-757"}}, "5061": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-752"}}, "5060": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-751"}}, "5063": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-754"}}, "5062": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-753"}}, "2705": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems)."}, "$insert": {"CARD_short_name": "Paer_MexS_MULT"}}, "4881": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-552"}}, "2707": {"$update": {"model_description": "A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems)."}, "$insert": {"CARD_short_name": "Paer_MvaT_MULT"}}, "2706": {"$insert": {"CARD_short_name": "MvaT"}}, "4884": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-555"}}, "4885": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-556"}}, "4886": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-557"}}, "4887": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-558"}}, "5574": {"$insert": {"CARD_short_name": "PDC-446"}}, "1829": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1284": {"$update": {"dna_sequence": {"$update": {"accession": "AB699171.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-87"}}, "1828": {"$update": {"ARO_description": "GES-6 is a beta-lactamase found in the Enterobacteriaceae family.", "model_sequences": {"$update": {"sequence": {"$update": {"1969": {"$update": {"dna_sequence": {"$update": {"accession": "AY494718.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-6"}}, "1825": {"$update": {"ARO_description": "CTX-M-27 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1704": {"$update": {"dna_sequence": {"$update": {"accession": "AY156923.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "CTX-M-27"}}, "1824": {"$update": {"model_sequences": {"$update": {"sequence": {"8246": {"dna_sequence": {"partial": "0", "sequence": "ATGACGAGCGAGCACCGCTCTGCCTCCGTGACACCCCGTCACATCTCCTTCTTCAACATCCCCGGCCACGGCCACGTGAACCCGTCACTCGGCATCGTCCAGGAACTGGTCGCGCGCGGCCACCGGGTCAGCTACGCCATCACCGACGAGTTCGCCGCACAGGTCAAGGCGGCCGGCGCGACGCCCGTGGTGTACGACTCCATCCTGCCGAAGGAGTCCAACCCCGAGGAGTCGTGGCCGGAGGACCAGGAGTCCGCGATGGGCCTGTTCCTCGACGAAGCCGTCCGGGTCCTGCCGCAGCTGGAGGACGCCTACGCCGACGACCGGCCGGACCTGATCGTCTACGACATCGCCTCCTGGCCCGCCCCGGTGCTCGGCCGGAAGTGGGACATCCCCTTCGTCCAGCTCTCCCCGACCTTCGTCGCCTACGAGGGCTTCGAGGAGGACGTACCCGCGGTGCAGGACCCCACGGCCGACCGCGGCGAGGAGGCCGCCGCCCCCGCGGGGACCGGGGACGCCGAGGAGGGTGCCGAGGCCGAGGACGGCCTGGTGCGCTTCTTCACCCGGCTCTCGGCCTTCCTGGAGGAGCACGGGGTGGACACCCCGGCCACCGAGTTCCTCATCGCGCCCAACCGCTGCATCGTCGCGCTGCCGCGCACCTTCCAGATCAAGGGCGACACGGTCGGCGACAACTACACCTTCGTCGGTCCCACCTACGGCGACCGGTCCCACCAGGGCACCTGGGAAGGCCCCGGGGACGGGCGTCCGGTGCTGCTGATCGCCCTGGGCTCGGCGTTCACCGACCACCTCGACTTCTACCGCACCTGCCTGTCCGCCGTCGACGGCCTGGACTGGCACGTGGTGCTCTCCGTGGGCCGCTTCGTCGACCCCGCGGACCTCGGCGAGGTCCCGCCGAACGTCGAGGTGCACCAGTGGGTGCCGCAGCTCGACATCCTGACCAAAGCCTCCGCGTTCATCACGCACGCGGGCATGGGCAGCACCATGGAGGCCCTGTCGAACGCGGTGCCCATGGTCGCGGTGCCGCAGATCGCGGAGCAGACGATGAACGCCGAGCGGATCGTCGAGCTGGGCCTCGGCCGGCACATCCCGCGGGACCAGGTCACGGCCGAGAAGCTGCGCGAGGCCGTGCTCGCCGTCGCCTCCGACCCCGGTGTCGCCGAACGGCTCGCGGCCGTCCGGCAGGAGATCCGTGAGGCGGGCGGCGCCCGGGCGGCCGCCGACATCCTGGAGGGCATCCTCGCCGAAGCAGGCTGA", "fmax": "1275", "accession": "DQ195535.2", "fmin": "0", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Streptomyces antibioticus", "NCBI_taxonomy_id": "1890", "NCBI_taxonomy_cvterm_id": "36823"}, "protein_sequence": {"accession": "ABA42118.2", "sequence": "MTSEHRSASVTPRHISFFNIPGHGHVNPSLGIVQELVARGHRVSYAITDEFAAQVKAAGATPVVYDSILPKESNPEESWPEDQESAMGLFLDEAVRVLPQLEDAYADDRPDLIVYDIASWPAPVLGRKWDIPFVQLSPTFVAYEGFEEDVPAVQDPTADRGEEAAAPAGTGDAEEGAEAEDGLVRFFTRLSAFLEEHGVDTPATEFLIAPNRCIVALPRTFQIKGDTVGDNYTFVGPTYGDRSHQGTWEGPGDGRPVLLIALGSAFTDHLDFYRTCLSAVDGLDWHVVLSVGRFVDPADLGEVPPNVEVHQWVPQLDILTKASAFITHAGMGSTMEALSNAVPMVAVPQIAEQTMNAERIVELGLGRHIPRDQVTAEKLREAVLAVASDPGVAERLAAVRQEIREAGGARAAADILEGILAEAG"}}}}}}, "$insert": {"CARD_short_name": "oleI"}}, "1827": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1149": {"$update": {"dna_sequence": {"$update": {"accession": "X55640.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-5"}}, "1826": {"$update": {"ARO_description": "ykkC is an SMR-type protein that is a subunit of the ykkCD efflux pump.", "model_sequences": {"$update": {"sequence": {"$update": {"489": {"$update": {"dna_sequence": {"$update": {"accession": "AL009126.1"}}}}}}}}}, "$insert": {"CARD_short_name": "ykkC"}}, "1821": {"$update": {"ARO_description": "AAC(6')-Ir is a chromosomal-encoded aminoglycoside acetyltransferase in Acinetobacter colistiniresistens.", "model_sequences": {"$update": {"sequence": {"$update": {"581": {"$update": {"dna_sequence": {"$update": {"accession": "AF031326.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Ir"}}, "1820": {"$insert": {"CARD_short_name": "bacA"}}, "4402": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6777": {"$update": {"NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-6"}}, "4403": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "BlaB-7"}}, "928": {"$update": {"ARO_description": "carA is an ABC-F subfamily protein involved in macrolide resistance. It is found in Streptomyces thermotolerans.", "model_sequences": {"$update": {"sequence": {"$update": {"90": {"$update": {"dna_sequence": {"$update": {"accession": "M80346.1"}}}}}}}}}, "$insert": {"CARD_short_name": "carA"}}, "929": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1670": {"$update": {"dna_sequence": {"$update": {"accession": "FJ820124.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-10"}}, "2145": {"$update": {"ARO_description": "Point mutations in the 3' major domain of the rrsB 16S rRNA gene of Escherichia coli can confer resistance to tetracycline.", "model_sequences": {"$update": {"sequence": {"$update": {"3242": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "model_name": "Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to tetracycline"}, "$insert": {"CARD_short_name": "Ecol_16rrsB_TET"}}, "2412": {"$update": {"ARO_description": "Point mutation in parC conferring resistance to fluoroquinolone antibiotics in Shigella flexneri,."}, "$insert": {"CARD_short_name": "Sfle_parC_FLO"}}, "2143": {"$update": {"ARO_description": "Point mutations in the 3' minor domain of the 16S rRNA gene of Borreliella burgdorferi can confer resistance to gentamicin."}, "$insert": {"CARD_short_name": "Bbur_16S_GEN"}}, "2142": {"$update": {"model_name": "Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to viomycin"}, "$insert": {"CARD_short_name": "Msme_16rrsA_VIO"}}, "2141": {"$update": {"ARO_description": "Point mutations in the helix 44 region of the 16S rRNA rrsB gene of Mycolicibacterium smegmatis can confer resistance to neomycin.", "model_name": "Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to neomycin"}, "$insert": {"CARD_short_name": "Msme_16rrsB_NEO"}}, "2140": {"$update": {"ARO_description": "Point mutations in the 5' domain of helix 18, in the rrsB 16S rRNA gene of Escherichia coli can confer resistance to streptomycin.", "model_sequences": {"$update": {"sequence": {"$update": {"3231": {"$update": {"dna_sequence": {"$update": {"accession": "U00096.1"}}, "NCBI_taxonomy": {"$update": {"NCBI_taxonomy_name": "Escherichia coli str. K-12"}}}}}}}}, "model_name": "Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to streptomycin"}, "$insert": {"CARD_short_name": "Ecol_16rrsB_STR"}}, "920": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1074": {"$update": {"dna_sequence": {"$update": {"accession": "DQ834728.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-152"}}, "921": {"$update": {"ARO_description": "OKP-A-11 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"8242": {"dna_sequence": {"partial": "0", "sequence": "ATGCGTTATGTTCGCCTGTGCCTTATCTCCCTGATTGCCGCCCTGCCACTGGCGGCATTCGCCAGCCCTCCGCCGCTCGAGCAAGTTACACGCAGCGAAAGTCAGCTGGCGGGCCGCGTGGGCTATGTTGAAATGGATCTGGCCAGCGGCCGCACGCTGGCCGCCTGGCGCGCCAGTGAGCGCTTTCCGCTGATGAGCACCTTTAAAGTGCTGCTCTGCGGCGCGGTGCTGGCCCGGGTGGATGCCGGAGACGAACAGCTGGATCGGCGGATCCGCTACCGCCAGCAGGATCTGGTGGACTACTCCCCGGTCAGCGAAAAACACCTTGCCGACGGGATGACCGTTGGCGAACTCTGCGCCGCCGCCATCACCATGAGCGACAACAGCGCCGGCAATCTGCTGTTGAAGAGCGTTGGCGGCCCCGCGGGATTGACCGCTTTTCTGCGCCAGATCGGTGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAGCTCAATGAGGCGCTTCCCGGCGACGTGCGCGACACCACCACCCCAGCCAGCATGGCCGCCACCCTGCGCAAGCTGCTAACCAGCCACGCGCTGAGCGCCCGTTCGCAGCAGCAGCTGCTGCAGTGGATGGTGGACGACCAGGTGGCCGGTCCGCTGATCCGCGCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAAACCGGGGCCGGCGAGCGGGGCTCACGCGGCATTGTCGCCCTGCTCGGCCCGAACGGCAAAGCGGAGCGCATCGTGGTGATCTATCTGCGGGATACGCCGGCGACCATGGCCGAGCGTAACCAGCAGATCGCCAGAATAGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA", "fmax": "880", "accession": "AM850915.2", "fmin": "19", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Klebsiella pneumoniae", "NCBI_taxonomy_id": "573", "NCBI_taxonomy_cvterm_id": "35915"}, "protein_sequence": {"accession": "CAP12353.2", "sequence": "MRYVRLCLISLIAALPLAAFASPPPLEQVTRSESQLAGRVGYVEMDLASGRTLAAWRASERFPLMSTFKVLLCGAVLARVDAGDEQLDRRIRYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAGNLLLKSVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDVRDTTTPASMAATLRKLLTSHALSARSQQQLLQWMVDDQVAGPLIRAVLPAGWFIADKTGAGERGSRGIVALLGPNGKAERIVVIYLRDTPATMAERNQQIARIGAALIEHWQR"}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-A-11"}}, "922": {"$update": {"ARO_description": "AAC(6')-30/AAC(6')-Ib' is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa.", "model_sequences": {"$update": {"sequence": {"8193": {"dna_sequence": {"partial": "0", "sequence": "ATGACATTCCTGATCCGACCCGTAGAACAAAGTGACGCTGAATCTTGGGAGCGCTTACGCAACCTTTTGTGGGAGGGCGACGACCACAAAAGCGAGATCACACAATTCTTCAACGGCGAAGTAGAAGAACCCAATGAAGTGTTGCTTGCCGTAACCGAAGAAAATGATGCAATAGCGCACATCGAGCTATCGTTGAGGTATGACATTGATGGCTTGACGGGCATCAAGACCGGTTACATCGAAGGCCTTTTTGTAGAGGAGCGGCACCGTGCCGCAGGTGTAGTCCTCAAGCTATTGCGAGCCGCAGAGTTCTGGGCAAGAGATCAAGGATGTCTGGCGTTTGCCTCAGACAGGGATGATCGTGTCATCATCTATGCTCGCTACACGGGAGCGCCACCTAACAATTCATTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGTTGCCTAA", "fmax": "2913", "accession": "AJ584652.2", "fmin": "1926", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Pseudomonas aeruginosa", "NCBI_taxonomy_id": "287", "NCBI_taxonomy_cvterm_id": "36752"}, "protein_sequence": {"accession": "CAE48335.2", "sequence": "MTFLIRPVEQSDAESWERLRNLLWEGDDHKSEITQFFNGEVEEPNEVLLAVTEENDAIAHIELSLRYDIDGLTGIKTGYIEGLFVEERHRAAGVVLKLLRAAEFWARDQGCLAFASDRDDRVIIYARYTGAPPNNSLGITKYSIVTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSVA"}}}}}}, "$insert": {"CARD_short_name": "AAC6_30_AAC6_Ib"}}, "923": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1890": {"$update": {"dna_sequence": {"$update": {"accession": "HM750249.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "VIM-25"}}, "4970": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-645"}}, "4971": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-650"}}, "2149": {"$update": {"model_name": "Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to hygromycin B"}, "$insert": {"CARD_short_name": "Msme_16rrsA_HGM"}}, "4973": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-652"}}, "5393": {"$insert": {"CARD_short_name": "PDC-254"}}, "5392": {"$insert": {"CARD_short_name": "PDC-253"}}, "5391": {"$insert": {"CARD_short_name": "PDC-252"}}, "5390": {"$insert": {"CARD_short_name": "PDC-251"}}, "5397": {"$insert": {"CARD_short_name": "PDC-260"}}, "5396": {"$insert": {"CARD_short_name": "PDC-26"}}, "5395": {"$insert": {"CARD_short_name": "PDC-259"}}, "5394": {"$insert": {"CARD_short_name": "PDC-256"}}, "2411": {"$insert": {"CARD_short_name": "Sfle_gyrA_FLO"}}, "5399": {"$insert": {"CARD_short_name": "PDC-262"}}, "5398": {"$insert": {"CARD_short_name": "PDC-261"}}, "4326": {"$insert": {"CARD_short_name": "ADC-33"}}, "1920": {"$update": {"ARO_description": "Also known as vanSF, is a vanS variant found in the vanF gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"680": {"$update": {"dna_sequence": {"$update": {"accession": "AF155139.1"}}}}}}}}, "model_name": "vanS gene in vanF cluster", "ARO_name": "vanS gene in vanF cluster"}, "$insert": {"CARD_short_name": "vanS_in_vanF_cl"}}, "1921": {"$insert": {"CARD_short_name": "EreB"}}, "1922": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "37250": {"$update": {"category_aro_class_name": "Antibiotic"}}}, "$insert": {"43746": {"category_aro_name": "disinfecting agents and antiseptics", "category_aro_cvterm_id": "43746", "category_aro_accession": "3005386", "category_aro_class_name": "Drug Class", "category_aro_description": "Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance."}}}}, "$insert": {"CARD_short_name": "marA"}}, "1923": {"$update": {"ARO_description": "APH(3'')-Ia is a chromosomal-encoded aminoglycoside phosphotransferase in S. griseus.", "model_sequences": {"$update": {"sequence": {"$update": {"91": {"$update": {"dna_sequence": {"$update": {"accession": "X53527.1"}}}}}}}}, "ARO_category": {"$update": {"36266": {"$update": {"category_aro_description": "Phosphorylation of streptomycin on the hydroxyl group at position 3''."}}}}}, "$insert": {"CARD_short_name": "APH(3'')-Ia"}}, "1924": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"651": {"$update": {"dna_sequence": {"$update": {"accession": "FJ349556.1"}}}}}}}}, "ARO_category": {"$update": {"39340": {"$update": {"category_aro_name": "Van ligase", "category_aro_description": "Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity."}}}}}, "$insert": {"CARD_short_name": "vanM"}}, "1925": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"113": {"$update": {"dna_sequence": {"$update": {"accession": "L11616.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "MexB"}}, "1926": {"$update": {"ARO_description": "CMY-34 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1993": {"$update": {"dna_sequence": {"$update": {"accession": "EF394370.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-34"}}, "1927": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"2024": {"$update": {"dna_sequence": {"$update": {"accession": "AF301532.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-29"}}, "1928": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1935": {"$update": {"dna_sequence": {"$update": {"accession": "AY306130.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-50"}}, "1929": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"779": {"$update": {"dna_sequence": {"$update": {"accession": "KJ207207.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-24"}}, "4226": {"$insert": {"CARD_short_name": "ADC-156"}}, "3278": {"$update": {"ARO_description": "AbaQ is an MFS transporter mainly involved in the extrusion of quinolone-type drugs in A. baumannii."}, "$insert": {"CARD_short_name": "Abau_AbaQ"}}, "3474": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-340"}}, "3475": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-341"}}, "830": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1635": {"$update": {"dna_sequence": {"$update": {"accession": "JX121124.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-157"}}, "831": {"$update": {"ARO_description": "OKP-B-13 is a beta-lactamase found in Klebsiella pneumoniae.", "model_sequences": {"$update": {"sequence": {"$update": {"1041": {"$update": {"dna_sequence": {"$update": {"accession": "AY825330.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "38817": {"$update": {"category_aro_description": "OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%."}}}}}, "$insert": {"CARD_short_name": "OKP-B-13"}}, "836": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1327": {"$update": {"dna_sequence": {"$update": {"accession": "AJ239002.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "TEM-68"}}, "837": {"$update": {"ARO_description": "vatH is a plasmid-mediated acetyltransferase found in Enterococcus faecium.", "model_sequences": {"$update": {"sequence": {"8208": {"dna_sequence": {"partial": "0", "sequence": "ATGGCAGAAAAATTAAAAGGACCCAACTCAAATGAAATGTATCCGATTGCCGGAAATAAAAGTGTTCAATTTGTTAAACCGTCATTAACAAGGCCCAATATTATAGTTGGTGAGTTCACTTATTATGATAGCAAGAACGGAGAGCTTTTTGAGGATCAAGTTCTGTATCATTATGAAATTATAGGGGATCGACTGATCATCGGGAAATTTTGTTCAATCGGTCCTGGAGTCACTTTTATTATGAATGGAGCTAATCATCGCATGGATGGCTCCACTTATCCATTTAATATCTTTGGGCATGGGTGGGAAAAGCATACACCTACACTAGATATGCTGCCTTTAAAGGGGGATACTATTGTTGGTAATGACGTATGGATTGGACTAGATGCTACAATTATGCCAGGCGTAAAAATAGGAGACGGCGCGATTATTGCAGCCAAATCTGTAGTAACAAAAGACGTTGACCCCTCCACAATTGTTGGTGGTAATCCTGCAAAACAAATAAAGAAACGATTTTCGGAGTCAAAAATTCAAGAACTATTAAAGATAAAATGGTGGGATTTTGAAGACCAGGTTATTAGCGATAATATTGATGCTATTCTAAGTTTGGATGTTGAAGCGCTTAATAATATTTCTAAAGAAAATGATTAG", "fmax": "3687", "accession": "GQ205627.2", "fmin": "3036", "strand": "+"}, "NCBI_taxonomy": {"NCBI_taxonomy_name": "Enterococcus faecium", "NCBI_taxonomy_id": "1352", "NCBI_taxonomy_cvterm_id": "36779"}, "protein_sequence": {"accession": "ACX92987.1", "sequence": "MAEKLKGPNSNEMYPIAGNKSVQFVKPSLTRPNIIVGEFTYYDSKNGELFEDQVLYHYEIIGDRLIIGKFCSIGPGVTFIMNGANHRMDGSTYPFNIFGHGWEKHTPTLDMLPLKGDTIVGNDVWIGLDATIMPGVKIGDGAIIAAKSVVTKDVDPSTIVGGNPAKQIKKRFSESKIQELLKIKWWDFEDQVISDNIDAILSLDVEALNNISKEND"}}}}}, "ARO_category": {"$update": {"37013": {"$update": {"category_aro_name": "virginiamycin M1", "category_aro_description": "Virginiamycin M1 is a streptogramin A antibiotic."}}}}}, "$insert": {"CARD_short_name": "vatH"}}, "834": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"540": {"$update": {"dna_sequence": {"$update": {"accession": "JF411006.1"}}}}}}}}}, "$insert": {"CARD_short_name": "FosA3"}}, "3473": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-339"}}, "4220": {"$insert": {"CARD_short_name": "ADC-150"}}, "838": {"$update": {"ARO_description": "CTX-M-102 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"946": {"$update": {"dna_sequence": {"$update": {"accession": "HQ398215.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-102"}}, "839": {"$update": {"ARO_description": "CMY-44 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"1586": {"$update": {"dna_sequence": {"$update": {"accession": "FJ437066.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-44"}}, "3478": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-344"}}, "3479": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-345"}}, "4221": {"$insert": {"CARD_short_name": "ADC-151"}}, "3": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}, "model_name": "Escherichia coli ompF with mutation conferring resistance to beta-lactam antibiotics"}, "$insert": {"CARD_short_name": "Ecol_ompF_BLA"}}, "4222": {"$insert": {"CARD_short_name": "ADC-152"}}, "4248": {"$insert": {"CARD_short_name": "ADC-180"}}, "4622": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}, "36205": {"$update": {"category_aro_description": "GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases."}}}}}, "$insert": {"CARD_short_name": "GES-39"}}, "4223": {"$insert": {"CARD_short_name": "ADC-153"}}, "671": {"$update": {"ARO_description": "CTX-M-137 is a beta-lactamase found in Escherichia coli.", "model_sequences": {"$update": {"sequence": {"$update": {"785": {"$update": {"dna_sequence": {"$update": {"accession": "AB900900.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CTX-M-137"}}, "1986": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"1131": {"$update": {"dna_sequence": {"$update": {"accession": "HF947514.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXA-309"}}, "5586": {"$insert": {"CARD_short_name": "PDC-459"}}, "3956": {"$update": {"ARO_description": "A beta-lactamase gene found in Klebsiella pneumonia. Directly submitted to NCBI without publication on 07-NOV-2018.", "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "SHV-223"}}, "2178": {"$update": {"ARO_description": "Homologous to vanA, contains a D-Ala-D-Lac ligase. The chromosome-located vanO gene cluster is inducible. Not much is known about the biochemistry about the vanO gene cluster. Gene orientation: orf1 RS orf2 HOX."}, "$insert": {"CARD_short_name": "vanO_cluster"}}, "5587": {"$insert": {"CARD_short_name": "PDC-46"}}, "2794": {"$update": {"ARO_description": "Point mutations in Helicobacter pylori shown to confer resistance to clarithromycin, a macrolide antibiotic.", "model_param": {"$update": {"snp": {"$update": {"param_value": {"$insert": {"12514": "A2143G", "12515": "A1410G", "12516": "A2167G", "12517": "C1707T", "12518": "C2922T"}}, "clinical": {"$insert": {"12514": "A2143G", "12515": "A1410G", "12516": "A2167G", "12517": "C1707T", "12518": "C2922T"}}}}}, "$insert": {"40330": {"param_value": {"12519": "C2248T,G2287A"}, "param_type_id": "40330", "param_type": "multiple resistance variants", "param_description": "A set of nucleotide or amino acid substitutions that are each required to confer resistance to an antibiotic drug or drug class by co-mutation. Compare to single resistance variant, where only one substitution is required. Multiple resistance variants parameters are indicated on appropriate models using the following notation: [wild-type 1][position 1][mutation 1],[wild-type 2][position 2][mutation 2],...,[wild-type n][position n][mutation n]. When each included substitution is detected in a protein sequence, resistance is conferred. This parameter is not currently included in any detection algorithms."}}}}, "$insert": {"CARD_short_name": "Hpyl_23S_CLR"}}, "3868": {"$insert": {"CARD_short_name": "PDC-44"}}, "5584": {"$insert": {"CARD_short_name": "PDC-457"}}, "3941": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"6304": {"$update": {"dna_sequence": {"$update": {"accession": "KY066478.1"}}}}}}}}}, "$insert": {"CARD_short_name": "CMY-144"}}, "3319": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"5297": {"$update": {"dna_sequence": {"$update": {"accession": "AP014611.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Ian"}}, "3318": {"$update": {"ARO_description": "An ADC beta-lactamase and cephalosporinase from Acinetobacter baumannii."}, "$insert": {"CARD_short_name": "ADC-60"}}, "5585": {"$insert": {"CARD_short_name": "PDC-458"}}, "5421": {"$insert": {"CARD_short_name": "PDC-289"}}, "5489": {"$insert": {"CARD_short_name": "PDC-36"}}, "5488": {"$insert": {"CARD_short_name": "PDC-359"}}, "5487": {"$insert": {"CARD_short_name": "PDC-358"}}, "5486": {"$insert": {"CARD_short_name": "PDC-357"}}, "3313": {"$update": {"ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "ACT-8"}}, "5484": {"$insert": {"CARD_short_name": "PDC-355"}}, "5483": {"$insert": {"CARD_short_name": "PDC-354"}}, "5482": {"$insert": {"CARD_short_name": "PDC-353"}}, "5481": {"$insert": {"CARD_short_name": "PDC-351"}}, "5480": {"$insert": {"CARD_short_name": "PDC-350"}}, "784": {"$update": {"model_sequences": {"$update": {"sequence": {"$update": {"81": {"$update": {"dna_sequence": {"$update": {"accession": "AF031330.1"}}}}}}}}}, "$insert": {"CARD_short_name": "AAC(6')-Iv"}}, "785": {"$update": {"ARO_description": "OXY-2-9 is a beta-lactamase found in Klebsiella oxytoca.", "model_sequences": {"$update": {"sequence": {"$update": {"1770": {"$update": {"dna_sequence": {"$update": {"accession": "FJ785625.1"}}}}}}}}, "ARO_category": {"$update": {"36017": {"$update": {"category_aro_description": "Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms."}}}}}, "$insert": {"CARD_short_name": "OXY-2-9"}}, "786": {"$update": {"ARO_description": "Also known as vanHO, is a vanH variant in the vanO gene cluster.", "model_sequences": {"$update": {"sequence": {"$update": {"576": {"$update": {"dna_sequence": {"$update": {"accession": "KF478993.1"}}}}}}}}, "model_name": "vanH gene in vanO cluster", "ARO_name": "vanH gene in vanO cluster"}, "$insert": {"CARD_short_name": "vanH_in_vanO_cl"}}, "787": {"$update": {"ARO_description": "dfrA23 is an integron-encoded dihydrofolate reductase found in Salmonella enterica.", "model_sequences": {"$update": {"sequence": {"8173": {"dna_sequence": {"partial": "0", "sequence": "ATGCCAACAGTTGAGATTATTGTTGCAGTTGATCCTGTTGGGGGATTTGGCCGGAATGGCCAAATCCCTTGGACGTGCAAGGAAGACATGAAGCGCTTCACCACCATATCCAAAGAGATTCGAGTGTGTGTGATGGGGAAGAACACATACAAAGACATGCTCGATATGCAAATGAAGAAGGAAGGCGCTGAAGAACGAATCAAAGAGAAGGGAATTCTTCCGGAGCGCGAATCTTACGTCGTGTCCTCGACTTTGAAGCCCGAGGACGTCATTGGAGCCACGGTAGTTCCGGACCTACGTGCGGTGCTCAATCAATATCACGACAGCGATCAACGAATAGCTGTCATTGGTGGAGAAAAGCTGTACGTGCAAGCCCTCGCATCTGCCACAAAAGTCCACATGACGGTAATGCACAAGCCATATAACTGCGATCGGACGTTGCCGATGTCATACATCGACAAAAAGTTTGTTGCAGGTCAAGGGTCTATCACCATTCAA