Model_id Action ARO_name ARO_category Changes To Summary 1718 UPDATE DIM-1 carbapenem; antibiotic inactivation; cephalosporin; DIM beta-lactamase; ARO_description; model_sequences; model_name "UPDATED ARO_description with Dutch imipenemase or DIM-1 is an integron-encoded metallo-beta-lactamase from Pseudomonas stutzeri. UPDATED partial with 0 UPDATED sequence with ATGAGAACACATTTTACAGCGTTATTACTTCTATTCAGCTTGTCTTCGCTTGCTAACGACGAGGTACCTGAGCTAAGAATCGAGAAAGTAAAAGAGAACATCTTTTTGCACACATCATACAGTCGTGTGAATGGGTTTGGTTTGGTCAGTTCAAACGGCCTTGTTGTCATAGATAAGGGTAATGCTTTCATTGTTGATACACCTTGGTCAGACCGAGATACAGAAACGCTCGTACATTGGATTCGTAAAAATGGTTATGAGCTACTGGGGAGTGTTTCTACTCATTGGCATGAGGATAGAACCGCAGGAATTAAATGGCTTAATGACCAATCAATTTCTACGTATGCCACGACTTCAACCAACCATCTCTTGAAAGAAAATAAAAAAGAGCCAGCGAAATACACCTTGAAAGGAAATGAGTCCACATTGGTTGACGGCCTTATCGAAGTATTTTATCCAGGAGGTGGTCATACAATAGACAACGTAGTGGTGTGGTTGCCAAAGTCGAAAATCTTATTTGGCGGCTGTTTTGTGCGTAGCCTTGATTCCGAGGGGTTAGGCTACACTGGTGAAGCCCATATTGATCAATGGTCCCGATCAGCTCAGAATGCTCTGTCTAGGTACTCAGAAGCCCAGATAGTAATTCCTGGCCATGGGAAAATCGGGGATATAGCGCTGTTAAAACACACCAAAAGTCTGGCTGAGACAGCCTCTAACAAATCAATCCAGCCGAACGCTAACGCGTCGGCTGATTGA UPDATED fmax with 796 UPDATED accession with KC004136.2 UPDATED fmin with 40 UPDATED strand with + UPDATED NCBI_taxonomy_name with Enterobacter sp. SL1 UPDATED NCBI_taxonomy_id with 1284354 UPDATED NCBI_taxonomy_cvterm_id with 39662 UPDATED accession with AGC92784.1 UPDATED sequence with MRTHFTALLLLFSLSSLANDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRKNGYELLGSVSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKEPAKYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPNANASAD UPDATED model_name with DIM-1 " 1867 UPDATE CTX-M-116 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-116 is a beta-lactamase found in Proteus mirabilis. UPDATED accession with JF966749.1 " 2031 UPDATE OXA-173 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-173 is a beta-lactamase found in A. baumannii. UPDATED accession with HM113559.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1866 UPDATE KPC-7 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with KPC-7 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with EU729727.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4026 UPDATE PDC-461 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-461 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4027 UPDATE PDC-19a PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-19a is a class C beta-lactamase found in Pseudomonas (multispecies). " 4024 UPDATE PDC-19b PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-19b is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4025 UPDATE PDC-380 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-380 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4022 UPDATE PDC-352 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-352 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4023 UPDATE PDC-464 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-464 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4020 UPDATE PDC-337 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-337 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4021 UPDATE PDC-212 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-212 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 643 UPDATE OXY-2-5 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-2-5 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with AJ746227.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4028 UPDATE PDC-272 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-272 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4029 UPDATE PDC-255 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-255 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 3383 UPDATE MCR-9.1 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; ARO_description; model_sequences; model_name "UPDATED ARO_description with A mobilized and plasmid-mediated colistin resistance gene and phosphoethanolamine transferase identified from a Salmonella enterica isolate. UPDATED NCBI_taxonomy_name with Enterobacterales UPDATED model_name with MCR-9.1 " 981 UPDATE OXA-86 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with DQ149247.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2030 UPDATE AAC(3)-IXa antibiotic inactivation; AAC(3); aminoglycoside antibiotic; neomycin; ARO_description; model_sequences "UPDATED ARO_description with AAC(3)-IXa is a chromosomal-encoded aminoglycoside acetyltransferase in Micromonospora chalcea. UPDATED accession with M55427.1 " 344 UPDATE SHV-188 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with LN515534.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 345 UPDATE bcrA peptide antibiotic; ATP-binding cassette (ABC) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; antibiotic efflux; bacitracin B; bacitracin F; bacitracin A; ARO_description; model_sequences "UPDATED ARO_description with bcrA is an ABC transporter found in Bacillus licheniformis that confers bacitracin resistance. UPDATED accession with L20573.1 " 346 UPDATE QnrB23 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB23 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii. UPDATED accession with FJ981622.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 347 UPDATE SFH-1 SFH beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED accession with AF197943.1 " 340 UPDATE CMY-51 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with JQ733571.1 " 341 UPDATE IMP-1 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IMP-1 is a beta-lactamase found in Serratia marcescens. UPDATED accession with AJ223604.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 342 UPDATE smeS penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; cephamycin; aminoglycoside antibiotic; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with smeS is the protein kinase sensor component of a two component signal transduction system that includes smeR. UPDATED accession with AF173226.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 343 UPDATE OXA-31 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-31 is a beta-lactamase found in P. aeruginosa. UPDATED accession with AF294653.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3997 UPDATE TEM-234 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3996 UPDATE TEM-233 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with TEM-233 is a beta-lactamase. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3995 UPDATE TEM-232 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3994 UPDATE TEM-231 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with TEM-231 is a beta-lactamase. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 348 UPDATE OXY-3-1 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-3-1 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with AF491278.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3992 UPDATE TEM-229 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3991 UPDATE TEM-228 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3990 UPDATE TEM-227 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4930 UPDATE OXA-604 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 595 UPDATE SHV-75 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACATCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGCATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACCCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 891 UPDATED accession with AM176550.2 UPDATED fmin with 30 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAJ47130.2 UPDATED sequence with MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPHNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4844 UPDATE OXA-509 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 965 UPDATE OXA-333 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF203107.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1343 UPDATE OXA-166 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HM488987.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 966 UPDATE vanSC glycopeptide antibiotic; vanS; antibiotic target alteration; glycopeptide resistance gene cluster; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanSC, is a vanS variant found in the vanC gene cluster. UPDATED accession with AF162694.1 UPDATED model_name with vanS gene in vanC cluster UPDATED ARO_name with vanS gene in vanC cluster " 967 UPDATE AAC(6')-Isa AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Isa is a plasmid-encoded aminoglycoside acetyltransferase in Streptomyces albulus. UPDATED accession with AB116646.1 " 1296 UPDATE OKP-B-12 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-B-12 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AJ635420.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 960 UPDATE TEM-137 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AM286274.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 961 UPDATE SHV-93 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with EF373969.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4732 UPDATE KPC-73 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4733 UPDATE KPC-74 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4730 UPDATE KPC-71 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4731 UPDATE KPC-72 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4736 UPDATE KPC-77 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4737 UPDATE KPC-78 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4734 UPDATE KPC-75 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4735 UPDATE KPC-76 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2317 UPDATE mgrB antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; pmr phosphoethanolamine transferase; macrolide antibiotic; peptide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; antibiotic target alteration; resistance by absence; erythromycin; ARO_description; ARO_category "UPDATED ARO_description with mgrB is a small transmembrane protein produced in the PhoPQ signalling system. It acts as a negative regulator in this system. Inactivation or down-regulation of mgrB confers colistin resistance by absence as shown in Klebsiella pneumoniae. UPDATED category_aro_description with Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin). " 2315 UPDATE Acinetobacter baumannii parC conferring resistance to fluoroquinolones grepafloxacin; trovafloxacin; ofloxacin; norfloxacin; nalidixic acid; lomefloxacin; gatifloxacin; sparfloxacin; levofloxacin; fluoroquinolone resistant parC; antibiotic target alteration; enoxacin; ciprofloxacin; pefloxacin; fluoroquinolone antibiotic; moxifloxacin; model_name "UPDATED model_name with Acinetobacter baumannii parC conferring resistance to fluoroquinolones " 2184 UPDATE glycopeptide resistance gene cluster VanC glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; ARO_description "UPDATED ARO_description with Confers low vancomycin resistance by engineering peptidoglycan precursors ending in D-Ala-D-Ser in an inducible or constitutive manner. The vanC cluster is intrinsic to the Enterococcus gallinarum chromosome. vanC organisms remain susceptible to teicoplanin. Gene orientation: vanC(XY)TRS. " 298 UPDATE vanYG1 glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanY; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanYG, is a vanY variant found in the vanG gene cluster. UPDATED accession with DQ212986.1 UPDATED model_name with vanY gene in vanG cluster UPDATED ARO_name with vanY gene in vanG cluster " 299 UPDATE CepS CepS beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences; model_name "UPDATED accession with X80277.1 UPDATED model_name with CepS " 296 UPDATE VIM-23 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-23 is a beta-lactamase found in Enterobacter cloacae. UPDATED accession with GQ242167.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 297 UPDATE CMY-98 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with KC603538.1 " 294 UPDATE CfxA4 antibiotic inactivation; cephamycin; CfxA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with cfxA4 beta-lactamase is a class A beta-lactamase found in Bacteroides fragilis. UPDATED accession with AY769933.1 UPDATED category_aro_description with CfxA beta-lactamases are class A beta-lactamases. " 295 UPDATE OXA-145 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-145 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with FJ790516.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 292 UPDATE TEM-17 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAACAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTAAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACCCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTTTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATTTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA UPDATED fmax with 861 UPDATED accession with Y14574.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Capnocytophaga ochracea UPDATED NCBI_taxonomy_id with 1018 UPDATED NCBI_taxonomy_cvterm_id with 36958 UPDATED accession with CAA74912.2 UPDATED sequence with MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 293 UPDATE SHV-180 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 290 UPDATE vatD dalfopristin; antibiotic inactivation; streptogramin vat acetyltransferase; virginiamycin M1; madumycin II; griseoviridin; streptogramin antibiotic; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with vatD is a transposon-mediated acetyltransferase found in Enterococcus faecium. UPDATED accession with AF368302.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 291 UPDATE APH(3')-Ia antibiotic inactivation; aminoglycoside antibiotic; paromomycin; kanamycin A; APH(3'); lividomycin B; ribostamycin; G418; neomycin; lividomycin A; ARO_category "UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'. " 3772 UPDATE FLC-1 FRI beta-lactamase; penam; antibiotic inactivation; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3771 UPDATE FRI-9 FRI beta-lactamase; penam; antibiotic inactivation; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3770 UPDATE FRI-8 FRI beta-lactamase; penam; antibiotic inactivation; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3777 UPDATE CTX-M-165 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamase, no other information available. " 3776 UPDATE CTX-M-164 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamase, no other information available. " 3775 UPDATE CTX-M-163 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamase, no other information available. " 3774 UPDATE CTX-M-162 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamase, no other information available. " 4835 UPDATE OXA-500 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3779 UPDATE Yrc-1 penam; antibiotic inactivation; cephalosporin; YRC Beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3778 UPDATE CTX-M-166 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamase, no other information available. " 2782 UPDATE Vibrio cholerae OmpU peptide antibiotic; BPI; General Bacterial Porin with reduced permeability to peptide antibiotics; reduced permeability to antibiotic; model_sequences "UPDATED accession with KJ699300.1 UPDATED accession with AID70696.1 " 4834 UPDATE OXA-498 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 270 UPDATE LEN-20 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with LEN-20 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED partial with 0 UPDATED sequence with ATGCGTTATGTTCGCCTGTGTGTTATCTCCCTGTTAGCCACCCTGCCACTGGCGGTAGACGCCGGTCCACAGCCGCTTGAGCAGATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTGGGGATGGTGGAAATGGATCTGGCCAGCGGCCGCACGCTGGCCGCCTGGCGCGCCGATGAACGCTTTCCCATGGTGAGCACCTTTAAAGTGCTGCTGTGCGGCGCGGTGCTGGCGCGGGTGGATGCCGGGCTCGAACAACTGGATCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCGGTCAGCGAAAAACACCTTACCGACGGGATGACGGTCGGCGAACTCTGCGCCGCCGCCATCACCCTGAGCGATAACAGCGCTGGCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCGGGATTAACTGCCTTTCTGCGCCAGATCGGTGACAACGTCACCCGTCTTGACCGCTGGGAAACGGCACTGAATGAGGCGCTTCCCGGCGACGCGCGCGACACCACCACCCCGGCCAGCATGGCCGCCACGCTGCGCAAACTACTGACCGCGCAGCATCTGAGCGCCCGTTCGCAACAGCAACTCCTGCAGTGGATGGTGGACGATCGGGTTGCCGGCCCGCTGATCCGCGCCGTGCTGCCGCCGGGCTGGTTTATCGCCGACAAAACCGGGGCTGGCGAACGGGGTGCGCGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAACCGGAGCGCATTGTGGTGATCTATCTGCGGGATACCCCGGTGAGTATGGCCGAGCGTAATCAACATATCGCCGGGATCGGCGCAGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 861 UPDATED accession with AM850910.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAP12348.2 UPDATED sequence with MRYVRLCVISLLATLPLAVDAGPQPLEQIKQSESQLSGRVGMVEMDLASGRTLAAWRADERFPMVSTFKVLLCGAVLARVDAGLEQLDRRIHYRQQDLVDYSPVSEKHLTDGMTVGELCAAAITLSDNSAGNLLLATVGGPAGLTAFLRQIGDNVTRLDRWETALNEALPGDARDTTTPASMAATLRKLLTAQHLSARSQQQLLQWMVDDRVAGPLIRAVLPPGWFIADKTGAGERGARGIVALLGPDGKPERIVVIYLRDTPVSMAERNQHIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 271 UPDATE CMY-4 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-4 is a beta-lactamase found in Proteus mirabilis. UPDATED accession with Y15130.1 " 272 UPDATE QnrB36 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB36 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii. UPDATED accession with JN173058.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 273 UPDATE VEB-7 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; model_sequences; ARO_category "UPDATED accession with FJ825622.1 UPDATED category_aro_description with VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam. " 274 UPDATE OXA-174 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-174 is a beta-lactamase found in A. baumannii. UPDATED accession with HM113560.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 275 UPDATE OKP-B-2 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-B-2 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051151.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 276 UPDATE tetR antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; antibiotic target alteration; tetracycline; ARO_description; model_sequences "UPDATED ARO_description with TetR is the repressor of the tetracycline resistance element; its N-terminal region forms a helix-turn-helix structure and binds DNA. Binding of tetracycline to TetR reduces the repressor affinity for the tetracycline resistance gene (tetA) promoter operator sites. Mutations arise within tetR results in lower affinity for tetracyclin. UPDATED accession with AL513383.1 " 277 UPDATE TEM-91 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AB049569.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 278 UPDATE imiS carbapenem; CphA beta-lactamase; antibiotic inactivation; model_sequences "UPDATED accession with Y10415.1 " 279 UPDATE CTX-M-107 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED partial with 1 UPDATED sequence with GGTTAAAAAATCACTGCGTCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACGGCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAAATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGCGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAACCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTTGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATGTCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGCGTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCGCGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTGGTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAGAACCGGCAGCGGTGGCTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAACCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCA UPDATED fmax with 864 UPDATED accession with JF274244.1 UPDATED fmin with 1 UPDATED strand with - UPDATED NCBI_taxonomy_name with Shigella sp. SH219 UPDATED NCBI_taxonomy_id with 1074433 UPDATED NCBI_taxonomy_cvterm_id with 39656 UPDATED accession with AEM44650.1 UPDATED sequence with VKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDRTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVT " 4836 UPDATE OXA-501 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4659 UPDATE GOB-46 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4658 UPDATE GOB-45 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 962 UPDATE OXA-356 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF297585.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 581 UPDATE QnrB19 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB19 is a plasmid-mediated quinolone resistance protein found in Escherichia coli. UPDATED accession with JX298080.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1612 UPDATE ErmR antibiotic target alteration; virginiamycin S2; vernamycin C; pristinamycin IC; patricin B; patricin A; oleandomycin; ostreogrycin B3; macrolide antibiotic; telithromycin; tylosin; lincosamide antibiotic; dirithromycin; clarithromycin; clindamycin; dalfopristin; pristinamycin IB; quinupristin; pristinamycin IA; Erm 23S ribosomal RNA methyltransferase; virginiamycin M1; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; roxithromycin; spiramycin; azithromycin; erythromycin; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGGCAGGTCCGCAAGACCGTCCGCGAGGGCGCGGACCCTCCTCCGGTCGCCCGCAGCGGCCGGTGGGCGGCCGCAGCCAGCGCGACCGCGACCGGCGGGTCCTCGGCCAGAACTTCCTGCGCGACCCGGCGACCATCCGGCGCATCGCCGACGCCGCCGACGTCGACCCCGACGGGCTCGTCGTCGAGGCGGGTCCCGGCGAAGGGCTGCTCACCCGCGAGCTCGCCCGACGCGCCGGGCGGGTACGCACCTACGAGCTGGACCAGCGCCTCGCGCGACGACTCTCGACCGACCTGGCCCAGGAGACGAGCATCGAGGTCGTCCACGCCGACTTCCTGACCGCGCCTCACCCCGAGGAGCCGTTCCAGTTCGTCGGCGCGATCCCCTACGGCATCACCTCCGCCATCGTCGACTGGTGCCTGACCGCCCCGACCCTGACGTCGGCGACCCTCGTGACCCAGCAGGAGTTCGCGCGCAAGCGGACGGGTGACTACGGACGGTGGACGGCCCTCACCGTCACCACGTGGCCGACCTTCGAGTGGCAGTACGTCGCCAAGGTCGACCGCACGCTGTTCACACCGGTGCCGCGCGTGCACTCCGCGATCATGCGGCTGCGCCGCCGCCCACAGCCCCTCCTGCGCGACGCGGCGGCGAGGTCGCGCTTCGCGGACATGGTGGAGATCGGCTTCGTCGGCAAGGGCGGCAGCCTCTACCGGTCGCTGACCCGGGAGTGGCCGCGCTCGAAGGTCGACAGCGCGTTCGCGCGCGCCGACGTCCACCACGACGAGATCGTCGCCTTCGTGCACCCCGACCAGTGGATCACGCTGTTCCAGCTCCTCGACGGGTCCCGTGGCGGCGCCGCGCGCGGACCGGGCGACCAGCGGGGGCGGCGCGGCCGCCCAGGCGGAGGCCCCCGGCCGGACGGTCGCGCGGGCGGCGGCCCGCGCCGCGACGCGGGCGGGCGCCGCACGGGTGACGGACGCGGAGGTCGCCCCCGTCCCCCGCGCGGCGGCCAGGCCTAG UPDATED fmax with 13472 UPDATED accession with AY623658.2 UPDATED fmin with 12449 UPDATED strand with + UPDATED NCBI_taxonomy_name with Aeromicrobium erythreum UPDATED NCBI_taxonomy_id with 2041 UPDATED NCBI_taxonomy_cvterm_id with 40506 UPDATED accession with AAU93796.1 UPDATED sequence with MAGPQDRPRGRGPSSGRPQRPVGGRSQRDRDRRVLGQNFLRDPATIRRIADAADVDPDGLVVEAGPGEGLLTRELARRAGRVRTYELDQRLARRLSTDLAQETSIEVVHADFLTAPHPEEPFQFVGAIPYGITSAIVDWCLTAPTLTSATLVTQQEFARKRTGDYGRWTALTVTTWPTFEWQYVAKVDRTLFTPVPRVHSAIMRLRRRPQPLLRDAAARSRFADMVEIGFVGKGGSLYRSLTREWPRSKVDSAFARADVHHDEIVAFVHPDQWITLFQLLDGSRGGAARGPGDQRGRRGRPGGGPRPDGRAGGGPRRDAGGRRTGDGRGGRPRPPRGGQA UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 1132 UPDATE OXA-88 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-88 is a beta-lactamase found in A. baumannii. UPDATED accession with DQ392963.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2263 UPDATE optrA pleuromutilin antibiotic; macrolide antibiotic; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; phenicol antibiotic; lincosamide antibiotic; model_sequences "UPDATED accession with KP399637.1 UPDATED accession with AKA86814.1 " 2260 UPDATE vatF dalfopristin; antibiotic inactivation; streptogramin vat acetyltransferase; virginiamycin M1; madumycin II; griseoviridin; streptogramin antibiotic; model_sequences; ARO_category "UPDATED accession with AF170730.1 UPDATED accession with AAF63432.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 2261 UPDATE lnuE antibiotic inactivation; lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; model_sequences "UPDATED accession with KF287643.1 UPDATED accession with AGT57825.1 " 2264 UPDATE oleC efflux pump complex or subunit conferring antibiotic resistance; ATP-binding cassette (ABC) antibiotic efflux pump; macrolide antibiotic; oleandomycin; antibiotic efflux; model_sequences "UPDATED accession with L06249.1 UPDATED accession with AAA26793.1 " 2265 UPDATE salA retapamulin; virginiamycin M1; pleuromutilin antibiotic; tiamulin; macrolide antibiotic; lincomycin; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; clindamycin; phenicol antibiotic; lincosamide antibiotic; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with salA is an ABC-F subfamily protein gene isolated from the chromosome of Mammaliicoccus sciuri conferring resistance to lincosamides and streptogramins. UPDATED accession with KC693025.1 UPDATED NCBI_taxonomy_name with Mammaliicoccus sciuri UPDATED NCBI_taxonomy_id with 1296 UPDATED NCBI_taxonomy_cvterm_id with 36794 UPDATED accession with AGN74946.1 DELETED 37716 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_cvterm_id with 37013 UPDATED category_aro_accession with 3000669 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with retapamulin UPDATED category_aro_cvterm_id with 37713 UPDATED category_aro_accession with 3001314 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Retapamulin is a semi-synthetic pleuromutilin antibiotic approved for the treatment of skin infections. UPDATED category_aro_name with tiamulin UPDATED category_aro_cvterm_id with 37015 UPDATED category_aro_accession with 3000671 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Tiamulin is a pleuromutilin derivative currently used in veterinary medicine. It binds to the 23 rRNA of the 50S ribosomal subunit to inhibit protein translation. UPDATED category_aro_name with clindamycin UPDATED category_aro_cvterm_id with 35983 UPDATED category_aro_accession with 0000066 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Clindamycin is a lincosamide antibiotic that blocks A-site aminoacyl-tRNA binding. It is usually used to treat infections with anaerobic bacteria but can also be used to treat some protozoal diseases, such as malaria. " 963 UPDATE CMY-69 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with JX049132.1 " 2445 UPDATE Erm(44)v antibiotic target alteration; streptogramin antibiotic; Erm 23S ribosomal RNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; model_name "UPDATED model_name with Erm(44)v " 47 UPDATE OXA-60 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-60 is a beta-lactamase found in Ralstonia pickettii. UPDATED partial with 0 UPDATED sequence with ATGCTGTCTCGCTACTCGAAGACCCTCGCGTTTGCCGTGGTGGCCTGCACGCTCGCAATAAGCACCGCCACCGCTCATGCCGAGCTGGTCGTGCGCAATGACCTCAAGCGCGTGTTCGACGACGCCGGCGTCTCCGGCACCTTCGTGCTGATGGACATCACCGCCGACCGTACCTATGTCGTCGATCCGGCGCGTGCCGCGCGGAGCATCCATCCGGCTTCGACGTTCAAGATTCCGAACAGCCTGATCGCCTTCGACACCGGGGCCGTGCGCGACGATCAGGAAGTGCTGCCCTACGGCGGCAAGCCGCAGCCTTACGAGCAGTGGGAGCACGACATGGCGTTACCCGAGGCGATTCGCCTGTCGGCCGTGCCGATCTATCAGGAAGTCGCGCGCCGCGTTGGCTTCGAGCGCATGCAGGCTTATGTCGATGCGTTCGACTACGGCAATCGCCAGCTCGGCAGCGCGATCGACCAGTTCTGGCTGCGTGGCCCGCTGGAGATTTCCGCTTTCGAAGAAGCACGCTTCACCAGCCGCATGGCGCTCAAGCAGTTGCCGGTGAAGCCGCGCACGTGGGACATGGTCCAGCGCATGCTGTTGATCGAGCAGCAGGGCGATGCCGCGCTATATGCCAAGACCGGCGTCGCCACCGAATACCAGCCGGAGATCGGTTGGTGGGCCGGCTGGGTGGAGCGTGCGGGGCATGTCTATGCATTCGCGCTGAACATCGACATGCCGCGCGAGGGCGATATGGCCAAGCGCATTCCGCTGGGCAAGCAGTTGATGCGGGCGCTCGAGGTGTGGCCGGCACCGTGA UPDATED fmax with 3586 UPDATED accession with AF525303.2 UPDATED fmin with 2770 UPDATED strand with + UPDATED NCBI_taxonomy_name with Ralstonia pickettii UPDATED NCBI_taxonomy_id with 329 UPDATED NCBI_taxonomy_cvterm_id with 36921 UPDATED accession with AAQ08905.1 UPDATED sequence with MLSRYSKTLAFAVVACTLAISTATAHAELVVRNDLKRVFDDAGVSGTFVLMDITADRTYVVDPARAARSIHPASTFKIPNSLIAFDTGAVRDDQEVLPYGGKPQPYEQWEHDMALPEAIRLSAVPIYQEVARRVGFERMQAYVDAFDYGNRQLGSAIDQFWLRGPLEISAFEEARFTSRMALKQLPVKPRTWDMVQRMLLIEQQGDAALYAKTGVATEYQPEIGWWAGWVERAGHVYAFALNIDMPREGDMAKRIPLGKQLMRALEVWPAP UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 108 UPDATE PDC-8 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED accession with FJ666071.1 " 109 UPDATE ErmE antibiotic target alteration; virginiamycin S2; vernamycin C; pristinamycin IC; patricin B; patricin A; oleandomycin; ostreogrycin B3; macrolide antibiotic; telithromycin; tylosin; lincosamide antibiotic; dirithromycin; clarithromycin; clindamycin; dalfopristin; pristinamycin IB; quinupristin; pristinamycin IA; Erm 23S ribosomal RNA methyltransferase; virginiamycin M1; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; roxithromycin; spiramycin; azithromycin; erythromycin; model_sequences; ARO_category "UPDATED accession with X51891.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 103 UPDATE SHV-12 penam; antibiotic inactivation; cephalosporin; carbapenem; ceftazidime; cefalotin; ceftriaxone; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AJ920369.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 100 UPDATE Mycobacterium tuberculosis ethA with mutation conferring resistance to ethionamide antibiotic target alteration; ethionamide; ethionamide resistant ethA; ARO_description; ARO_category "UPDATED ARO_description with Specific mutations that occurs on Mycobacterium tuberculosis ethA causing it to be ethionamide resistant. UPDATED category_aro_description with ethionamide is a second-line antitubercular agent that inhibits mycolic acid synthesis. UPDATED category_aro_description with Mutations that occurs on the ethA genes resulting in the inability to catalyzes the oxidation of ethionamide (ETH) to the corresponding sulfoxide (the active drug). " 101 UPDATE TEM-109 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY628175.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 106 UPDATE catB9 antibiotic inactivation; thiamphenicol; chloramphenicol acetyltransferase (CAT); azidamfenicol; phenicol antibiotic; chloramphenicol; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with catB9 is a chromosome-encoded variant of the cat gene found in Vibrio cholerae. UPDATED accession with AF462019.1 UPDATED category_aro_description with Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini. " 107 UPDATE TEM-43 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTAAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCTGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCATTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGACGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA UPDATED fmax with 861 UPDATED accession with U95363.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with AAC32889.2 UPDATED sequence with MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDHWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 104 UPDATE OXA-61 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-61 is a beta-lactamase found in Campylobacter jejuni. UPDATED accession with AY587956.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 105 UPDATE CARB-4 penam; antibiotic inactivation; CARB beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with CARB-4 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with U14749.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2047 UPDATE OXA-322 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF203096.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2044 UPDATE QnrB31 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB31 is a plasmid-mediated quinolone resistance protein found in Klebsiella pneumoniae. UPDATED partial with 0 UPDATED sequence with ATGACGCCATTACTGTATAAGAAAACAGGTACAAATATGGCTCTGGCGCTCGTGGGCGAAAAAATTGACAGAAACCGTTTCACCGGTGAGAAAATTGAAAATAGTACATTTTTTTTATGTGATTTTTCAGGAGCCGACCTGAGCGGCACTGAGTTTATCGGCTGTCAATTCTATGATCGTGAAAGCCAGAAAGGCTGCAATTTTAGTCGTGCGATGTTAAAGGATGCCATTTTTAAAAGCTGCGATTTATCCATGGCGGATTTTCGCAATGCAAGCGCCCTGGGTATTGAGATTTCTCATTGTAGGGCTCAGGGTGCAGATTTTCGCGGCGCAAGCTTTATGAACATGATTACCACGCGCACTTGGTTCTGCAGCGCGTATATCACGAATACGAATCTGTCTTATGCCAATTTTTCGAAAGTCGTGTTGGAGAAGTGTGAGTTATGGGAAAACCGTTGGATGGGTGCCCAGGTACTGGGCGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCAACTTTCGACTGGCGAGCAGCAAACTTTACACATTGCGATCTCACAAATTCGGAGTTGGGTGACTTAGATATTCGTCGGGTTGATTTACAAGGCGTTAAGTTGGACAACTACCAGGCTTCGTTGCTCATGGAGCGACTTGGCATCGCGATAATTGGTTGA UPDATED fmax with 681 UPDATED accession with HQ418999.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with ADQ43424.1 UPDATED sequence with MTPLLYKKTGTNMALALVGEKIDRNRFTGEKIENSTFFLCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNASALGIEISHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRRVDLQGVKLDNYQASLLMERLGIAIIG UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 2045 UPDATE OXY-2-3 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-2-3 is a beta-lactamase found in Klebsiella oxytoca. UPDATED partial with 0 UPDATED sequence with ATGATAAAAAGTTCGTGGCGTAAAATTGCAATGCTAGCCGCCGTTCCGCTGCTGCTGGCGAGCGGCGCACTGTGGGCCAGTACCGATGCTATCCATCAGAAGCTGACAGATCTCGAGAAGCGTTCAGGCGGCAGGTTGGGCGTGGCGCTAATCAACACGGCAGATAATTCTCAAATCTTATATCGCGGCGACGAGCGTTTTGCCATGTGCAGCACCAGTAAAGTGATGGCCGCCGCCGCGGTATTAAAACAGAGCGAAAGCAATAAAGAGGTGGTAAATAAAAGGCTGGAGATTAACGCAGCCGATTTGGTGGTCTGGAGTCCGATTACCGAAAAACATCTCCAGAGCGGAATGACGCTGGCTGAGCTAAGCGCGGCGACGCTGCAATATAGCGACAATACGGCGATGAATCTGATCATCGGCTACCTTGGCGGGCCGGAAAAAGTCACCGCCTTCGCCCGCAGTATCGGCGATGCCACCTTTCGTCTCGATCGTACGGAGCCCACGCTGAATACCGCCATCCCGGGCGATGAGCGTGATACCAGCACGCCGCTGGCGATGGCTGAAAGCCTACGCAAGCTGACGCTTGGCGATGCGCTGGGCGAACAGCAACGCGCCCAGTTAGTCACCTGGCTGAAAGGCAATACCACCGGCGGGCAAAGCATTCGCGCGGGCCTGCCTGAAAGCTGGGTGGTCGGCGATAAAACCGGCGGCGGAGATTACGGCACCACCAATGATATTGCGGTTATCTGGCCGGAAGATCACGCTCCGCTGGTATTAGTCACCTACTTTACCCAGCCGCAGCAGGATGCGAAAAACCGCAAAGAGGTGTTAGCCGCAGCGGCAAAAATCGTGACCGAAGGGCTTTAA UPDATED fmax with 1031 UPDATED accession with AY077488.2 UPDATED fmin with 161 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella oxytoca UPDATED NCBI_taxonomy_id with 571 UPDATED NCBI_taxonomy_cvterm_id with 36788 UPDATED accession with AAL78281.2 UPDATED sequence with MIKSSWRKIAMLAAVPLLLASGALWASTDAIHQKLTDLEKRSGGRLGVALINTADNSQILYRGDERFAMCSTSKVMAAAAVLKQSESNKEVVNKRLEINAADLVVWSPITEKHLQSGMTLAELSAATLQYSDNTAMNLIIGYLGGPEKVTAFARSIGDATFRLDRTEPTLNTAIPGDERDTSTPLAMAESLRKLTLGDALGEQQRAQLVTWLKGNTTGGQSIRAGLPESWVVGDKTGGGDYGTTNDIAVIWPEDHAPLVLVTYFTQPQQDAKNRKEVLAAAAKIVTEGL UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2042 UPDATE IND-8 carbapenem; antibiotic inactivation; IND beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IND-8 is a beta-lactamase found in Escherichia coli. UPDATED accession with GU186044.1 UPDATED category_aro_description with IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases. " 2043 UPDATE aadA8 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with aadA8 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in V. cholerae, K. pneumoniae and Bacillus endophyticus. UPDATED accession with AY139603.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 2040 UPDATE TEM-60 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF047171.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2041 UPDATE OXA-424 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KM588352.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4819 UPDATE OXA-114t carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4818 UPDATE OXA-114s carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1297 UPDATE CTX-M-80 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-80 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED partial with 0 UPDATED sequence with ATGGTTAAAAAATCACTGCGCCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACCGTGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAAATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGCGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAACCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTTGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATGTCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGCGTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCGCGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTGGTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGCGGTGACTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAACCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA UPDATED fmax with 876 UPDATED accession with EU202673.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with ABW86620.2 UPDATED sequence with MVKKSLRQFTLMATATVTLLLGSVPLYAQTVDVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL " 2048 UPDATE OXA-57 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-57 is a beta-lactamase found in Burkholderia pseudomallei. UPDATED accession with AJ631966.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2049 UPDATE QnrB72 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB72 is a plasmid-mediated quinolone resistance protein found in Citrobacter sp. TR21_24. UPDATED accession with KC741443.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1189 UPDATE vatB dalfopristin; antibiotic inactivation; streptogramin vat acetyltransferase; virginiamycin M1; madumycin II; griseoviridin; streptogramin antibiotic; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with vatB is a plasmid-mediated acetyltransferase found in Staphylococcus aureus. UPDATED accession with U19459.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 4144 UPDATE ACT-53 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 449 UPDATE SHV-133 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AB551737.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1364 UPDATE CMY-101 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with KF526114.1 " 1060 UPDATE SHV-103 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with EU032604.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4849 UPDATE OXA-514 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3519 UPDATE OXA-450 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3518 UPDATE OXA-449 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3513 UPDATE OXA-443 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3512 UPDATE OXA-442 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3511 UPDATE OXA-441 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3510 UPDATE OXA-440 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3517 UPDATE OXA-448 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3516 UPDATE OXA-447 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3515 UPDATE OXA-446 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3514 UPDATE OXA-444 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1420 UPDATE aadA5 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with aadA5 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids, transposons and integrons in E. coli, K. pneumoniae, Kluyvera georgiana, P. aeruginosa and E. cloacae. UPDATED accession with AF137361.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 2688 UPDATE ArmR sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; clavulanic acid; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; amoxicillin-clavulanic acid; colistin B; protein(s) and two-component regulatory system modulating antibiotic efflux; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; amoxicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2689 UPDATE Staphylococcus aureus 23S rRNA with mutation conferring resistance to linezolid 23S rRNA with mutation conferring resistance to linezolid antibiotics; pleuromutilin antibiotic; macrolide antibiotic; linezolid; streptogramin antibiotic; glycopeptide antibiotic; oxazolidinone antibiotic; antibiotic target alteration; phenicol antibiotic; lincosamide antibiotic; ARO_description "UPDATED ARO_description with Point mutations in the 23S rRNA subunit of the large ribosomal bacterial subunit in Staphylococcus aureus, which confer resistance to linezolid by disrupting antibiotic target binding. " 2685 UPDATE Pseudomonas aeruginosa CpxR sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; clavulanic acid; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; amoxicillin-clavulanic acid; colistin B; protein(s) and two-component regulatory system modulating antibiotic efflux; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; amoxicillin; penam; aminoglycoside antibiotic; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2686 UPDATE MexAB-OprM with CpxR regulator conferring resistance to ciprofloxacin, ceftazidime, and aztreonam sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; clavulanic acid; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; amoxicillin-clavulanic acid; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; amoxicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; model_description; ARO_category "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2680 UPDATE MexAB-OprM with prematurely terminated MexR conferring resistance to meropenem and ciprofloxacin sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; clavulanic acid; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; amoxicillin-clavulanic acid; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; amoxicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; model_description; ARO_category "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2681 UPDATE Escherichia coli fabG mutations conferring resistance to triclosan antibiotic target alteration; antibiotic resistant fabG; triclosan; disinfecting agents and antiseptics; ARO_category; model_name "UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. UPDATED model_name with Escherichia coli fabG mutations conferring resistance to triclosan " 2682 UPDATE MexAB-OprM with NalC mutations conferring resistance to aztreonam sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; clavulanic acid; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; trimethoprim; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; amoxicillin-clavulanic acid; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ampicillin; amoxicillin; penam; sulfamethoxazole; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; azithromycin; chloramphenicol; model_description; ARO_category "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2683 UPDATE MexAB-OprM with NalD mutations conferring resistance to multiple antibiotics sulfonamide antibiotic; penem; panipenem; tetracycline antibiotic; clavulanic acid; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; aztreonam; nalidixic acid; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; ciprofloxacin; cephamycin; ceftriaxone; amoxicillin-clavulanic acid; colistin B; colistin A; peptide antibiotic; diaminopyrimidine antibiotic; ticarcillin; ampicillin; amoxicillin; penam; sulfamethoxazole; novobiocin; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; trimethoprim-sulfamethoxazole; tetracycline; monobactam; fluoroquinolone antibiotic; erythromycin; trimethoprim; azithromycin; chloramphenicol; model_description; ARO_category; model_name "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED model_name with MexAB-OprM with NalD mutations conferring resistance to multiple antibiotics " 1436 UPDATE TEM-40 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with FR717535.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 122 UPDATE VIM-34 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-34 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with JX013656.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3999 UPDATE TEM-236 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1437 UPDATE AcrF penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; cephamycin; ciprofloxacin; fluoroquinolone antibiotic; model_sequences; model_name; ARO_category "UPDATED accession with U00096.1 UPDATED model_name with AcrF UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 645 UPDATE mecR1 penam; methicillin resistant PBP2; methicillin; antibiotic target replacement; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3998 UPDATE TEM-235 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 99 UPDATE QnrB38 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB38 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii. UPDATED partial with 0 UPDATED sequence with ATGGCTCTGGCATTAATTGGCGAAAAAATTGACAGAAACCGCTTCACCGGTGAAAAAGTTGAAAATAGCACTTTTTTTAACTGTGATTTTTCGGGTGCCGACCTTAGCGGTACTGAATTTATCGGCTGTCAGTTCTATGATCGAGAAAGCCAGAAAGGGTGCAATTTCAGTCGCGCAATACTGAAAGATGCCATTTTTAAAAGCTGTGATTTATCCATGGCGGATTTTCGCAACGTCAGTGCGTTGGGCATAGAAATTCGCCACTGCCGCGCACAGGGTGCAGATTTTCGCGGCGCAAGTTTCATGAATATGATCACCACGCGCACCTGGTTTTGCAGCGCATATATCACTAATACCAATCTAAGCTACGCCAACTTTTCGAAGGCCGTGCTTGAAAAGTGCGAATTGTGGGAAAATCGCTGGATGGGAACTCAGGTACTGGGTGCGACGTTGAGTGGTTCCGATCTCTCCGGTGGCGAGTTTTCGTCGTTCGACTGGCGGACGGCAAATTTCACGCACTGTGATTTGACCAATTCAGAACTGGGTGATTTAGATATTCGGGGCGTCGATTTACAAGGTGTCAAATTGGACAGCTATCAGGCCGCATTGCTCATGGAACGTCTTGGCATCGCTGTCATTGGCTAA UPDATED fmax with 2951 UPDATED accession with JN173060.2 UPDATED fmin with 2306 UPDATED strand with + UPDATED NCBI_taxonomy_name with Citrobacter freundii UPDATED NCBI_taxonomy_id with 546 UPDATED NCBI_taxonomy_cvterm_id with 36915 UPDATED accession with AEL00461.1 UPDATED sequence with MALALIGEKIDRNRFTGEKVENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAILKDAIFKSCDLSMADFRNVSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKAVLEKCELWENRWMGTQVLGATLSGSDLSGGEFSSFDWRTANFTHCDLTNSELGDLDIRGVDLQGVKLDSYQAALLMERLGIAVIG UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 98 UPDATE CMY-48 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGATGAAAAAATCGATATGCTGCGCGCTGCTGCTGACAGCCTCTTTCTCCACGTTTGCTGCCGCAAAAACAGAACAACAAATTGCCGATATCGTTAACCGCACCATCACACCACTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTGGCGATTATCTACGAGGGGAAACCTTATTACTTTACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGGTCGGTCAGTAAGACGTTTAACGGCGTGTTGGGCGGCGACGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCGGGGTATCAGCCTGCTGCACTTAGCCACCTATACAGCGGGTGGCCTGCCGCTGCAGATCCCCGATGACGTTACGGATAAAGCCGCATTACTGCGCTTTTATCAAAACTGGCAACCACAATGGACTCCGGGCGCTAAGCGTCTTTACGCTAACTCCAGCATTGGTCTGTTTGGTGCGCTGGCGGTGAAACCTTCAGGTATGAGCTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAAAGCGAACAAAAAAATTATGCCTGGGGCTATCGCGAAGGGAAGCCTGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATCGATATGGCCCGCTGGGTTCAGGCCAACATGGACGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGAGCTTGCGCAGTCTCGTTACTGGCGTATTGGTGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCAGCACCTGCCGTGAAAGCCTCATGGGTGCATAAAACGGGATCCACAGGTGGATTTGGCAGCTACGTTGCCTTCGTTCCAGAAAAAAACCTTGGCATAGTGATGCTGGCAAACAAAAGCTATCCTAACCCGGCTCGCGTAGAGGCGGCCTGGCGCATTCTTGAAAAACTGCAATAA UPDATED fmax with 2185 UPDATED accession with HM569226.2 UPDATED fmin with 1039 UPDATED strand with + UPDATED NCBI_taxonomy_name with Citrobacter freundii UPDATED NCBI_taxonomy_id with 546 UPDATED NCBI_taxonomy_cvterm_id with 36915 UPDATED accession with ADP02979.1 UPDATED sequence with MMKKSICCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYEGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWRGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQSEQKNYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPARVEAAWRILEKLQ " 91 UPDATE gadX penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; norfloxacin; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; oxacillin; cloxacillin; fluoroquinolone antibiotic; erythromycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 90 UPDATE Staphylococcus aureus rpoB mutants conferring resistance to rifampicin rifampin; rifapentine; rifabutin; rifamycin-resistant beta-subunit of RNA polymerase (rpoB); antibiotic target replacement; antibiotic target alteration; rifaximin; rifamycin antibiotic; ARO_description "UPDATED ARO_description with Point mutations that occurs in Staphylococcus aureus rpoB resulting in resistance to rifampicin. " 93 UPDATE SHV-105 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with FJ194944.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 92 UPDATE CTX-M-42 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-42 is a beta-lactamase found in Escherichia coli. UPDATED accession with DQ061159.1 " 95 UPDATE CMY-56 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-56 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with HQ322613.1 " 94 UPDATE CMY-79 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with JQ733576.1 " 97 UPDATE vanXYC glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanXY; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanXYC, is a vanXY variant found in the vanC gene cluster. UPDATED accession with AF162694.1 UPDATED model_name with vanXY gene in vanC cluster UPDATED ARO_name with vanXY gene in vanC cluster " 96 UPDATE OXA-426 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-426 is a beta-lactamase found in clinical isolates of Acinetobacter baumannii. It is carbapenem resistant. UPDATED accession with KM588354.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1623 UPDATE GIM-2 penam; GIM beta-lactamase; penem; carbapenem; cephalosporin; antibiotic inactivation; cephamycin; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with GIM-2 is a metallo-beta-lactamase present on an integron found in clinical isolates of Enterobacter cloacae in Germany. UPDATED accession with KM659858.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1622 UPDATE vanWG glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanW; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanWG, is a vanW variant found in the vanG gene cluster. UPDATED accession with DQ212986.1 UPDATED model_name with vanW gene in vanG cluster UPDATED ARO_name with vanW gene in vanG cluster " 1993 UPDATE QnrB74 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB74 is a plasmid-mediated quinolone resistance protein found in Escherichia coli. UPDATED accession with KJ415247.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1620 UPDATE CTX-M-156 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with KM211509.1 " 1627 UPDATE CTX-M-95 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with FN813245.1 " 1994 UPDATE gimA antibiotic inactivation; methymycin; oleandomycin; chalcomycin; gimA family macrolide glycosyltransferase; macrolide antibiotic; tylosin; model_sequences; ARO_category "UPDATED accession with AJ223970.1 UPDATED category_aro_description with Produced by Streptomyces bikiniensis. " 1625 UPDATE OXA-179 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HM570035.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1624 UPDATE lmrD efflux pump complex or subunit conferring antibiotic resistance; ATP-binding cassette (ABC) antibiotic efflux pump; antibiotic efflux; lincosamide antibiotic; ARO_description "UPDATED ARO_description with lmrD is a chromosomally-encoded efflux pump that confers resistance to lincosamides in Streptomyces lincolnensis and Lactococcus lactis. It can dimerize with lmrC. " 1999 UPDATE TEM-215 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with KP050492.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1998 UPDATE CTX-M-83 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-83 is a beta-lactamase found in Salmonella enterica. UPDATED accession with FJ214366.1 " 1629 UPDATE TEM-197 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with HQ877606.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1628 UPDATE SHV-154 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX121121.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 349 UPDATE vanL glycopeptide antibiotic; glycopeptide resistance gene cluster; Van ligase; antibiotic target alteration; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VanL is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Ser, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity in Enterococcus faecalis. UPDATED accession with EU250284.1 UPDATED category_aro_name with Van ligase UPDATED category_aro_description with Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity. " 3535 UPDATE OXA-473 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3534 UPDATE OXA-472 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2860 UPDATE PDC-81 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2861 UPDATE PDC-82 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2862 UPDATE PDC-83 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2863 UPDATE PDC-84 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 559 UPDATE vanXYE glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanXY; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanXY, is a vanXY variant found in the vanE gene cluster. UPDATED accession with FJ872411.1 UPDATED model_name with vanXY gene in vanE cluster UPDATED ARO_name with vanXY gene in vanE cluster " 558 UPDATE qacB efflux pump complex or subunit conferring antibiotic resistance; fluoroquinolone antibiotic; major facilitator superfamily (MFS) antibiotic efflux pump; antibiotic efflux; ARO_description; model_sequences "UPDATED ARO_description with qacB is a subunit of the qac multidrug efflux pump. UPDATED accession with AF535087.1 " 2866 UPDATE PDC-87 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2867 UPDATE PDC-88 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 555 UPDATE OXA-133 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-133 is a beta-lactamase found in A. radioresistens. UPDATED accession with EU571228.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 554 UPDATE OXA-163 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-163 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with HQ700343.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 557 UPDATE SHV-9 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with S82452.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 556 UPDATE vanYB glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanY; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanYB, is a vanY variant found in the vanB gene cluster. UPDATED accession with U35369.1 UPDATED model_name with vanY gene in vanB cluster UPDATED ARO_name with vanY gene in vanB cluster " 551 UPDATE CTX-M-117 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-117 is a beta-lactamase found in Escherichia coli. UPDATED accession with JN227085.1 " 550 UPDATE CMY-71 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with JQ711184.1 " 553 UPDATE VIM-35 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX982634.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 552 UPDATE QnrB28 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB28 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii. UPDATED accession with HM439643.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 5054 UPDATE OXA-745 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1438 UPDATE SHV-19 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF117743.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5055 UPDATE OXA-746 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1439 UPDATE SHV-80 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCACAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAGCGGGGTGCGCGCGGCATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 861 UPDATED accession with AM176555.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAJ47135.2 UPDATED sequence with MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPTGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1199 UPDATE SHV-168 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX870080.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1198 UPDATE mef(B) efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; model_name "UPDATED model_name with mef(B) " 3349 UPDATE tetU tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; ARO_description "UPDATED ARO_description with Tetracycline-resistant determinant encoded on the plasmid pKQ10 in Enterococcus faecium. " 1191 UPDATE mdtM antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; norfloxacin; disinfecting agents and antiseptics; efflux pump complex or subunit conferring antibiotic resistance; lincomycin; puromycin; acriflavine; nucleoside antibiotic; fluoroquinolone antibiotic; lincosamide antibiotic; phenicol antibiotic; chloramphenicol; ARO_description; ARO_category "UPDATED ARO_description with Multidrug resistance protein MdtM. UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 1190 UPDATE OXA-354 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF297583.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1193 UPDATE ErmH antibiotic target alteration; streptogramin antibiotic; Erm 23S ribosomal RNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; ARO_description; model_sequences "UPDATED ARO_description with ErmH is a plasmid-mediated methyltransferase found in Streptomyces thermotolerans. UPDATED accession with M16503.1 " 1192 UPDATE VEB-1 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; ARO_category "UPDATED category_aro_description with VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam. " 1195 UPDATE SHV-55 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGCGTTTTATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACATCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGAGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTAGCAAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATCGTGGTGATTTATCTGCGGGATACCCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 861 UPDATED accession with AJ863560.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAI10727.2 UPDATED sequence with MRFIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1194 UPDATE OXA-16 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF043100.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1197 UPDATE Mycobacterium tuberculosis rpsL mutations conferring resistance to Streptomycin antibiotic target alteration; antibiotic-resistant rpsL; streptomycin; aminoglycoside antibiotic; model_sequences; ARO_category "UPDATED accession with AE000516.1 UPDATED category_aro_description with Ribosomal protein S12 stabilizes the highly conserved pseudoknot structure formed by 16S rRNA. Amino acid substitutions in RpsL affect the higher-order structure of 16S rRNA and confer antibiotic resistance. " 1196 UPDATE OXA-71 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-71 is a beta-lactamase found in A. baumannii. UPDATED accession with AY750913.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1759 UPDATE vanF glycopeptide antibiotic; glycopeptide resistance gene cluster; Van ligase; antibiotic target alteration; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VanF is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Lac, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity. It is associated with both vancomycin and teicoplanin resistance in Paenibacillus popilliae. UPDATED accession with AF155139.1 UPDATED category_aro_name with Van ligase UPDATED category_aro_description with Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity. " 1758 UPDATE OXA-326 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF203100.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1757 UPDATE emrA efflux pump complex or subunit conferring antibiotic resistance; nalidixic acid; major facilitator superfamily (MFS) antibiotic efflux pump; fluoroquinolone antibiotic; antibiotic efflux; model_sequences "UPDATED accession with AP009048.1 " 1756 UPDATE CMY-93 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with KF992025.1 " 1755 UPDATE CTX-M-23 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-23 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with AF488377.1 " 1754 UPDATE vanO glycopeptide antibiotic; glycopeptide resistance gene cluster; Van ligase; antibiotic target alteration; model_sequences; ARO_category "UPDATED accession with KF478993.1 UPDATED category_aro_name with Van ligase UPDATED category_aro_description with Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity. " 1753 UPDATE SHV-148 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX121115.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1752 UPDATE MdtK efflux pump complex or subunit conferring antibiotic resistance; fluoroquinolone antibiotic; antibiotic efflux; multidrug and toxic compound extrusion (MATE) transporter; ciprofloxacin; model_name "UPDATED model_name with MdtK " 1751 UPDATE Erm(33) antibiotic target alteration; virginiamycin S2; vernamycin C; pristinamycin IC; patricin B; patricin A; oleandomycin; ostreogrycin B3; macrolide antibiotic; telithromycin; tylosin; lincosamide antibiotic; dirithromycin; clarithromycin; clindamycin; dalfopristin; pristinamycin IB; quinupristin; pristinamycin IA; Erm 23S ribosomal RNA methyltransferase; virginiamycin M1; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; roxithromycin; spiramycin; azithromycin; erythromycin; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Mammaliicoccus sciuri UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 1750 UPDATE OXA-254 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-254 is a beta-lactamase found in A. baumannii. UPDATED accession with AB781687.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1177 UPDATE KPC-12 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences; ARO_category "UPDATED accession with HQ641421.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1176 UPDATE Mycobacterium tuberculosis katG mutations conferring resistance to isoniazid isoniazid; isoniazid resistant katG; antibiotic target alteration; ARO_category; model_param "UPDATED category_aro_description with Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity. It is a catalase-peroxidases that catalyzes the activation of isoniazid. Mutations that arises within this protein cause changes that results in the inability for katG to activate antibiotics, conferring resistance. UPDATED 12300 with P365R UPDATED 12300 with P365R " 1174 UPDATE QnrB22 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB22 is a plasmid-mediated quinolone resistance protein found in Citrobacter werkmanii. UPDATED accession with FJ981621.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1173 UPDATE TEM-54 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF104442.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1172 UPDATE OXA-194 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HQ425492.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1171 UPDATE tet(44) chlortetracycline; demeclocycline; oxytetracycline; tetracycline antibiotic; tetracycline; antibiotic target protection; minocycline; tetracycline-resistant ribosomal protection protein; doxycycline; model_sequences; model_name "UPDATED accession with FN594949.1 UPDATED model_name with tet(44) " 1170 UPDATE CMY-46 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with FN556186.1 " 1179 UPDATE IMP-4 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IMP-4 is a beta-lactamase found in Acinetobacter baumannii. UPDATED accession with AF244145.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1178 UPDATE CMY-81 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with JQ733578.1 " 513 UPDATE CARB-19 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences; ARO_category "UPDATED accession with KJ934267.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 644 UPDATE OXY-2-1 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-2-1 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with AJ871866.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1285 UPDATE SAT-2 streptothricin acetyltransferase (SAT); streptothricin; antibiotic inactivation; nucleoside antibiotic; model_sequences; model_name "UPDATED accession with AB211124.1 UPDATED model_name with SAT-2 " 1284 UPDATE IND-15 carbapenem; antibiotic inactivation; IND beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IND-15 is a beta-lactamase found in Escherichia coli. UPDATED accession with AB563173.1 UPDATED category_aro_description with IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases. " 1287 UPDATE CTX-M-110 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with JF274242.1 " 1004 UPDATE vanRD glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanR; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanRD, is a mutated vanR variant found in the vanD gene cluster that caused constitutive expression of vanD peptidoglycan synthesis. UPDATED accession with AY082011.1 UPDATED model_name with vanR gene in vanD cluster UPDATED ARO_name with vanR gene in vanD cluster " 1281 UPDATE OXA-110 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-110 is a beta-lactamase found in A. baumannii. UPDATED accession with EF650036.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1280 UPDATE QnrB12 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB12 is a plasmid-mediated quinolone resistance protein found in Citrobacter werkmanii. UPDATED accession with AM774474.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1283 UPDATE KPC-6 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with KPC-6 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with EU555534.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1282 UPDATE SIM-1 carbapenem; penam; cephalosporin; antibiotic inactivation; SIM beta-lactamase; ARO_description; model_sequences; model_name; ARO_category "UPDATED ARO_description with SIM-1 is an integron-encoded Ambler class B beta-lactamase isolated from Acinetobacter baumannii. UPDATED accession with GQ288397.1 UPDATED model_name with SIM-1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1003 UPDATE OXA-18 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with U85514.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1289 UPDATE OKP-B-7 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-B-7 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051156.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 1288 UPDATE OXA-82 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-82 is a beta-lactamase found in A. baumannii. UPDATED accession with EU019536.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1002 UPDATE AAC(6')-Ib4 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; model_sequences "UPDATED accession with AF445082.1 " 876 UPDATE smeE antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; fluoroquinolone antibiotic; phenicol antibiotic; tetracycline; chloramphenicol; ARO_description; model_sequences "UPDATED ARO_description with smeE is the RND protein of the efflux complex smeDEF in Stenotrophomonas maltophilia. UPDATED accession with AJ252200.1 " 1579 UPDATE QnrB9 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB9 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii. UPDATED accession with EF526508.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1578 UPDATE SHV-123 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with GQ390805.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 689 UPDATE CTX-M-123 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-123 is a beta-lactamase found in Escherichia coli. UPDATED accession with JN790864.1 " 688 UPDATE MOX-2 penam; antibiotic inactivation; MOX beta-lactamase; cephamycin; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with MOX-2 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AJ276453.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1872 UPDATE vanXYL glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanXY; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanXYL, is a vanXY variant found in the vanL gene cluster. UPDATED accession with EU250284.1 UPDATED model_name with vanXY gene in vanL cluster UPDATED ARO_name with vanXY gene in vanL cluster " 877 UPDATE SHV-124 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with GQ390806.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 685 UPDATE OXA-239 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with JQ837239.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 684 UPDATE SHV-37 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF467948.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 687 UPDATE APH(3')-Vc antibiotic inactivation; aminoglycoside antibiotic; paromomycin; APH(3'); ribostamycin; G418; neomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(3')-Vc is a chromosomal-encoded aminoglycoside phosphotransferase in M. chalcea. UPDATED accession with S81599.1 UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'. " 686 UPDATE OXA-162 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-162 is a beta-lactamase found in Enterobacteriaceae. UPDATED accession with HM015773.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 681 UPDATE TEM-120 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY243512.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 680 UPDATE CMY-54 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-54 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with HM544039.1 " 683 UPDATE CMY-75 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with JQ733572.1 " 682 UPDATE QnrS4 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrS4 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica. UPDATED accession with FJ418153.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1227 UPDATE aadA2 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; model_sequences; ARO_category "UPDATED accession with AF156486.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 875 UPDATE dfrA19 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description; model_sequences "UPDATED ARO_description with dfrA19 is an integron-encoded dihydrofolate reductase found in Klebsiella pneumoniae. UPDATED accession with AJ310778.1 " 469 UPDATE SHV-49 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY528718.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 872 UPDATE vatC dalfopristin; antibiotic inactivation; streptogramin vat acetyltransferase; virginiamycin M1; madumycin II; griseoviridin; streptogramin antibiotic; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with vatC is a plasmid-mediated acetyltransferase found in Staphylococcus cohnii. UPDATED accession with AF015628.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 1225 UPDATE TEM-178 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with X97254.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3435 UPDATE OXA-268 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 620 UPDATE OXA-320 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-320 is a beta-lactamase found in Proteus mirabilis. UPDATED accession with KF151169.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 870 UPDATE otr(B) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; ARO_description; model_sequences "UPDATED ARO_description with otr(B) is a tetracycline resistance efflux pump found in Streptomyces rimosus. UPDATED accession with AF079900.1 " 1223 UPDATE vph peptide antibiotic; viomycin phosphotransferase; antibiotic inactivation; viomycin; ARO_description; model_sequences; model_name "UPDATED ARO_description with vph is a phosphotransferase that confers resistance to viomycin in Streptomyces vinaceus. UPDATED accession with X02393.1 UPDATED model_name with vph " 871 UPDATE CGB-1 carbapenem; penam; cephalosporin; antibiotic inactivation; CGB beta-lactamase; ARO_description; model_sequences; model_name; ARO_category "UPDATED ARO_description with CGB-1 is an Ambler class B beta-lactamase that mediates resistance for carbapenems in Chryseobacterium gleum. UPDATED accession with EF672680.1 UPDATED model_name with CGB-1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 626 UPDATE vanHB glycopeptide antibiotic; glycopeptide resistance gene cluster; vanH; antibiotic target alteration; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanHB, is a vanH variant in the vanB gene cluster. UPDATED accession with U35369.1 UPDATED model_name with vanH gene in vanB cluster UPDATED ARO_name with vanH gene in vanB cluster " 2037 UPDATE tetT chlortetracycline; demeclocycline; oxytetracycline; tetracycline antibiotic; tetracycline; antibiotic target protection; minocycline; tetracycline-resistant ribosomal protection protein; doxycycline; model_sequences "UPDATED accession with L42544.1 " 4389 UPDATE BlaB-28 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4388 UPDATE BlaB-27 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 625 UPDATE QnrB46 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB46 is a plasmid-mediated quinolone resistance protein found in Escherichia coli. UPDATED partial with 0 UPDATED sequence with ATGACGCCATTACTGTATAAGAAAACAGGAACAAATATGGCTCTAGCGCTCGTGGGCGAAAAAATTGACAGAAACCGTTTCACCGGTGAAAAAATTGAAAATAGTACATTTTTTAACTGTGATTTTTCAGGAGCGGACCTGAGCGGCACTGAGTTTATCGGCTGCCAATTTTATGATCGTGAAAGCCAGAAAGGCTGTAATTTTAGCCGTGCGATGTTAAAGGATGCTATTTTTAAAAGCTGCGATTTATCCATGGCCGATTTTCGCAATGCAAGCGCCCTGGGTATTGAGATTCGTCATTGTAGGGCTCAGGGTGCAGATTTTCGCGGCGCAAGCTTTATGAACATGATTACCACGCGAACTTGGTTCTGCAGCGCGTATATCACGAATACGAATCTGTCTTATGCCAATTTTTCGAAAGCAGTGTTGGAGAAGTGTGAATTATGGGAAAACCGTTGGATGGGTGCCCAGGTACTGGGCGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTTCAACTTTCGACTGGCGAGCAGCAAACTTTACACATTGCGATCTCACAAATTCGGAGTTGGGTGACTTAGATATTCGTCGGGTTGATTTACAAGGCGTTAAGTTGGACAACTACCAGGCTTCGTTGCTCATGGAGCGACTTGGCATCGCGATAATTGGATGA UPDATED fmax with 681 UPDATED accession with HQ704413.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with ADW54092.1 UPDATED sequence with MTPLLYKKTGTNMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNASALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKAVLEKCELWENRWMGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRRVDLQGVKLDNYQASLLMERLGIAIIG UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 5629 UPDATE PLN-1 carbapenem; antibiotic inactivation; PLN beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 4383 UPDATE BlaB-22 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4382 UPDATE BlaB-20 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4381 UPDATE BlaB-2 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4380 UPDATE BlaB-19 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4387 UPDATE BlaB-26 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5622 UPDATE PFM-1 carbapenem; antibiotic inactivation; PFM beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 4385 UPDATE BlaB-24 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4384 UPDATE BlaB-23 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 407 UPDATE OXA-352 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF297581.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 406 UPDATE ACC-4 penam; monobactam; cephalosporin; ACC beta-lactamase; antibiotic inactivation; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with ACC-4 is a beta-lactamase found in Escherichia coli. UPDATED partial with 0 UPDATED sequence with ATGCAGAACACATTGAAGCTGTTATCCGTGATTACCTGTCTGGCAGCAACTGTCCAAGGTGCTCTGGCTGCTAATATCGATGAGAGCAAAATTAAAGACACCGTTGATGACCTGATCCAGCCGCTGATGCAGAAGAATAATATTCCCGGTATGTCGGTCGCAGTGACCGTCAACGGTAAAAACTACATTTATAACTATGGGTTAGCGGCAAAACAGCCTCAGCAGCCGGTTACGGAAAATACGTTATTTGAAGTGGGTTCGCTGAGTAAAACGTTTGCTGCCACCTTGGCGTCCTATGCGCAGGTGAGCGGTAAGCTGTCTTTGGATCAAAGCGTTAGCCATTACGTTCCAGAGTTGCGTGGCAGCAGCTTTGACCACGTTAGCGTACTCAATGTGGGCACGCATACCTCAGGCCTACAGCTATTTATGCCGGAAGATATTAAAAATACCACACAGCTGATGGCTTATCTAAAAGCATGGAAACCTGCCGATGCGGCTGGAACCCATCGCGTTTATTCCAATATCGGTACTGGTTTGCTAGGGATGATTGCGGCGAAAAGTCTGGGTGTGAGCTATGAAGATGCGATTGAGAAAACCCTCCTTCCTCAGTTAGGCATGCATCACAGCTACTTGAAGGTTCCGGCTGACCAGATGGAAAACTATGCGTGGGGCTACAACAAGAAAGATGAGCCAGTGCACGGGAATATGGAGATTTTGGGTAACGAAGCTTATGGTATCAAAACCACCTCCAGCGACTTGTTACGCTACGTGCAAGCCAATATGGGGCAGTTAAAGCTTGATGCTAATGCCAAGATGCAACAGGCTCTGACAGCCACCCACACCGGCTATTTCAAATCGGGTGAGATTACTCAGGATCTGATGTGGGAGCAGCTGCCATATCCGGTTTCTCTGCCGAATTTGCTCACCGGTAACGATATGGCGATGACGAAAAGCGTGGCTACGCCGATTGTTCCGCCGTTACCGCCACAGGAAAATGTGTGGATTAATAAGACCGGATCAACTAACGGCTTCGGTGCCTATATTGCGTTTGTTCCTGCTAAGAAGATGGGGATCGTGATGCTGGCTAACAAAAACTACTCAATCGATCAGCGAGTGACGGTGGCGTATAAAATCCTGAGCTCATTGGAAGGGAATAAGTAG UPDATED fmax with 3155 UPDATED accession with EF504260.2 UPDATED fmin with 1994 UPDATED strand with - UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with ABP49606.1 UPDATED sequence with MQNTLKLLSVITCLAATVQGALAANIDESKIKDTVDDLIQPLMQKNNIPGMSVAVTVNGKNYIYNYGLAAKQPQQPVTENTLFEVGSLSKTFAATLASYAQVSGKLSLDQSVSHYVPELRGSSFDHVSVLNVGTHTSGLQLFMPEDIKNTTQLMAYLKAWKPADAAGTHRVYSNIGTGLLGMIAAKSLGVSYEDAIEKTLLPQLGMHHSYLKVPADQMENYAWGYNKKDEPVHGNMEILGNEAYGIKTTSSDLLRYVQANMGQLKLDANAKMQQALTATHTGYFKSGEITQDLMWEQLPYPVSLPNLLTGNDMAMTKSVATPIVPPLPPQENVWINKTGSTNGFGAYIAFVPAKKMGIVMLANKNYSIDQRVTVAYKILSSLEGNK UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 405 UPDATE OXA-202 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-202 is a beta-lactamase found in A. baumannii. UPDATED accession with HQ734813.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1372 UPDATE ANT(2'')-Ia antibiotic inactivation; plazomicin; kanamycin A; ANT(2''); gentamicin B; gentamicin C; aminoglycoside antibiotic; tobramycin; ARO_description; model_sequences "UPDATED ARO_description with Plasmid or integron-encoded nucleotidylylation of 2-deoxystreptamine aminoglycosides at the hydroxyl group at position 2'' in P. aeruginosa, K. pneumoniae, Morganella morganii, E. coli, S. typhimurium, C. freundii and A. baumannii. UPDATED accession with AF078527.1 " 1375 UPDATE CMY-11 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-11 is a beta-lactamase found in Escherichia coli. UPDATED accession with AF357599.1 " 402 UPDATE tet(Y) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; model_sequences "UPDATED accession with AF070999.1 " 1377 UPDATE CTX-M-60 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with AM411407.1 " 400 UPDATE PDC-1 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED accession with FJ666065.1 " 1379 UPDATE OXA-313 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-313 is a beta-lactamase found in A. baumannii. UPDATED accession with KF057030.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1378 UPDATE AAC(3)-IIc antibiotic inactivation; AAC(3); paromomycin; kanamycin A; aminoglycoside antibiotic; neomycin; butirosin; ARO_description; model_sequences "UPDATED ARO_description with AAC(3)-IIc is a plasmid-encoded aminoglycoside acetyltransferase in E. coli and P. aeruginosa. UPDATED accession with X54723.1 " 629 UPDATE VIM-28 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences; ARO_category "UPDATED accession with JF900599.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 409 UPDATE vanRL glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanR; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanRL, is a vanR variant found in the vanL gene cluster. UPDATED accession with EU250284.1 UPDATED model_name with vanR gene in vanL cluster UPDATED ARO_name with vanR gene in vanL cluster " 408 UPDATE OXA-380 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF986261.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3834 UPDATE Mycobacterium tuberculosis katG mutations conferring resistance to prothionamide antibiotic target alteration; prothionamide resistant katG; prothionamide; ARO_description; ARO_category "UPDATED ARO_description with Mutations in Mycobacterium tuberculosis katG conferring resistance to prothionamide, an analogue of isoniazid. UPDATED category_aro_description with Mutations associated with katG conferring resistance to prothionamide, an analogue of isoniazid. Like isoniazid, prothionamide targets lnhA. " 3836 UPDATE Mycobacterium tuberculosis ethA mutations conferring resistance to isoniazid isoniazid; antibiotic target alteration; isoniazid resistant ethA; ARO_description; ARO_category "UPDATED ARO_description with Mutations in Mycobacterium tuberculosis ethA conferring resistance to isoniazid. UPDATED category_aro_description with Mutations in ethA conferring resistance to isoniazid. " 628 UPDATE catB10 antibiotic inactivation; thiamphenicol; chloramphenicol acetyltransferase (CAT); azidamfenicol; phenicol antibiotic; chloramphenicol; ARO_description; ARO_category "UPDATED ARO_description with catB10 is an integron-encoded variant of the cat gene found in P. aeruginosa. UPDATED category_aro_description with Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini. " 3830 UPDATE qacL efflux pump complex or subunit conferring antibiotic resistance; small multidrug resistance (SMR) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with A subunit of the qac multidrug efflux pump in Vibrio cholerae. UPDATED accession with AAZ42322.1 UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 1242 UPDATE aadA6/aadA10 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with aadA6/aadA10 is an integron-encoded aminoglycoside nucleotidyltransferase gene cassette in P. aeruginosa. UPDATED accession with AM087405.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 1344 UPDATE MexH antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; efflux pump complex or subunit conferring antibiotic resistance; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; disinfecting agents and antiseptics; tetracycline; ARO_category; model_name "UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 UPDATED model_name with MexH " 4973 UPDATE OXA-652 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3838 UPDATE Mycobacterium tuberculosis mshA mutations conferring resistance to prothionamide antibiotic target alteration; prothionamide; prothionamide resistant mshA; ARO_description; ARO_category "UPDATED ARO_description with Mutations in Mycobacterium tuberculosis mshA conferring resistance to prothionamide, an analogue to isoniazid. UPDATED category_aro_description with Mutations in mshA conferring resistance to prothionamide, an analogue of isoniazid. " 3839 UPDATE blaS1 penam; antibiotic inactivation; mezlocillin; cefixime; blaS; cephalosporin; cephamycin; oxacillin; carbenicillin; ampicillin; piperacillin; ceftriaxone; cefoxitin; ARO_description; ARO_category "UPDATED ARO_description with Predominant beta-lactamase in Mycolicibacterium smegmatis. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with A class A beta-lactamase in Mycolicibacterium smegmatis. " 3452 UPDATE OXA-288 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4031 UPDATE PDC-183 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-183 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4033 UPDATE PDC-306 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-306 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4032 UPDATE PDC-207 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-207 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4035 UPDATE PDC-117 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-117 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 1229 UPDATE CTX-M-6 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-6 is a beta-lactamase found in Salmonella typhimurium. UPDATED accession with AJ005044.1 " 4037 UPDATE PDC-104 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-104 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 2748 UPDATE oqxAB antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; trimethoprim; efflux pump complex or subunit conferring antibiotic resistance; diaminopyrimidine antibiotic; tigecycline; glycylcycline; ciprofloxacin; tetracycline antibiotic; nitrofuran antibiotic; fluoroquinolone antibiotic; nitrofurantoin; model_description "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). " 4039 UPDATE PDC-292 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-292 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 4038 UPDATE PDC-173 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with PDC-173 is a class C beta-lactamase found in Pseudomonas aeruginosa. " 1228 UPDATE CMY-30 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGGTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAA UPDATED fmax with 1143 UPDATED accession with EF685372.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with ABS12249.1 UPDATED sequence with MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHGSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ " 4598 UPDATE EFM-1 carbapenem; antibiotic inactivation; EFM beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 4599 UPDATE ELM-1 carbapenem; antibiotic inactivation; ELM beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 379 UPDATE OXA-148 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with GQ853679.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 378 UPDATE TEM-214 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with KP050491.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2039 UPDATE CARB-18 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences; ARO_category "UPDATED accession with KJ934266.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 371 UPDATE SHV-8 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with U92041.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 373 UPDATE MIR-3 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY743435.1 UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 372 UPDATE qacA efflux pump complex or subunit conferring antibiotic resistance; fluoroquinolone antibiotic; major facilitator superfamily (MFS) antibiotic efflux pump; antibiotic efflux; ARO_description; model_sequences "UPDATED ARO_description with qacA is a subunit of the qac multidrug efflux pump. UPDATED accession with AB566411.1 " 375 UPDATE mdtH antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; norfloxacin; efflux pump complex or subunit conferring antibiotic resistance; fluoroquinolone antibiotic; enoxacin; ARO_description; model_sequences "UPDATED ARO_description with Multidrug resistance protein MdtH. UPDATED accession with U00096.1 " 374 UPDATE SHV-21 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF117745.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 376 UPDATE lnuC antibiotic inactivation; lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; ARO_description; model_sequences "UPDATED ARO_description with lnuC is a transposon-mediated nucleotidyltransferase found in Streptococcus agalactiae. UPDATED accession with AY928180.1 " 4739 UPDATE KPC-80 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 393 UPDATE QnrS5 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrS5 is a plasmid-mediated quinolone resistance protein found in Aeromonas sobria. UPDATED accession with HQ631377.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 392 UPDATE TUS-1 carbapenem; antibiotic inactivation; TUS beta-lactamase; cephamycin; cephalosporin; ARO_description; model_sequences; model_name; ARO_category "UPDATED ARO_description with TUS-1 is a chromosome-encoded beta-lactamase from Myroides odoratus and Myroides odoratimimus. UPDATED accession with AF441287.1 UPDATED model_name with TUS-1 UPDATED category_aro_description with TUS beta-lactamases are Class B beta-lactamases that can hydrolyze a variety of beta-lactams, such as cephems and carbapenems. " 391 UPDATE VIM-2 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences; ARO_category "UPDATED accession with EF614235.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 390 UPDATE vanSG glycopeptide antibiotic; vanS; antibiotic target alteration; glycopeptide resistance gene cluster; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanSG, is a vanS variant found in the vanG gene cluster. UPDATED accession with DQ212986.1 UPDATED model_name with vanS gene in vanG cluster UPDATED ARO_name with vanS gene in vanG cluster " 397 UPDATE OXA-357 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF421160.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 396 UPDATE sul3 sulfadiazine; sulfadoxine; sulfacetamide; sulfadimidine; mafenide; sulfamethoxazole; sulfisoxazole; sulfonamide resistant sul; antibiotic target replacement; sulfamethizole; sulfasalazine; sulfonamide antibiotic; model_sequences "UPDATED accession with FJ196385.1 " 395 UPDATE blaF penam; amoxicillin; antibiotic inactivation; blaF family beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with Class A beta-lactamase found in Mycolicibacterium fortuitum. UPDATED accession with L25634.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 394 UPDATE OXA-130 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-130 is a beta-lactamase found in A. baumannii. UPDATED accession with EU547445.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 399 UPDATE MIR-16 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; model_sequences; ARO_category "UPDATED accession with KM087861.1 UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 398 UPDATE TEM-71 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF203816.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2308 UPDATE Acinetobacter baumannii OprD conferring resistance to imipenem penam; carbapenem; imipenem; penem; reduced permeability to antibiotic; Outer Membrane Porin (Opr); cephalosporin; cephamycin; monobactam; resistance by absence; ARO_category; model_name "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin). UPDATED model_name with Acinetobacter baumannii OprD conferring resistance to imipenem " 4729 UPDATE KPC-66 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4728 UPDATE KPC-65 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3960 UPDATE SHV-218 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with A beta-lactamase gene found in Klebsiella pneumoniae. Directly submitted to NCBI without publication on 07-NOV-2018. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2301 UPDATE Enterococcus faecalis YybT with mutation conferring daptomycin resistance peptide antibiotic; antibiotic target alteration; daptomycin; daptomycin resistant YybT; ARO_category "UPDATED category_aro_description with Mutations to the YybT gene confers daptomycin resistance. " 2300 UPDATE Acinetobacter baumannii ampC beta-lactamase penam; antibiotic inactivation; cephalosporin; cefepime; piperacillin; ampC-type beta-lactamase; ARO_category; model_name "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED model_name with Acinetobacter baumannii ampC beta-lactamase " 2303 UPDATE bcr-1 antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; bicyclomycin; ARO_description "UPDATED ARO_description with Transmembrane protein which expels bicyclomycin from the cell, leading to bicyclomycin resistance. Identified in Pseudomonas aeruginosa strains responsible for outbreaks in Brazil, often appearing with blaSPM-1, another bicyclomycin resistance gene. " 4726 UPDATE KPC-63 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4720 UPDATE KPC-44 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2307 UPDATE carO carbapenem; reduced permeability to antibiotic; resistance by absence; CarO porin; ARO_category; model_name "UPDATED category_aro_description with Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin). UPDATED model_name with carO " 4722 UPDATE KPC-59 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1358 UPDATE VIM-24 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-24 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with HM855205.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1246 UPDATE AAC(2')-Ic antibiotic inactivation; AAC(2'); arbekacin; gentamicin B; gentamicin C; amikacin; aminoglycoside antibiotic; tobramycin; ARO_description "UPDATED ARO_description with AAC(2')-Ic is a chromosomal-encoded aminoglycoside acetyltransferase in M. tuberculosis and Mycobacterium tuberculosis variant bovis. " 5105 UPDATE OXA-800 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 245 UPDATE cmlA5 antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; chloramphenicol; ARO_description; model_sequences "UPDATED ARO_description with cmlA5 is a plasmid or transposon-encoded chloramphenicol exporter that is found in Escherichia coli. UPDATED accession with AY115475.1 " 244 UPDATE SHV-164 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with HE981194.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 247 UPDATE TEM-158 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with EF534736.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 246 UPDATE CTX-M-126 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with AB703103.1 " 241 UPDATE ACT-30 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences; ARO_category "UPDATED accession with KM087833.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 240 UPDATE vanRF glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanR; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanRF, is a vanR variant found in the vanF gene cluster. UPDATED accession with AF155139.1 UPDATED model_name with vanR gene in vanF cluster UPDATED ARO_name with vanR gene in vanF cluster " 243 UPDATE OXA-9 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with M55547.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 242 UPDATE SHV-152 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX121119.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4628 UPDATE GES-45 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 4629 UPDATE GES-46 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 249 UPDATE basS pmr phosphoethanolamine transferase; peptide antibiotic; antibiotic target alteration; protein(s) and two-component regulatory system modulating antibiotic efflux; antibiotic efflux; ARO_description; model_sequences "UPDATED ARO_description with Histidine protein kinase sensor Lipid A modification gene; part of a two-component system involved in polymyxin resistance that senses high extracellular Fe(2+). UPDATED accession with JQ340365.1 " 248 UPDATE OKP-B-9 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-B-9 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051159.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 2274 UPDATE RlmA(II) antibiotic target alteration; non-erm 23S ribosomal RNA methyltransferase (G748); macrolide antibiotic; lincosamide antibiotic; ARO_category "UPDATED category_aro_description with Non-erm 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides. " 2276 UPDATE Staphylococcus aureus ileS with mutation conferring resistance to mupirocin antibiotic-resistant isoleucyl-tRNA synthetase (ileS); antibiotic target alteration; mupirocin; model_sequences "UPDATED accession with X74219.1 " 2271 UPDATE Staphylococcus aureus mupB conferring resistance to mupirocin antibiotic-resistant isoleucyl-tRNA synthetase (ileS); antibiotic target alteration; mupirocin; model_sequences; model_name "UPDATED accession with JQ231224.1 UPDATED accession with AEY83581.1 UPDATED model_name with Staphylococcus aureus mupB conferring resistance to mupirocin " 2270 UPDATE Staphylococcus aureus mupA conferring resistance to mupirocin antibiotic-resistant isoleucyl-tRNA synthetase (ileS); antibiotic target alteration; mupirocin; model_sequences; model_name "UPDATED accession with X75439.1 UPDATED accession with CAA53189.1 UPDATED model_name with Staphylococcus aureus mupA conferring resistance to mupirocin " 2272 UPDATE Enterococcus faecalis cls with mutation conferring resistance to daptomycin peptide antibiotic; antibiotic target alteration; daptomycin resistant cls; daptomycin; ARO_description; model_name "UPDATED ARO_description with Cardiolipin synthase (cls) is an inner membrane protein involved in membrane synthesis and phosopholipid metabolism, with mutations to the gene being capable of conferring daptomycin resistance. UPDATED model_name with Enterococcus faecalis cls with mutation conferring resistance to daptomycin " 2278 UPDATE Bifidobacterium bifidum ileS conferring resistance to mupirocin antibiotic-resistant isoleucyl-tRNA synthetase (ileS); antibiotic target alteration; mupirocin; model_name "UPDATED model_name with Bifidobacterium bifidum ileS conferring resistance to mupirocin " 708 UPDATE CTX-M-49 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-49 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with AY847145.1 " 2154 UPDATE Borreliella burgdorferi 16S rRNA mutation conferring resistance to spectinomycin antibiotic target alteration; aminoglycoside antibiotic; spectinomycin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description "UPDATED ARO_description with Point mutations in the 3' major domain of the 16S rRNA gene of Borreliella burgdorferi can confer resistance to spectinomycin. " 1248 UPDATE H-NS penam; antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; norfloxacin; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; cephamycin; oxacillin; ciprofloxacin; tetracycline antibiotic; cloxacillin; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1071 UPDATE DHA-22 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED accession with KM087856.1 " 179 UPDATE QnrA5 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrA5 is a plasmid-mediated quinolone resistance protein found in Shewanella algae. UPDATED accession with DQ058663.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 178 UPDATE vanHA vanH; glycopeptide resistance gene cluster; teicoplanin; glycopeptide antibiotic; antibiotic target alteration; vancomycin; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanHA, is a vanH variant in the vanA gene cluster. UPDATED accession with M97297.1 UPDATED model_name with vanH gene in vanA cluster UPDATED ARO_name with vanH gene in vanA cluster " 177 UPDATE IMP-51 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with From Lahey's list of beta-lactamases, no additional information available. UPDATED accession with LC031883.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 176 UPDATE CMY-25 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-25 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with EU515249.1 " 175 UPDATE CTX-M-24 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-24 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with AY143430.1 " 174 UPDATE CfxA2 antibiotic inactivation; cephamycin; CfxA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with CfxA2 beta-lactamase is a class A beta-lactamase found in Prevotella intermedia. UPDATED category_aro_description with CfxA beta-lactamases are class A beta-lactamases. " 173 UPDATE arr-4 antibiotic inactivation; rifampin; rifapentine; rifabutin; rifampin ADP-ribosyltransferase (Arr); rifaximin; rifamycin antibiotic; ARO_description; model_sequences "UPDATED ARO_description with arr-4 is an integron-encoded ribosyltransferase found in Pseudomonas aeruginosa. UPDATED accession with EF660562.1 " 171 UPDATE TEM-78 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF190693.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 170 UPDATE IMP-19 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IMP-19 is a beta-lactamase found in Aeromonas caviae. UPDATED accession with EF118171.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2051 UPDATE dfrA15 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description; model_sequences "UPDATED ARO_description with dfrA15 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae. UPDATED accession with KF534911.1 " 2050 UPDATE OXA-331 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF203105.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2053 UPDATE dfrA7 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description; model_sequences "UPDATED ARO_description with dfrA7 is an integron-encoded dihydrofolate reductase found in Escherichia coli. UPDATED accession with FJ854362.1 " 2052 UPDATE APH(3'')-Ic antibiotic inactivation; APH(3''); streptomycin; aminoglycoside antibiotic; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(3'')-Ic is a chromosomal-encoded aminoglycoside phosphotransferase in Mycolicibacterium fortuitum. UPDATED accession with DQ336355.1 UPDATED category_aro_description with Phosphorylation of streptomycin on the hydroxyl group at position 3''. " 2055 UPDATE LRA-3 penam; antibiotic inactivation; subclass B3 LRA beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with LRA-3 is a beta-lactamase isolated from soil samples in Alaska. UPDATED accession with EU408348.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2054 UPDATE msrC quinupristin; pleuromutilin antibiotic; macrolide antibiotic; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; erythromycin; phenicol antibiotic; lincosamide antibiotic; model_sequences "UPDATED accession with AF313494.1 " 2057 UPDATE SHV-179 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF705208.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4829 UPDATE OXA-489 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2058 UPDATE pp-flo antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; florfenicol; phenicol antibiotic; chloramphenicol; ARO_description; model_sequences "UPDATED ARO_description with pp-flo is a plasmid chloramphenicol exporter that is found in Photobacterium damselae subsp. piscicida. UPDATED accession with D37826.1 " 4824 UPDATE OXA-159 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4823 UPDATE OXA-114x carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4821 UPDATE OXA-114v carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 655 UPDATE OXA-243 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX206446.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4802 UPDATE OXA-114b carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 652 UPDATE tcr3 tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; ARO_description; model_sequences "UPDATED ARO_description with tcr3 is a tetracycline efflux pump that confers self-resistance to Kitasatospora aureofaciens. UPDATED accession with D38215.1 " 4856 UPDATE OXA-521 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 653 UPDATE AAC(3)-VIIa antibiotic inactivation; AAC(3); aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(3)-VIIa is a chromosomal-encoded aminoglycoside acetyltransferase in Streptomyces rimosus. UPDATED accession with M22999.1 " 650 UPDATE aadA antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; ARO_category "UPDATED ARO_description with ANT(3'')-Ia is an aminoglycoside nucleotidyltransferase gene encoded by plasmids, transposons, integrons in Enterobacteriaceae, A. baumannii, P. aeruginosa and Vibrio cholerae. UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 1505 UPDATE SAT-4 streptothricin acetyltransferase (SAT); streptothricin; antibiotic inactivation; nucleoside antibiotic; model_sequences "UPDATED accession with U01945.1 " 670 UPDATE IND-3 carbapenem; antibiotic inactivation; IND beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IND-3 is a beta-lactamase found in Chryseobacterium indologenes. UPDATED partial with 0 UPDATED sequence with ATGAAAAAAAGAATTCAGTTCTTTATGGTTTCAATGATGCTAAGTTCATTATTCAGTGCCCAGGTAAAAGATTTTGTCATCGAACCACCGATTAAAAAGAATTTACATATTTACAAAACTTTTGGTGTATTCGGAGGTAAAGAATATTCTGCCAATTCAGTATATCTTGTTACCCAAAAAGGAGTTGTCTTATTTGACGTCCCGTGGGAAAAGGTACAGTACCAAAGCCTGATGGATACCATCCAAAAACGCCACAATTTACCCGTAATAGCTGTGTTTGCCACTCACTCCCATGATGACCGTGCCGGAGATCTGAGCTTTTTTAACAACAAAGGAATTAAAACCTACGCTACTTCCAAAACCAATGAATTCCTGAAAAAAGACGGAAAAGCAACATCCACAGAGATCATTAAGACCGGAAAGCCATATCGCATAGGAGGTGAGGAATTTGTGGTTGATTTTCTTGGAGAAGGGCATACTGCTGATAATGTAGTGGTATGGTTTCCCAAATACAACGTCCTGGATGGCGGATGCCTTGTAAAAAGTAAAGCTGCAACCGATCTTGGATATATTAAGGAAGCCAATGTAGAGCAATGGCCCAAGACCATCAATAAACTGAAATCCAAATATTCAAAAGCAAGCCTGGTTATTCCCGGACATGATGAATGGAAAGGTGGAGGCCATGTAAAACATACTCTTGAACTTCTTAACAAAAAATAA UPDATED fmax with 720 UPDATED accession with AF219131.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Chryseobacterium indologenes UPDATED NCBI_taxonomy_id with 253 UPDATED NCBI_taxonomy_cvterm_id with 36916 UPDATED accession with AAG29761.2 UPDATED sequence with MKKRIQFFMVSMMLSSLFSAQVKDFVIEPPIKKNLHIYKTFGVFGGKEYSANSVYLVTQKGVVLFDVPWEKVQYQSLMDTIQKRHNLPVIAVFATHSHDDRAGDLSFFNNKGIKTYATSKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSKAATDLGYIKEANVEQWPKTINKLKSKYSKASLVIPGHDEWKGGGHVKHTLELLNKK UPDATED category_aro_description with IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases. " 3526 UPDATE OXA-459 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3527 UPDATE OXA-460 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3524 UPDATE OXA-457 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3525 UPDATE OXA-458 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3522 UPDATE OXA-453 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3523 UPDATE OXA-455 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3520 UPDATE OXA-451 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3521 UPDATE OXA-452 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4916 UPDATE OXA-590 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3528 UPDATE OXA-461 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3529 UPDATE OXA-464 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED NCBI_taxonomy_name with Aliarcobacter butzleri UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4655 UPDATE GOB-42 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3254 UPDATE NDM-11 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4654 UPDATE GOB-41 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 314 UPDATE TEM-176 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with GU550123.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3543 UPDATE OXA-482 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1091 UPDATE IMP-6 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IMP-6 is a beta-lactamase found in Serratia marcescens. UPDATED accession with AB040994.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4657 UPDATE GOB-44 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 945 UPDATE tet(40) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; model_sequences "UPDATED accession with AM419751.1 " 1977 UPDATE AAC(6')-Ik AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; model_sequences "UPDATED accession with L29510.1 " 4656 UPDATE GOB-43 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4651 UPDATE GOB-38 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2695 UPDATE MexCD-OprJ with type B NfxB mutation penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; trimethoprim; aminocoumarin antibiotic; novobiocin; macrolide antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; gentamicin C; chloramphenicol; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; model_description; ARO_category; model_name "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED model_name with MexCD-OprJ with type B NfxB mutation " 2694 UPDATE MexCD-OprJ with type A NfxB mutation penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; trimethoprim; aminocoumarin antibiotic; novobiocin; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; tetracycline; chloramphenicol; model_description; ARO_category; model_name "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED model_name with MexCD-OprJ with type A NfxB mutation " 2693 UPDATE Type B NfxB penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; ofloxacin; trimethoprim; aminocoumarin antibiotic; novobiocin; macrolide antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; gentamicin C; chloramphenicol; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1975 UPDATE blt antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; acriflavine; fluoroquinolone antibiotic; disinfecting agents and antiseptics; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with blt is an MFS efflux pump that confers resistance to multiple drugs such as rhodamine and acridine dyes, and fluoroquinolone antibiotics. UPDATED accession with L32599.1 UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 2691 UPDATE Type A NfxB penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; ofloxacin; trimethoprim; aminocoumarin antibiotic; novobiocin; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; tetracycline; chloramphenicol; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4650 UPDATE GOB-37 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4653 UPDATE GOB-40 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1973 UPDATE TEM-111 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with TEM-111 is a beta-lactamase found in E. coli and P. mirabilis. UPDATED accession with AF468003.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4983 UPDATE OXA-666 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4652 UPDATE GOB-39 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1972 UPDATE OXA-149 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with GQ853680.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3306 UPDATE Escherichia coli ampC1 beta-lactamase penam; antibiotic inactivation; cephalosporin; ampC-type beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1971 UPDATE dfrB2 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description "UPDATED ARO_description with dfrB2 is an integron-encoded dihydrofolate reductase found in an uncultured bacterium from a wastewater treatment plant. " 1970 UPDATE SHV-44 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY259119.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1362 UPDATE IMP-31 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences; ARO_category "UPDATED accession with KF148593.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1968 UPDATE SHV-189 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with KP050494.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1618 UPDATE OXA-362 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF460532.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1619 UPDATE L1 beta-lactamase antibiotic inactivation; cephalosporin; L1 family beta-lactamase; model_sequences "UPDATED accession with AJ272109.1 " 1616 UPDATE CTX-M-152 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with KJ461948.1 " 1617 UPDATE vanE glycopeptide antibiotic; glycopeptide resistance gene cluster; Van ligase; antibiotic target alteration; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VanE is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Ser, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity in Enterococcus faecalis. UPDATED accession with FJ872411.1 UPDATED category_aro_name with Van ligase UPDATED category_aro_description with Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity. " 1614 UPDATE TEM-194 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with JN935136.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1615 UPDATE APH(2'')-IIa antibiotic inactivation; kanamycin A; gentamicin B; aminoglycoside antibiotic; plazomicin; sisomicin; arbekacin; APH(2''); netilmicin; gentamicin C; amikacin; isepamicin; tobramycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(2'')-IIa is a chromosomal-encoded aminoglycoside phosphotransferase in E. faecium and E. coli. UPDATED accession with AF337947.1 UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 2''. " 1960 UPDATE smeB penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; cephamycin; aminoglycoside antibiotic; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with smeB is the inner membrane multidrug exporter of the efflux complex smeABC in Stenotrophomonas maltophilia. UPDATED accession with AF173226.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1613 UPDATE CMY-38 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-38 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with AM931008.1 " 1610 UPDATE OXA-74 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-74 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with AJ854182.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1611 UPDATE SME-4 carbapenem; antibiotic inactivation; SME beta-lactamase; model_sequences "UPDATED accession with KF481967.1 " 2063 UPDATE blaR1 penam; antibiotic inactivation; BlaZ beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Alkalihalobacillus clausii UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with BlaZ beta-lactamase UPDATED category_aro_description with BlaZ beta-lactamases are Class A beta-lactamases. These beta-lactamases are responsible for penicillin resistance in Staphylococcus aureus. " 1363 UPDATE CARB-1 penam; antibiotic inactivation; CARB beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with CARB-1 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with AF313471.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2873 UPDATE catV antibiotic inactivation; phenicol antibiotic; chloramphenicol acetyltransferase (CAT); chloramphenicol; ARO_category "UPDATED category_aro_description with Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini. " 2872 UPDATE PDC-93 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2871 UPDATE PDC-92 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2870 UPDATE PDC-91 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2877 UPDATE OXA-535 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2876 UPDATE OXA-436 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2874 UPDATE ACI-1 penam; antibiotic inactivation; penem; cephalosporin; cefotaxime; ceftazidime; penicillin; ticarcillin; amoxicillin; ACI beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 597 UPDATE Klebsiella pneumoniae ramR mutants penam; antibiotic efflux; triclosan; rifampin; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; antibiotic target alteration; disinfecting agents and antiseptics; tetracycline antibiotic; cephalosporin; cefalotin; tigecycline; glycylcycline; ampicillin; fluoroquinolone antibiotic; rifamycin antibiotic; phenicol antibiotic; tetracycline; chloramphenicol; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 3355 UPDATE catII from Escherichia coli K-12 antibiotic inactivation; phenicol antibiotic; chloramphenicol acetyltransferase (CAT); chloramphenicol; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Escherichia coli str. K-12 UPDATED category_aro_description with Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini. " 3357 UPDATE catA4 antibiotic inactivation; phenicol antibiotic; chloramphenicol acetyltransferase (CAT); chloramphenicol; ARO_category "UPDATED category_aro_description with Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini. " 3356 UPDATE OXA-296 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1117 UPDATE ErmD antibiotic target alteration; virginiamycin S2; vernamycin C; pristinamycin IC; patricin B; patricin A; oleandomycin; ostreogrycin B3; macrolide antibiotic; telithromycin; tylosin; lincosamide antibiotic; dirithromycin; clarithromycin; clindamycin; dalfopristin; pristinamycin IB; quinupristin; pristinamycin IA; Erm 23S ribosomal RNA methyltransferase; virginiamycin M1; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; roxithromycin; spiramycin; azithromycin; erythromycin; model_sequences; ARO_category "UPDATED accession with L08389.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 1745 UPDATE KPC-2 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences; model_name; ARO_category "UPDATED accession with AY034847.1 UPDATED model_name with KPC-2 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3359 UPDATE Mef(En2) efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; macrolide antibiotic; antibiotic efflux; ARO_description "UPDATED ARO_description with NBU2-encoded resistance gene. An MefE homolog in Bacteroides species. Macrolide efflux MFS transporter. " 3358 UPDATE catA8 antibiotic inactivation; phenicol antibiotic; chloramphenicol acetyltransferase (CAT); chloramphenicol; ARO_category "UPDATED category_aro_description with Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini. " 1181 UPDATE cmeA antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; cefotaxime; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; fluoroquinolone antibiotic; fusidic acid; erythromycin; model_sequences "UPDATED accession with CP000768.1 " 1366 UPDATE cmx antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; chloramphenicol; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGCCTTTTGCCCTCTACATGCTTGCCCTGGCGGTCTTCGTCATGGGCACTTCAGAATTCATGCTCGCGGGATTGCTCCCCGCGATCGCGACCGAACTTGACGTCTCGGTCGGCACTGCGGGCCTGCTGACCTCCGCATTCGCAGTCGGTATGGTCGTCGGCGCGCCAGTGATGGCGGCATTCGCTCGCCGTTGGCCACCGCGGCTCACATTGATCGTTTGCCTTCTCGTGTTCGCGGGAAGCCACGTCATCGGAGCGATGACACCAGTGTTCTCTCTCCTGCTCATCACCCGGGTGCTCAGCGCTCTCGCAAACGCAGGATTCCTCGCCGTAGCACTGAGCACGGCCACTACCCTCGTGCCAGCGAACCAGAAGGGGCGTGCACTGTCGATCCTGCTCTCCGGCACGACGATCGCAACCGTCGTGGGCGTCCCCGCCGGGGCACTGCTCGGCACAGCGCTGGGCTGGCGAACGACGTTCTGGGCGATCGCCATCCTCTGTATTCCCGCGGCCGTTGGAGTCATTCGTGGCGTCACGAACAATGTTGGTCGGAGCGAGACTAGCGCGACCTCACCAAGGCTCCGTGTCGAGCTCAGCCAGTTGGCGACGCCGCGGCTCATCCTGGCCATGGCACTCGGAGCGCTGATCAACGGAGGGACCTTTGCGGCATTCACCTTCCTGGCACCCATCGTGACCGAGACCGCGGGCTTGGCCGAAGCGTGGGTGTCCGTCGCGCTGGTGATGTTCGGCATCGGATCGTTCCTTGGCGTCACGATCGCAGGACGACTATCAGATCAACGACCTGGCCTCGTGCTCGCAGTCGGCGGACCGCTATTGCTGACAGGCTGGATCGTGTTGGCAGTGGTCGCATCTCATCCCGTTGCGCTTATCGTCCTCGTCCTCGTTCAGGGATTCCTGTCGTTCGGCGTCGGCAGTACTCTGATCACGCGTGTGCTGTATGCAGCATCGGGTGCGCCAACGATGGGCGGTTCGTACGCAACCGCAGCATTGAATATCGGAGCTGCAGCGGGGCCCGTGCTTGGTGCGCTCGGGCTCGCGACCGGGCTGGGGCTGCTCGCGCCGGTTTGGGTCGCTTCGGTGCTGACAGCGATCGCTCTCGTCATCATGCTTCTCACCAGACGCGCGCTTACGAAGACCGCGGCGGAGGCCAATTGA UPDATED fmax with 37110 UPDATED accession with AF024666.2 UPDATED fmin with 35934 UPDATED strand with + UPDATED NCBI_taxonomy_name with Corynebacterium striatum UPDATED NCBI_taxonomy_id with 43770 UPDATED NCBI_taxonomy_cvterm_id with 39554 UPDATED accession with AAG03380.1 UPDATED sequence with MPFALYMLALAVFVMGTSEFMLAGLLPAIATELDVSVGTAGLLTSAFAVGMVVGAPVMAAFARRWPPRLTLIVCLLVFAGSHVIGAMTPVFSLLLITRVLSALANAGFLAVALSTATTLVPANQKGRALSILLSGTTIATVVGVPAGALLGTALGWRTTFWAIAILCIPAAVGVIRGVTNNVGRSETSATSPRLRVELSQLATPRLILAMALGALINGGTFAAFTFLAPIVTETAGLAEAWVSVALVMFGIGSFLGVTIAGRLSDQRPGLVLAVGGPLLLTGWIVLAVVASHPVALIVLVLVQGFLSFGVGSTLITRVLYAASGAPTMGGSYATAALNIGAAAGPVLGALGLATGLGLLAPVWVASVLTAIALVIMLLTRRALTKTAAEAN " 1768 UPDATE CTX-M-144 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with KJ020573.1 " 1769 UPDATE CTX-M-115 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-115 is a beta-lactamase found in Acinetobacter baumannii. UPDATED accession with KJ911020.1 " 1361 UPDATE OXA-223 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-223 is a beta-lactamase found in A. baumannii. UPDATED accession with JN248564.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1762 UPDATE aadA16 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with aadA16 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in E. coli, V. cholerae and K. pneumoniae. UPDATED partial with 0 UPDATED sequence with ATGAGCAACGCAGTGCCCGCCGAGATTTCGGTACAGCTATCACAGGCACTCAACGTCATCGAGCGTCATCTGGGATCGACGTTGCTGGCCGTGCATTTGTACGGCTCTGCACTCGACGGTGGCCTGAAGCCATGCAGTGATATTGATTTGCTGGTTACTGTGACTGCACAGCTCGATGAGACTGTGCGGCAGGCTCTGTTCGTAGATTTCCTGGAAGTTTCCGCTTCTCCCGGCCAAAGTGAAGCTCTCCGTGCCTTGGAAGTTACCATCGTCGTGTACGGCGATGTTGCTCCTTGGCGTTATCTAGCCAGACGGGAACTGCAATTCGGGGAGTGGCAGCGCAAGGACATTCTTGCGGGCATCTTCGAGCCCGCGACAACCGATGTTGATCTGGCTATTCTGCTAACTAAAGCAAGGCAACACAGCCTTGCCTTGGCAGGTTCGGCCGCGGAAGATTTCTTCAACTCAGTCCCGGAAAGCGATCTATTCAAAGCACTGGCCGACACCTTGAAACTATGGAACTCACAACCGGATTGGGCAGGCGACGAGCGGAATGTAGTGCTTACTTTGTCTCGCATTTGGTACAGCGCAGCAACCGGCAAGATCGCGCCGAAGGATGTAGCTGCCAACTGGGTAATGGAACGCCTGCCCGTCCAACATCAGCCCGTGCTGCTTGAAGCCCAGCAGGCTTACCTTGGACAAGGGATGGATTGCTTGGCCTCACGCGCTGATCAGTTGACTGCGTTCATTTACTTTGTGAAGCACGAAGCCGCCAGTCTGCTCGGCTCCACGCCAATGATGTCTAACAGTTCATTCAAGCCGACGCCGCTTCGCGGCGCAGCTTAA UPDATED fmax with 4042 UPDATED accession with EU675686.2 UPDATED fmin with 3196 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with ACF17980.1 UPDATED sequence with MSNAVPAEISVQLSQALNVIERHLGSTLLAVHLYGSALDGGLKPCSDIDLLVTVTAQLDETVRQALFVDFLEVSASPGQSEALRALEVTIVVYGDVAPWRYLARRELQFGEWQRKDILAGIFEPATTDVDLAILLTKARQHSLALAGSAAEDFFNSVPESDLFKALADTLKLWNSQPDWAGDERNVVLTLSRIWYSAATGKIAPKDVAANWVMERLPVQHQPVLLEAQQAYLGQGMDCLASRADQLTAFIYFVKHEAASLLGSTPMMSNSSFKPTPLRGAA UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 1763 UPDATE NDM-2 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; model_sequences; ARO_category "UPDATED accession with JF703135.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1760 UPDATE QnrB35 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB35 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii. UPDATED accession with JN173057.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1761 UPDATE OXA-351 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF297580.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1766 UPDATE VIM-14 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-14 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with AY635904.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1767 UPDATE OKP-A-16 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-A-16 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with FJ755840.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 1764 UPDATE OXA-97 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with OXA-97 is a beta-lactamase found in A. baumannii. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1765 UPDATE OXA-56 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-56 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with AY445080.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1142 UPDATE dfrA17 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description; model_sequences "UPDATED ARO_description with dfrA17 is an integron-encoded dihydrofolate reductase found in Escherichia coli. UPDATED accession with DQ838665.1 " 1143 UPDATE OXA-7 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with X75562.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1140 UPDATE CMY-86 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with KJ207204.1 " 1141 UPDATE OXA-169 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HM488990.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1146 UPDATE TEM-156 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AM941159.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1147 UPDATE CMY-63 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with HQ650104.1 " 1144 UPDATE vgbB virginiamycin S2; pristinamycin IB; quinupristin; pristinamycin IC; patricin B; patricin A; ostreogrycin B3; vernamycin C; pristinamycin IA; antibiotic inactivation; streptogramin antibiotic; streptogramin vgb lyase; model_sequences; model_name; ARO_category "UPDATED accession with AF015628.1 UPDATED model_name with vgbB UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 1145 UPDATE CTX-M-124 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-124 is a beta-lactamase found in Escherichia coli. UPDATED accession with JQ429324.1 " 1148 UPDATE OXA-363 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF460533.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1149 UPDATE AER-1 AER beta-lactamase; penam; antibiotic inactivation; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with AER-1 is a beta-lactamase found in Aeromonas hydrophila. UPDATED accession with U14748.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 769 UPDATE KPC-11 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with KPC-11 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with HM066995.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 692 UPDATE TEM-159 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with EF136376.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 693 UPDATE OXA-22 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-22 is a beta-lactamase found in Ralstonia pickettii. UPDATED partial with 0 UPDATED sequence with ATGAAACGCCGCCACGCCGCCATCGGCGCCCTGCTTGCCGCGCTTGCCACCTTTGCCCACGCCGAGCACCCGATCTGCACGATCGTGGCCGATGCCGCCACGGGCAAGGCCGTCTTGCATGAAGGCAAGTGCGACGAGCGCGTGACGCCCGCTTCCACCTTCAAGCTGGCGCTGGCCGTCATGGGCTTCGACCACGGCTTCCTCAAAGATGAGCACACCCCGGTTGAGCACTTCAGGCACGGTGACCCCGACTGGGGCGGCGAAGCCTGGCACCAGCCGATCGACCCGGCGCTGTGGCTCAAGTATTCGGTGGTCTGGTATTCGCAGCGCATTACGCATGCGATGGGCGCGCAGACCTTCCAGGCCTACGTGCGCAAGCTTGGCTACGGCAACATGGATGTGAGCGGCGATCCGGGCAAGAACAACGGCATGGACCGCTCGTGGATCACCTCGTCGCTGAAGATTTCGCCGGAAGAGCAAGTCGGCTTGATGCGCCGGATCGTCAACCGGCAGTTGCCGGTGTCGGCGCACACCTACGAGATGCTCGACCGTACCGTGCAGACCTGGCAGGTGCCCGGCGGCTGGGCGGTGCAGGGCAAGACGGGCACTGCCGGTCCGGCGCCGGGCAACACGTCGCCCGATGGCACGTGGGATCAGGCACACGCTTACGGCTGGTTTGTCGGCTGGGCCAGGAAGGGCGACAAGACCTACGTATTCGCCAACCTGATCCAGGACGACAAGGTTGAGCCGACGTCGGGCGGTATCCGCTCGCGCGATGCGCTGTTTGCTCGCCTGTCGGAAGTGCTGGCCTTTGCTGGGCACTGA UPDATED fmax with 1776 UPDATED accession with AF064820.3 UPDATED fmin with 951 UPDATED strand with + UPDATED NCBI_taxonomy_name with Ralstonia pickettii UPDATED NCBI_taxonomy_id with 329 UPDATED NCBI_taxonomy_cvterm_id with 36921 UPDATED accession with AAD12233.1 UPDATED sequence with MKRRHAAIGALLAALATFAHAEHPICTIVADAATGKAVLHEGKCDERVTPASTFKLALAVMGFDHGFLKDEHTPVEHFRHGDPDWGGEAWHQPIDPALWLKYSVVWYSQRITHAMGAQTFQAYVRKLGYGNMDVSGDPGKNNGMDRSWITSSLKISPEEQVGLMRRIVNRQLPVSAHTYEMLDRTVQTWQVPGGWAVQGKTGTAGPAPGNTSPDGTWDQAHAYGWFVGWARKGDKTYVFANLIQDDKVEPTSGGIRSRDALFARLSEVLAFAGH UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1544 UPDATE dfrE trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description "UPDATED ARO_description with dfrE is a chromosome-encoded dihydrofolate reductase found in Enterococcus faecalis. " 691 UPDATE vanRE glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanR; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanRE, is a vanR variant found in the vanE gene cluster. UPDATED accession with FJ872411.1 UPDATED model_name with vanR gene in vanE cluster UPDATED ARO_name with vanR gene in vanE cluster " 696 UPDATE cfrA dalfopristin; thiamphenicol; oxazolidinone antibiotic; virginiamycin M1; pleuromutilin antibiotic; tiamulin; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; antibiotic target alteration; lincosamide antibiotic; azidamfenicol; clindamycin; phenicol antibiotic; Cfr 23S ribosomal RNA methyltransferase; chloramphenicol; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with CfrA is a chloramphenicol-florfenicol resistance gene and methyltransferase enzyme. Methylation of position 8 of A2503 in 23S rRNA confers resistance to chloramphenicol antibiotics first identified by Schwarz 2000 as cfr from Mammaliicoccus sciuri. Additional Oxazolidinone resistance mediated by the cfr gene in a human isolated was first reported from Colombia in linezolid- and methicillin-resistant Staphylococcus aureus. UPDATED accession with AM408573.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 697 UPDATE Erm(42) antibiotic target alteration; streptogramin antibiotic; Erm 23S ribosomal RNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; ARO_description; model_sequences "UPDATED ARO_description with Erm42 confers MLSb phenotype in Pasteurella multocida. UPDATED accession with FR734406.1 " 694 UPDATE CTX-M-40 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description "UPDATED ARO_description with CTX-M-40 is a beta-lactamase found in Escherichia coli. " 695 UPDATE CMY-66 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with JN714478.1 " 698 UPDATE TEM-205 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with KC900516.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 699 UPDATE QnrS9 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrS9 is a plasmid-mediated quinolone resistance protein found in Klebsiella pneumoniae. UPDATED accession with KF732714.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1548 UPDATE APH(3')-Vb antibiotic inactivation; aminoglycoside antibiotic; paromomycin; APH(3'); ribostamycin; G418; neomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(3')-Vb is a chromosomal-encoded aminoglycoside phosphotransferase in Streptomyces ribosidificus. UPDATED accession with M22126.1 UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'. " 1549 UPDATE ErmB antibiotic target alteration; virginiamycin S2; vernamycin C; pristinamycin IC; patricin B; patricin A; oleandomycin; ostreogrycin B3; macrolide antibiotic; telithromycin; tylosin; lincosamide antibiotic; dirithromycin; clarithromycin; clindamycin; dalfopristin; pristinamycin IB; quinupristin; pristinamycin IA; Erm 23S ribosomal RNA methyltransferase; virginiamycin M1; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; roxithromycin; spiramycin; azithromycin; erythromycin; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGAACAAAAATATAAAATATTCTCAAAACTTTTTAACGAGTGAAAAAGTACTCAACCAAATAATAAAACAATTGAATTTAAAAGAAACCGATACCGTTTACGAAATTGGAACAGGTAAAGGGCATTTAACGACGAAACTGGCTAAAATAAGTAAACAGGTAACGTCTATTGAATTAGACAGTCATCTATTCAACTTATCGTCAGAAAAATTAAAACTGAATACTCGTGTCACTTTAATTCACCAAGATATTCTACAGTTTCAATTCCCTAACAAACAGAGGTATAAAATTGTTGGGAGTATTCCTTACAATTTAAGCACACAAATTATTAAAAAAGTGGTTTTTGAAAGCCGTGCGTCTGACATCTATCTGATTGTTGAAGAAGGATTCTACAAGCGTACCTTGGATATTCACCGAACACTAGGGTTGCTCTTGCACACTCAAGTCTCGATTCAGCAATTGCTTAAGCTGCCAGCGGAATGCTTTCATCCTAAACCAAAAGTAAACAGTGTCTTAATAAAACTTACCCGCCATACCACAGATGTTCCAGATAAATATTGGAAGCTATATACGTACTTTGTTTCAAAATGGGTCAATCGAGAATATCGTCAACTGTTTACTAAAAATCAGTTTCATCAAGCAATGAAACACGCCAAAGTAAACAATTTAAGTACCATTACTTATGAGCAAGTATTGTCTATTTTTAATAGTTATCTATTATTTAACGGGAGGAAATTAATTCTATGA UPDATED fmax with 2878 UPDATED accession with AF242872.1 UPDATED fmin with 2131 UPDATED strand with + UPDATED NCBI_taxonomy_name with Enterococcus faecium UPDATED NCBI_taxonomy_id with 1352 UPDATED NCBI_taxonomy_cvterm_id with 36779 UPDATED accession with AAF86219.1 UPDATED sequence with MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGSIPYNLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLLFNGRKLIL UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 543 UPDATE TEM-106 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY101578.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 540 UPDATE emrY tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; model_sequences "UPDATED accession with D78168.1 " 541 UPDATE TEM-133 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY528425.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 546 UPDATE TLA-1 antibiotic inactivation; monobactam; fluoroquinolone antibiotic; cephalosporin; TLA beta-lactamase; model_sequences "UPDATED accession with AF148067.1 " 547 UPDATE arr-5 antibiotic inactivation; rifampin; rifapentine; rifabutin; rifampin ADP-ribosyltransferase (Arr); rifaximin; rifamycin antibiotic; ARO_description; model_sequences "UPDATED ARO_description with arr-5 is an integron-encoded ribosyltransferase found in Pseudomonas aeruginosa. UPDATED accession with EF660563.1 " 544 UPDATE AAC(6')-Is AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Is is a chromosomal-encoded aminoglycoside acetyltransferase in Acinetobacter variabilis. UPDATED accession with AF031327.1 " 545 UPDATE GES-22 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX023441.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 548 UPDATE QnrB3 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB3 is a plasmid-mediated quinolone resistance protein found in Escherichia coli. UPDATED accession with DQ303920.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 549 UPDATE TEM-107 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY101764.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 760 UPDATE TEM-6 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with X57972.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 761 UPDATE GES-13 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with GES-13 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with GU169702.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 766 UPDATE SHV-102 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with EU024485.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2064 UPDATE TEM-196 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with JQ034306.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 767 UPDATE OXA-207 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with JQ838185.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 764 UPDATE FOX-2 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with FOX-2 is a beta-lactamase found in Escherichia coli. UPDATED accession with Y10282.1 UPDATED category_aro_description with FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins. " 765 UPDATE QnrB7 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB7 is a plasmid-mediated quinolone resistance protein found in Enterobacter cloacae. UPDATED partial with 0 UPDATED sequence with ATGGCTCTGGCACTCGTTGGCGAAAAAATTGACAGAAACCGTTTCACCGGTGAGAAAATTGAAAATAGTACATTTTTTAACTGTGATTTTTCAGGTGCCGACCTAAGTGGTACTGAATTTATCGGCTGTCAGTTCTATGATCGTGAAAGCCAGAAAGGGTGCAATTTTAGTCGTGCAATGCTGAAAGATGCCATTTTTAAAAGCTGTGATTTATCCATGGCGGATTTTCGCAATGCCAGTGCGCTGGGCATTGAAATTCGCCACTGCCGCGCACAAGGCGCAGATTTCCGCGGCGCAAGCTTTATGAATATGATCACTACACGCACCTGGTTTTGCAGCGCATATATCACTAACACAAATCTAAGCTACGCCAATTTTTCGAAAGTCGTGCTGGAAAAGTGTGAGCTGTGGGAAAACCGTTGGATGGGTGCCCAGGTACTGGGCGCGACGTTCAGTGGTTCAGATCTCTCCGGCGGCGAGTTTACGACTTTCGACTGGCGAGCAGCAAACTTCACACATTGCGATCTGACCAATTCGGAGTTGGGTGACTTAGATATTCGGGGCGTTGATTTACAAGGCGTTAAGTTGGACAACTACCAGGCATCGTTGCTCATGGAACGTCTTGGCATCGCGATTATTGGCTAG UPDATED fmax with 645 UPDATED accession with EU043311.3 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Enterobacter cloacae UPDATED NCBI_taxonomy_id with 550 UPDATED NCBI_taxonomy_cvterm_id with 36884 UPDATED accession with ABW03156.3 UPDATED sequence with MALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNASALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGAQVLGATFSGSDLSGGEFTTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAIIG UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 5137 UPDATE OXA-836 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5618 UPDATE PER-15 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5619 UPDATE PER-16 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 17 UPDATE tet(45) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; ARO_description "UPDATED ARO_description with Tet45 is a tetracycline efflux pump found in Bhargavaea cecembensis strain previously isolated from a poultry-litter-impacted soil. " 5613 UPDATE PER-10 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5616 UPDATE PER-13 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5617 UPDATE PER-14 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5614 UPDATE PER-11 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5615 UPDATE PER-12 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; PER beta-lactamase; monobactam; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 414 UPDATE OXA-377 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF986258.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 415 UPDATE TEM-33 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with GU371926.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 416 UPDATE OXA-204 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-204 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with JQ809466.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 417 UPDATE QnrB6 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB6 is a plasmid-mediated quinolone resistance protein found in Pantoea agglomerans. UPDATED accession with EF520349.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1388 UPDATE oleB oleandomycin; pleuromutilin antibiotic; macrolide antibiotic; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; phenicol antibiotic; lincosamide antibiotic; ARO_description; model_sequences "UPDATED ARO_description with oleB is an ABC-F subfamily protein in Streptomyces antibioticus and is involved in oleandomycin secretion. UPDATED accession with L36601.1 " 411 UPDATE QnrB11 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB11 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii. UPDATED accession with EF653270.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 412 UPDATE OXA-117 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 413 UPDATE OXA-144 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-144 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with FJ872530.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1384 UPDATE OXA-382 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KJ135345.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1385 UPDATE mdsB penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; penem; carbapenem; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; cephamycin; monobactam; phenicol antibiotic; chloramphenicol; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1386 UPDATE ANT(9)-Ia antibiotic inactivation; aminoglycoside antibiotic; spectinomycin; ANT(9); ARO_description; ARO_category "UPDATED ARO_description with ANT(9)-Ia is an aminoglycoside nucleotidyltransferase encoded by plasmids and transposons in S. aureus, Enterococcus spp., Mammaliicoccus sciuri, and E. faecalis. UPDATED category_aro_description with Nucleotidylylation of spectinomycin at the hydroxyl group at position 9. " 1387 UPDATE OXA-99 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-99 is a beta-lactamase found in A. baumannii. UPDATED accession with DQ888718.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1380 UPDATE TEM-193 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with JN935135.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 419 UPDATE SLB-1 penam; antibiotic inactivation; cephalosporin; SHW beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY590118.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1382 UPDATE rmtG antibiotic target alteration; aminoglycoside antibiotic; 16S rRNA methyltransferase (G1405); model_sequences "UPDATED accession with JX486113.1 " 1383 UPDATE IMI-4 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED accession with KF958750.1 " 3827 UPDATE OXA-898 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3826 UPDATE OXA-899 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3327 UPDATE AAC(2')-IIa antibiotic inactivation; aminoglycoside antibiotic; AAC(2'); kasugamycin; ARO_description "UPDATED ARO_description with AAC(2')-IIa is a kasugamycin 2' N-acetyltransferase protein found in Burkholderia glumae and Acidovorax avenae isolates. " 2769 UPDATE MdtNOP antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; puromycin; acriflavine; nucleoside antibiotic; disinfecting agents and antiseptics; ARO_description; model_description; ARO_category "UPDATED ARO_description with MdtNOP is a MFS efflux pump protein found in E. coli. The deletion of mdtP from strain W3110 resulted in increased susceptibility to acriflavin, puromycin, and tetraphenylarsonium chloride. An E. coli mdtN null mutant is more sensitive to sulfur drugs than wild type. UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 3829 UPDATE mecC-type BlaZ penam; antibiotic inactivation; BlaZ beta-lactamase; penicillin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with A blaZ-like beta-lactamase found in S. Aureus. UPDATED partial with 0 UPDATED sequence with TTGAAAAAATTAATAATTTTAGTCGTGTTAGCGTTGATATTAAGTGCTTGTAATAGTAAGAATTCAACTAATAACGACATTGAAAAGATCGAAAAAAAATATGGTGCTAACGTAGGTATGTATGCTCTTAATACTCAAAATGGTAAAGAATTATCATTTAATGAAAATAAGCGTTTTGCATATGCTTCCACATTAAAAACTATAAGTAGCGCAATGCTGCTTGAACAAACACCTTACAACAAATTAGATAAAAAAATTCACATTAATAAAGATGATATTGTTCCATATTCACCAGTGTTAGAAAAATATATTGGCAAAGAGATAACTTTAAAAAAGCTTATAGAAGCTACCATGTTATTTAGCGATAACACGGCTAATAATAAAATTATCGATGAATTGGGAGGATATGGGCAAGTAAAAACGAAACTGATAGATTTAGGCGATACAACGACACATCCATCTAGAAAAGAACCAGACTTAAATTTTTATTCACCAAAGGATAAACGAGATACAAGTACTCCATTAGCCTATGGTAAAACTTTAAAGAAACTTATAGCTGATGGAGATCTTAGCAAAGCAAACAAAGATTTCTTACTTAATCTAATGTTCAAAAATAAAAGTGGCGATACATTAATTAAGGATGGTGCACCTTCAAACTTTAAAGTTATGGATAAGAGCGGTCAAGCACTAACATACGGTTCAAGAAACGATGTTGCGTTTGTTTATCCAGATGGACAAGATAAACCTATAATTCTGGTGATATTTACAAATAAAGATAGAAAAGATGGTAAACCTAATGACAAAATAGTAAGTGAGGTTGCTGAAATTGTACTAAAAAATATTAATGAGTAA UPDATED fmax with 1647 UPDATED accession with FR823292.1 UPDATED fmin with 795 UPDATED strand with - UPDATED NCBI_taxonomy_name with Staphylococcus aureus UPDATED NCBI_taxonomy_id with 1280 UPDATED NCBI_taxonomy_cvterm_id with 35508 UPDATED accession with CBZ41939.1 UPDATED sequence with MKKLIILVVLALILSACNSKNSTNNDIEKIEKKYGANVGMYALNTQNGKELSFNENKRFAYASTLKTISSAMLLEQTPYNKLDKKIHINKDDIVPYSPVLEKYIGKEITLKKLIEATMLFSDNTANNKIIDELGGYGQVKTKLIDLGDTTTHPSRKEPDLNFYSPKDKRDTSTPLAYGKTLKKLIADGDLSKANKDFLLNLMFKNKSGDTLIKDGAPSNFKVMDKSGQALTYGSRNDVAFVYPDGQDKPIILVIFTNKDRKDGKPNDKIVSEVAEIVLKNINE UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with BlaZ beta-lactamase UPDATED category_aro_description with BlaZ beta-lactamases are Class A beta-lactamases. These beta-lactamases are responsible for penicillin resistance in Staphylococcus aureus. " 3583 UPDATE FAR-1 penam; antibiotic inactivation; FAR beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3584 UPDATE FIM-1 carbapenem; antibiotic inactivation; cephalosporin; FIM beta-lactamase; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGCGCCCCTTACCCCATTCATACCTAAAGAGTCTTGTCATTTGCCTGCTGACGGCCTTCGCCGCCTTAACACCCGTCGTGAACTCTGGCGTACAAGCGGCTCAACCCAAAGACGTGCCGGTAACGTTTACCGCTATTACGCAGGGGGTGTGGATGCACACCAGCATGAAGCACATGGAAAACTGGGGGCATGTACCCAGTAACGGGCTAATCGTTGAAAAAGGAGACTTTAGTATTTTGGTGGATACGGCTTGGGACGATCCACAAACGGCACAGATTATTGAGTGGTCCAAAGATACGCTAAAAAAACCCATTCGTTGGGCGGTGTTTACCCATGCCCACGACGACAAAATGGGCGGGGTGGCTGCCTTACGACAGCAGGGCATTGTGACCTATGCGGCGGCCGACTCTAATCGAATGGCCCCACAGAATGGCTTAACCCCTGCAGAGCATGACCTCATCTTTGATAGCGAGCACAGCACAAGCGTTCTGCATCCGCTGGTCATTTTCGATCCCGGCCCAGGGCATACCCGCGACAATATTGTGGTGGGCCTGCCCGAGCAAGGGATTGTTTTTGGAGGCTGTCTCATTCGCCCATCGGGCAGCACGTCTCTGGGAAACACCGCTGACGCCGATCTCGCTCACTGGAAAACAGCGGTATTGGCCGTTGCGCAGCGCTTTGCGGAGGCCCAACAGATTATACCCAGCCACGGACCCATGGCCGGACGAGAGCTTTTTGAACTGACGGCTCAGCTGGCAGAAAAGGCCAGCATACCGTCCACACCCTGA UPDATED fmax with 2725 UPDATED accession with JX570731.1 UPDATED fmin with 1936 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AFV91534.1 UPDATED sequence with MRPLPHSYLKSLVICLLTAFAALTPVVNSGVQAAQPKDVPVTFTAITQGVWMHTSMKHMENWGHVPSNGLIVEKGDFSILVDTAWDDPQTAQIIEWSKDTLKKPIRWAVFTHAHDDKMGGVAALRQQGIVTYAAADSNRMAPQNGLTPAEHDLIFDSEHSTSVLHPLVIFDPGPGHTRDNIVVGLPEQGIVFGGCLIRPSGSTSLGNTADADLAHWKTAVLAVAQRFAEAQQIIPSHGPMAGRELFELTAQLAEKASIPSTP " 5006 UPDATE OXA-694 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3588 UPDATE FONA-4 penam; antibiotic inactivation; FONA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 368 UPDATE CARB-14 penam; antibiotic inactivation; CARB beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with CARB-14 is a beta-lactamase found in Acinetobacter baumannii. UPDATED accession with JQ364968.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 369 UPDATE SHV-15 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAATGCTGGCGCGGGTGGATGCCGGTGACAAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTAGCAAGCGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 861 UPDATED accession with AJ011428.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with CAB37325.2 UPDATED sequence with MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAMLARVDAGDKQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 366 UPDATE Mycobacterium tuberculosis iniA mutant conferring resistance to Ethambutol antibiotic efflux; polyamine antibiotic; Ethambutol resistant iniA; efflux pump complex or subunit conferring antibiotic resistance; ethambutol; antibiotic target alteration; ARO_description; ARO_name; model_sequences; model_name; ARO_category "UPDATED ARO_description with Specific mutations in Mycobacterium tuberculosis iniA resulting in resistance to ethambutol. UPDATED ARO_name with Mycobacterium tuberculosis iniA mutant conferring resistance to ethambutol UPDATED accession with AL123456.1 UPDATED model_name with Mycobacterium tuberculosis iniA mutant conferring resistance to ethambutol UPDATED category_aro_description with Mutations that occurs on the iniA genes resulting in the resistance to ethambutol. " 367 UPDATE CTX-M-25 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-25 is a beta-lactamase found in Escherichia coli. UPDATED partial with 0 UPDATED sequence with ATGATGAGAAAAAGCGTAAGGCGGGCGATGTTAATGACGACAGCCTGTGTTTCGCTGCTGTTGGCCAGTGTGCCGCTGTGTGCCCAGGCGAACGATGTTCAACAAAAGCTCGCGGCGCTGGAGAAAAGCAGCGGGGGACGACTGGGTGTGGCGTTGATTAACACCGCCGATAACACGCAGACGCTCTACCGCGCCGACGAGCGTTTTGCCATGTGCAGCACCAGTAAAGTGATGGCGGTAGCGGCGGTGCTTAAGCAAAGTGAAACGCAAAAGGGCTTGTTGAGTCAGCGGGTTGAAATTAAGCCCTCAGACTTGATTAACTACAACCCCATTGCGGAAAAACACGTCAATGGCACGATGACATTCGGGGAGTTGAGCGCGGCGGCGCTACAGTACAGCGATAATACTGCCATGAATAAGCTGATTGCCCATCTCGGGGGGCCGGATAAAGTGACGGCATTTGCCCGTACGATTGGCGATGACACGTTCCGGCTCGATCGTACCGAGCCGACGCTCAACACCGCGATCCCCGGCGACCCGCGCGATACCACCACGCCGTTAGCGATGGCGCAGGCTCTGCGCAATCTGACGTTGGGCAATGCCCTGGGTGACACTCAGCGTGCGCAGCTGGTGATGTGGCTGAAAGGCAACACCACCGGCGCTGCCAGCATTCAGGCAGGGCTACCCACATCGTGGGTTGTCGGGGATAAAACCGGCAGCGGCGGTTATGGTACGACGAATGATATCGCGGTTATTTGGCCGGAAGGTCGCGCGCCGCTCGTTCTGGTGACTTACTTCACCCAGTCGGAGCCGAAGGCAGAGAGCCGTCGTGACGTGCTCGCTGCTGCCGCCAGAATTGTCACCGACGGTTATTAA UPDATED fmax with 3196 UPDATED accession with AF518567.2 UPDATED fmin with 2320 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with AAM70498.1 UPDATED sequence with MMRKSVRRAMLMTTACVSLLLASVPLCAQANDVQQKLAALEKSSGGRLGVALINTADNTQTLYRADERFAMCSTSKVMAVAAVLKQSETQKGLLSQRVEIKPSDLINYNPIAEKHVNGTMTFGELSAAALQYSDNTAMNKLIAHLGGPDKVTAFARTIGDDTFRLDRTEPTLNTAIPGDPRDTTTPLAMAQALRNLTLGNALGDTQRAQLVMWLKGNTTGAASIQAGLPTSWVVGDKTGSGGYGTTNDIAVIWPEGRAPLVLVTYFTQSEPKAESRRDVLAAAARIVTDGY " 364 UPDATE CMY-83 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with JX440351.1 " 365 UPDATE TEM-122 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY307100.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 362 UPDATE CTX-M-151 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with AB916359.1 " 363 UPDATE TEM-155 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with DQ679961.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 360 UPDATE AAC(6')-Iy AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; model_sequences "UPDATED accession with AF144880.1 " 361 UPDATE OXA-278 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-278 is a beta-lactamase found in A. baumannii. UPDATED accession with KC771279.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5008 UPDATE OXA-696 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1431 UPDATE GES-15 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences; ARO_category "UPDATED accession with GU208678.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 380 UPDATE CTX-M-147 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with KF513180.1 " 381 UPDATE QnrS1 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; ARO_category "UPDATED ARO_description with QnrS1 is a plasmid-mediated quinolone resistance protein found in Shigella flexneri. UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 382 UPDATE QnrB61 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB61 is a plasmid-mediated quinolone resistance protein found in Citrobacter braakii. UPDATED accession with AB734053.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 383 UPDATE Pseudomonas mutant PhoQ conferring resistance to colistin antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; colistin B; protein(s) and two-component regulatory system modulating antibiotic efflux; pmr phosphoethanolamine transferase; colistin A; macrolide antibiotic; peptide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; antibiotic target alteration; erythromycin; ARO_description "UPDATED ARO_description with Mutations in Pseudomonas aeruginosa PhoQ of the two-component PhoPQ regulatory system. Presence of mutation confers resistance to colistin. " 384 UPDATE APH(2'')-IVa antibiotic inactivation; kanamycin A; gentamicin B; aminoglycoside antibiotic; sisomicin; arbekacin; APH(2''); netilmicin; gentamicin C; amikacin; isepamicin; tobramycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(2'')-IVa is a chromosomal-encoded aminoglycoside phosphotransferase in E. casseliflavus. UPDATED accession with AF016483.1 UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 2''. " 385 UPDATE OXA-46 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-46 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with JX131372.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 386 UPDATE LEN-8 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_description; ARO_category "UPDATED ARO_description with LEN-8 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 387 UPDATE mdtA efflux pump complex or subunit conferring antibiotic resistance; antibiotic efflux; aminocoumarin antibiotic; resistance-nodulation-cell division (RND) antibiotic efflux pump; novobiocin; model_sequences "UPDATED accession with U00096.1 " 388 UPDATE QnrB71 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB71 is a plasmid-mediated quinolone resistance protein found in Citrobacter braakii. UPDATED accession with KC580660.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 4758 UPDATE LUT-5 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 4759 UPDATE LUT-6 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 2065 UPDATE CMY-5 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description "UPDATED ARO_description with CMY-5 is a beta-lactamase found in Klebsiella oxytoca. " 1369 UPDATE QnrB69 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB69 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii. UPDATED accession with KC580658.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 4753 UPDATE LUS-1 LUS beta-lactamase; carbapenem; cephalosporin; antibiotic inactivation; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 4755 UPDATE LUT-2 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 4757 UPDATE LUT-4 antibiotic inactivation; LUT beta-lactamase; cephalosporin; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 1076 UPDATE IMP-37 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences; ARO_category "UPDATED accession with JX131372.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1077 UPDATE OXA-420 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with AB983359.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1074 UPDATE LEN-3 penam; LEN beta-lactamase; antibiotic inactivation; penem; model_sequences; ARO_category "UPDATED accession with AY130286.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 797 UPDATE TEM-55 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with DQ286729.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3759 UPDATE APH(3')-VIb antibiotic inactivation; aminoglycoside antibiotic; isepamicin; paromomycin; kanamycin A; APH(3'); gentamicin B; amikacin; ribostamycin; G418; neomycin; butirosin; ARO_description; ARO_category "UPDATED ARO_description with APH(3')-VIb is a plasmid-encoded aminoglycoside phosphotransferase in K. pneumoniae and S. marcescens. UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'. " 1075 UPDATE TEM-20 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with Y17581.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3751 UPDATE TEM-181 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3750 UPDATE tet(57) tetracycline antibiotic; tetracycline-resistant ribosomal protection protein; antibiotic target protection; ARO_description "UPDATED ARO_description with A tetracycline efflux MFS Transporter from Providencia sp. Y14. " 3753 UPDATE TxR antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; tetracycline; model_name "UPDATED model_name with TxR " 3755 UPDATE qacEdelta1 efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 3754 UPDATE qacE efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; disinfecting agents and antiseptics; antibiotic efflux; ARO_category "UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 3757 UPDATE IDC-2 carbapenem; antibiotic inactivation; cephalosporin; IDC beta-lactamase; ARO_description "UPDATED ARO_description with IDC-2 is an IDC beta-lactamase and an integron cephalosprinase. " 3756 UPDATE IDC-1 carbapenem; antibiotic inactivation; cephalosporin; IDC beta-lactamase; ARO_description "UPDATED ARO_description with IDC-2 is an IDC beta-lactamase and an integron cephalosprinase. " 4633 UPDATE GOB-20 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2191 UPDATE AAC(6')-Iaj AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Iaj is a functional acetyltransferase that modifies the amino groups at the 6' positions of aminoglycosides and contributes to aminoglycoside resistance of P. aeruginosa. UPDATED accession with AB709942.1 " 258 UPDATE OXA-208 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with FR853176.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2193 UPDATE TriB efflux pump complex or subunit conferring antibiotic resistance; triclosan; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; ARO_category "UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 2194 UPDATE TriC efflux pump complex or subunit conferring antibiotic resistance; triclosan; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; ARO_category "UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 2195 UPDATE OpmH efflux pump complex or subunit conferring antibiotic resistance; triclosan; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; ARO_category "UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 4634 UPDATE GOB-21 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 253 UPDATE vanXYG glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanXY; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanXYG, is a vanXY variant found in the vanG gene cluster. UPDATED accession with DQ212986.1 UPDATED model_name with vanXY gene in vanG cluster UPDATED ARO_name with vanXY gene in vanG cluster " 250 UPDATE Rhodococcus fascians cmr antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; chloramphenicol; ARO_description; model_sequences "UPDATED ARO_description with cmr is a plasmid-encoded chloramphenicol exporter that is found in Rhodococcus fascians and Corynebacterium glutamicum. UPDATED accession with Z12001.1 " 251 UPDATE APH(3')-VIIa antibiotic inactivation; kanamycin A; APH(3'); aminoglycoside antibiotic; G418; neomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(3')-VIIa is a plasmid-encoded aminoglycoside phosphotransferase in C. jejuni. UPDATED accession with M29953.1 UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'. " 256 UPDATE CMY-21 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-21 is a beta-lactamase found in Escherichia coli. UPDATED accession with DQ139328.1 " 257 UPDATE ACT-37 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences; ARO_category "UPDATED accession with KM926622.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 254 UPDATE OXA-150 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with GQ853681.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 255 UPDATE BRP(MBL) antibiotic inactivation; bleomycin B2; bleomycinic acid; bleomycin A2; Bleomycin resistant protein; glycopeptide antibiotic; model_name "UPDATED model_name with BRP(MBL) " 2200 UPDATE APH(3')-VI antibiotic inactivation; aminoglycoside antibiotic; isepamicin; paromomycin; kanamycin A; APH(3'); gentamicin B; amikacin; ribostamycin; G418; neomycin; butirosin; ARO_category "UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'. " 2201 UPDATE PvrR phenotypic variant regulator; resistance by absence; aminoglycoside antibiotic; ARO_description; ARO_category "UPDATED ARO_description with PvrR is a response regulator that controls the conversion between antibiotic-resistant and antibiotic-susceptible forms of Pseudomonas aeruginosa biofilms through porin deletion/gene absence. UPDATED category_aro_description with Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin). " 2202 UPDATE AAC(3)-Ib/AAC(6')-Ib'' antibiotic inactivation; AAC(3); AAC(6'); kanamycin A; gentamicin C; aminoglycoside antibiotic; tobramycin; ARO_description; model_param "UPDATED ARO_description with AAC(3)-Ib/AAC(6')-Ib'' is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa. UPDATED param_description with A parameter to describe the genes in a fusion protein. The parameter is defined by Cvterm IDs, separated by commas, with the ordering number preceding a colon. If the ordering of one or more parameters is unknown, it is designated as 0. Examples: 1:30003,2:30111 or 0:32224,0:33555. " 2203 UPDATE MCR-1.1 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; model_sequences; model_name "UPDATED accession with KP347127.1 UPDATED accession with AKF16168.1 UPDATED model_name with MCR-1.1 " 2205 UPDATE MexJ antibiotic efflux; triclosan; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; disinfecting agents and antiseptics; tetracycline; erythromycin; ARO_description; ARO_category; model_name "UPDATED ARO_description with MexJ is the membrane fusion protein of the MexJK multidrug efflux protein. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. UPDATED model_name with MexJ " 2206 UPDATE MexK antibiotic efflux; triclosan; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; disinfecting agents and antiseptics; tetracycline; erythromycin; ARO_description; ARO_category; model_name "UPDATED ARO_description with MexK is the inner membrane resistance-nodulation-cell division (RND) transporter in the MexJK multidrug efflux protein. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. UPDATED model_name with MexK " 2207 UPDATE MexV antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; disinfecting agents and antiseptics; efflux pump complex or subunit conferring antibiotic resistance; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; tetracycline; chloramphenicol; ARO_category; model_name "UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 UPDATED model_name with MexV " 2208 UPDATE MexW antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; disinfecting agents and antiseptics; efflux pump complex or subunit conferring antibiotic resistance; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; tetracycline; chloramphenicol; ARO_category; model_name "UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 UPDATED model_name with MexW " 3985 UPDATE TEM-210 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with TEM-210. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4812 UPDATE OXA-114l carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2424 UPDATE YojI peptide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; ATP-binding cassette (ABC) antibiotic efflux pump; microcin J25; antibiotic efflux; ARO_category; model_name "UPDATED category_aro_description with Microcin J25 is a peptide antibiotic that inhibits transcription by bacterial RNA polymerase. MccJ25 is produced by Escherichia coli strains that harbor a plasmid-borne antibiotic-synthesis and antibiotic-export cassette, consisting of a gene for MccJ25 precursor (a 58 residue linear peptide), two genes for factors that process MccJ25 precursor into MccJ25, and one gene for export of MccJ25. UPDATED model_name with YojI " 2425 UPDATE hmrM antibiotic efflux; norfloxacin; multidrug and toxic compound extrusion (MATE) transporter; efflux pump complex or subunit conferring antibiotic resistance; acriflavine; fluoroquinolone antibiotic; disinfecting agents and antiseptics; ARO_category "UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 4810 UPDATE OXA-114j carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 168 UPDATE VIM-17 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-17 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED partial with 0 UPDATED sequence with ATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATGATGGCTATTGCGAGTCCGCTCGCTTTTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCGGTCGGGGAGGTCCGGCTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAAAACACAGCGGCACTTCTCGCGGAGATTGAGAAGCAAATTGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCGGCGGCGTTGATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGTAGAGGGGAACGAGATTCCCACGCACTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAACTCTTCTATCCTGGTGCTGCGCATTCGACCGACAACTTAGTTGTGTACGTCCCGTCTGCGAGTGTGCTCTATGGTGGTTGTGCGATTTATGAGTTGTCACGCACGTCTGCGGGGAACGTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCATTGAGCGGATTCAACAACACTACCCGGAAGCACAGTTCGTCATTCCGGGGCACGGCCTGCCGGGCGGTCTAGACTTGCTCAAGCACACAACGAATGTTGTAAAAGCGCACACAAATCGCTCAGTCGTTGAGTAG UPDATED fmax with 1811 UPDATED accession with EU118148.2 UPDATED fmin with 1010 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with ABW90721.1 UPDATED sequence with MFKLLSKLLVYLTASMMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 169 UPDATE IMP-33 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IMP-33 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED partial with 0 UPDATED sequence with ATGAAGAAATTATTTGTTTTATGTGTATGCTTCTTTTGTAGCATTACTGCCGCAGGATCGTCTTTACCTGATTTAAAAATTGAGAAGCTTGAAGAAGGTGTTTTTGTTCATACATCGTTCGAAGAAGTTAACGGTTGGGGGGTTGTTACTAAACACGGTTTGGTGGTGCTTGTAAACACAGACGCCTATCTAATTGACACTCCATTTACTGCTACAGACACTGAAAAATTAGTCAATTGGTTTGTGGAGCGCGGCTATAAAATCAAAGGCACTATTTCATCACATTTCCATAGCGACAGCACAGGAGGAATAGAGTGGCTTAATTCTCAATCTATTCCCACGTATGCATCTGAATTAACAAATGAACTTTTGAAAAAATCCGGTAAGGTACAAGCTAAATATTCATTTAGCGAAGTTAGCTATTGGCTAGTTAAAAATAAAATTGAAGTTTTTTATCCTGGCCCAGGTCACACTCAAGATAACCTAGTGGTTTGGTTGCCTGAAAGTAAAATTTTATTCGGTGGTTGCTTTGTTAAACCTCACGGTCTTGGCAATTTAGGTGACGCAAATTTAGAAGCTTGGCCAAAGTCCGCCAAAATATTAATGTCTAAATATGGCAAAGCAAAGCTTGTTGTTTCAAGTCATAGTGAGAAAGGGGACGCATCACTATTGAAACGTACATGGGAACAAGCTCTTAAAGGGCTTAAAGAAAGTAAAAAAACATCATCACCAAGTAACTAA UPDATED fmax with 2568 UPDATED accession with JN848782.2 UPDATED fmin with 1827 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AEU17778.1 UPDATED sequence with MKKLFVLCVCFFCSITAAGSSLPDLKIEKLEEGVFVHTSFEEVNGWGVVTKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKSGKVQAKYSFSEVSYWLVKNKIEVFYPGPGHTQDNLVVWLPESKILFGGCFVKPHGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEKGDASLLKRTWEQALKGLKESKKTSSPSN UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 164 UPDATE vanN glycopeptide antibiotic; glycopeptide resistance gene cluster; Van ligase; antibiotic target alteration; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VanN is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Ser, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity in Enterococcus faecium. UPDATED accession with JF802084.1 UPDATED category_aro_name with Van ligase UPDATED category_aro_description with Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity. " 165 UPDATE VIM-29 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-29 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with JX311308.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 268 UPDATE CfxA6 antibiotic inactivation; cephamycin; CfxA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with CfxA6 beta-lactamase is a class A beta-lactamase found in an uncultured bacterium. UPDATED accession with GQ342996.1 UPDATED category_aro_description with CfxA beta-lactamases are class A beta-lactamases. " 167 UPDATE CMY-39 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with AB372224.1 " 160 UPDATE OXA-236 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-236 is a beta-lactamase found in A. baumannii. UPDATED accession with JQ820242.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 161 UPDATE SHV-56 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with EU586041.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 162 UPDATE KPC-8 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with KPC-8 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with FJ234412.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 163 UPDATE OXA-376 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF986257.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4839 UPDATE OXA-504 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4838 UPDATE OXA-503 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4815 UPDATE OXA-114p carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4831 UPDATE OXA-493 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2518 UPDATE tetB(58) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; model_name "UPDATED model_name with tetB(58) " 4423 UPDATE CARB-38 penam; antibiotic inactivation; CARB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2066 UPDATE Escherichia coli soxS with mutation conferring antibiotic resistance penem; antibiotic target alteration; tetracycline antibiotic; antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; reduced permeability to antibiotic; carbapenem; cephalosporin; cefalotin; ciprofloxacin; disinfecting agents and antiseptics; protein(s) and two-component regulatory system modulating antibiotic efflux; rifampin; ampicillin; penam; triclosan; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; tigecycline; glycylcycline; General Bacterial Porin with reduced permeability to beta-lactams; monobactam; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; rifamycin antibiotic; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 2517 UPDATE tetA(58) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; model_name "UPDATED model_name with tetA(58) " 908 UPDATE CTX-M-139 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with KC107824.1 " 2734 UPDATE PmpM antibiotic efflux; chlorhexidine; multidrug and toxic compound extrusion (MATE) transporter; efflux pump complex or subunit conferring antibiotic resistance; benzalkonium chloride; fluoroquinolone antibiotic; aminoglycoside antibiotic; disinfecting agents and antiseptics; neomycin; ARO_category "UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with chlorhexidine UPDATED category_aro_cvterm_id with 45598 UPDATED category_aro_accession with 3007039 UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_description with Chlorhexidine is a disinfectant and antiseptic that is used for skin disinfection, including mouthwashes (chlorhexidine gluconate). UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 909 UPDATE OXA-5 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with X58272.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2731 UPDATE MexJK-OpmH efflux pump complex or subunit conferring antibiotic resistance; triclosan; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; model_description; ARO_category "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 2732 UPDATE MexVW-OprM antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; disinfecting agents and antiseptics; efflux pump complex or subunit conferring antibiotic resistance; acriflavine; tetracycline antibiotic; fluoroquinolone antibiotic; erythromycin; phenicol antibiotic; tetracycline; chloramphenicol; model_description; ARO_category "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 2733 UPDATE TriABC-OpmH efflux pump complex or subunit conferring antibiotic resistance; triclosan; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; disinfecting agents and antiseptics; model_description; ARO_category "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 1846 UPDATE CTX-M-91 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-91 is a beta-lactamase found in Escherichia coli. UPDATED accession with GQ870432.1 " 3531 UPDATE OXA-466 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3530 UPDATE OXA-465 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3533 UPDATE OXA-471 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3532 UPDATE OXA-470 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5058 UPDATE OXA-749 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5059 UPDATE OXA-750 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3537 UPDATE OXA-475 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3536 UPDATE OXA-474 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3539 UPDATE OXA-477 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3538 UPDATE OXA-476 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Assigned by Lahey's list of beta-lactamases, no accessions or other information available. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5056 UPDATE OXA-747 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5057 UPDATE OXA-748 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5050 UPDATE OXA-741 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5051 UPDATE OXA-742 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5052 UPDATE OXA-743 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5053 UPDATE OXA-744 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1814 UPDATE AAC(6')-Ie-APH(2'')-Ia antibiotic inactivation; kanamycin A; gentamicin B; AAC(6'); aminoglycoside antibiotic; plazomicin; sisomicin; arbekacin; APH(2''); netilmicin; gentamicin C; amikacin; isepamicin; tobramycin; ARO_description; ARO_category "UPDATED ARO_description with AAC(6')-Ie-APH(2'')-Ia is an aminoglycoside acetyltransferase encoded by plasmids and transposons in S. aureus, E. faecalis, E. faecium and Staphylococcus warneri. UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 2''. " 1815 UPDATE CTX-M-134 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with JX896165.1 " 1816 UPDATE TEM-8 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with X65252.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1817 UPDATE vgaB dalfopristin; pleuromutilin; virginiamycin M1; pleuromutilin antibiotic; madumycin II; griseoviridin; ABC-F ATP-binding cassette ribosomal protection protein; macrolide antibiotic; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; phenicol antibiotic; lincosamide antibiotic; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGCTTAAAATCGACATGAAGAATGTAAAAAAATATTATGCAGATAAATTAATTTTAAATATAAAAGAACTAAAGATTTATAGTGGGGATAAAATAGGTATTGTAGGTAAGAATGGAGTTGGCAAAACAACACTTTTAAAAATAATAAAAGGACTAATAGAGATTGACGAAGGAAATATAATTATAAGTGAAAAAACAACTATTAAATATATCTCTCAATTAGAAGAACCACATAGTAAGATAATTGATGGAAAATATGCTTCAATATTTCAAGTTGAAAATAAGTGGAATGACAATATGAGTGGTGGTGAAAAAACTAGATTTAAACTAGCAGAGGGATTTCAAGATCAATGTTCTTTAATGCTCGTAGATGAACCTACAAGTAATTTAGATATCGAAGGAATAGAGTTGATAACAAATACTTTTAAAGAGTACCGTGATACTTTTTTGGTAGTATCTCATGATAGAATTTTTTTAGATCAAGTTTGTACAAAAATTTTTGAAATTGAAAATGGATATATTAGAGAATTCATCGGTAATTATACAAACTATATAGAGCAAAAAGAAATGCTTCTACGAAAGCAACAAGAAGAATACGAAAAGTATAATTCTAAAAGAAAGCAATTGGAGCAAGCTATAAAGCTAAAAGAGAATAAGGCGCAAGGAATGATTAAGCCCCCTTCAAAAACAATGGGAACATCTGAATCTAGAATATGGAAAATGCAACATGCTACTAAACAAAAAAAGATGCATAGAAATACGAAATCGTTGGAAACACGAATAGATAAATTAAATCATGTAGAAAAAATAAAAGAGCTTCCTTCTATTAAAATGGATTTACCTAATAGAGAGCAATTTCATGGTCGCAATGTAATTAGTTTAAAAAACTTATCTATAAAATTTAATAATCAATTTCTTTGGAGAGATGCTTCATTTGTCATTAAAGGTGGAGAAAAGGTTGCTATAATTGGTAACAATGGTGTAGGAAAAACAACATTGTTGAAGCTGATTCTAGAAAAAGTAGAATCAGTAATAATATCACCATCAGTTAAAATTGGATACGTCAGTCAAAACTTAGATGTTCTACAATCTCATAAATCTATCTTAGAAAATGTTATGTCTACCTCCATTCAAGATGAAACAATAGCAAGAATTGTTCTAGCAAGATTACATTTTTATCGCAATGATGTTCATAAAGAAATAAATGTTTTGAGTGGTGGAGAACAAATAAAGGTTGCTTTTGCCAAGCTATTTGTTAGCGATTGTAATACATTAATTCTTGATGAACCAACAAACTATTTGGATATCGATGCTGTTGAGGCATTAGAAGAATTGTTAATTACCTATGAAGGTGTTGTGTTATTTGCTTCCCATGATAAAAAATTTATACAAAACCTAGCTGAACAATTGTTAATAATAGAAAATAATAAAGTGAAAAAATTCGAAGGAACATATATAGAATATTTAAAAATTAAAGATAAACCAAAATTAAATACAAATGAAAAAGAACTCAAAGAAAAAAAGATGATACTAGAAATGCAAATTTCATCATTATTAAGTAAAATCTCAATGGAAGAAAATGAAGAAAAAAACAAAGAATTAGATGAAAAGTACAAATTGAAATTAAAAGAATTGAAAAGCCTAAATAAAAATATTTAA UPDATED fmax with 2287 UPDATED accession with U82085.2 UPDATED fmin with 628 UPDATED strand with + UPDATED NCBI_taxonomy_name with Staphylococcus aureus UPDATED NCBI_taxonomy_id with 1280 UPDATED NCBI_taxonomy_cvterm_id with 35508 UPDATED accession with AAB95639.1 UPDATED sequence with MLKIDMKNVKKYYADKLILNIKELKIYSGDKIGIVGKNGVGKTTLLKIIKGLIEIDEGNIIISEKTTIKYISQLEEPHSKIIDGKYASIFQVENKWNDNMSGGEKTRFKLAEGFQDQCSLMLVDEPTSNLDIEGIELITNTFKEYRDTFLVVSHDRIFLDQVCTKIFEIENGYIREFIGNYTNYIEQKEMLLRKQQEEYEKYNSKRKQLEQAIKLKENKAQGMIKPPSKTMGTSESRIWKMQHATKQKKMHRNTKSLETRIDKLNHVEKIKELPSIKMDLPNREQFHGRNVISLKNLSIKFNNQFLWRDASFVIKGGEKVAIIGNNGVGKTTLLKLILEKVESVIISPSVKIGYVSQNLDVLQSHKSILENVMSTSIQDETIARIVLARLHFYRNDVHKEINVLSGGEQIKVAFAKLFVSDCNTLILDEPTNYLDIDAVEALEELLITYEGVVLFASHDKKFIQNLAEQLLIIENNKVKKFEGTYIEYLKIKDKPKLNTNEKELKEKKMILEMQISSLLSKISMEENEEKNKELDEKYKLKLKELKSLNKNI UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 1810 UPDATE VIM-15 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-15 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with EU419745.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1811 UPDATE CARB-2 penam; antibiotic inactivation; CARB beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with CARB-2 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with DQ157752.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1812 UPDATE KHM-1 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; KHM beta-lactamase; model_sequences; model_name; ARO_category "UPDATED accession with AB364006.1 UPDATED model_name with KHM-1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1813 UPDATE MOX-4 penam; antibiotic inactivation; MOX beta-lactamase; cephamycin; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with MOX-4 is a beta-lactamase found in Aeromonas caviae. UPDATED accession with FJ262599.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1093 UPDATE AAC(6')-31 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-31 is an integron-encoded aminoglycoside acetyltransferase in Pseudomonas putida, A. baumannii and K. pneumoniae. UPDATED accession with AM283489.1 " 1818 UPDATE GES-26 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences; ARO_category "UPDATED accession with KP096411.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 1819 UPDATE TEM-3 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4912 UPDATE OXA-586 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 674 UPDATE OXA-15 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with U63835.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 300 UPDATE AAC(6')-29a AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description "UPDATED ARO_description with AAC(6')-29a is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa. " 675 UPDATE OXA-25 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-25 is a beta-lactamase found in A. baumannii. UPDATED accession with AF201826.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 725 UPDATE GES-11 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with GES-11 is a beta-lactamase found in Acinetobacter baumannii. UPDATED accession with FJ854362.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 676 UPDATE AAC(6')-Ih AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Ih is a plasmid-encoded aminoglycoside acetyltransferase in A. baumannii. UPDATED accession with L29044.1 " 677 UPDATE OXA-171 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HM488992.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2008 UPDATE SHV-145 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX013655.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1087 UPDATE OXA-253 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-253 is a beta-lactamase found in A. baumannii. UPDATED partial with 0 UPDATED sequence with ATGAAAAAATTTATACTTCCTATCTTCAGCATTTCTATTCTACTTTCTCTCAGTGCATGCTCATCTATTCAAACTAAATTTGAAGATACTTCTGATATTTCTGATCAGCAACAAGGAAAAGCCATTAAAAGCTATTTTGATGAAGCTCAAACACAAGGTGTAATCATTATTAAAGAGGGAAAGAATATTAGTACCTATGGTAATAACCTGGCACGAGCACATACAGAATATGTCCCTGCATCAACATTTAAGATGCTAAATGCCTTAATTGGATTAGAAAATCATAAAGCTACAACAACTGAGATTTTCAAATGGGATGGTAAAAAAAGATCTTATCCTATGTGGGAAAAAGATATGACTTTAGGTGATGCCATGGCACTTTCAGCAGTTCCTGTATATCAAGAACTTGCAAGACGGACTGGTTTAGACCTAATGCAAAAAGAAGTCAAACGGGTTGGTTTTGGTAATATGAACATTGGAACACAAGTTGATAACTTCTGGTTGGTTGGCCCGCTTAAAATTACACCAATACAAGAGGTTAATTTTGCCGACGATCTCGCTAATAATCGATTACCCTTTAAATTAGAAACTCAAGAAGAAGTAAAAAAAATGCTTCTGATTAAAGAAGTCAATGGTAGTAAAATTTATGCGAAAAGCGGATGGGGAATGGATGTAATCCCTCAGGTAGGTTGGTTAACAGGTTGGGTAGAAAAATCTAATGGCGAAAAAGTTCCCTTTTCTCTAAACCTAGAAATGAAGCAAGGAATGTCTGGTTCTATTCGTAATGAAATTACTTATAAGTCATTAGAAAATTTAGGGATTATATAG UPDATED fmax with 1403 UPDATED accession with KC479324.2 UPDATED fmin with 575 UPDATED strand with + UPDATED NCBI_taxonomy_name with Acinetobacter baumannii UPDATED NCBI_taxonomy_id with 470 UPDATED NCBI_taxonomy_cvterm_id with 35507 UPDATED accession with AGK07368.1 UPDATED sequence with MKKFILPIFSISILLSLSACSSIQTKFEDTSDISDQQQGKAIKSYFDEAQTQGVIIIKEGKNISTYGNNLARAHTEYVPASTFKMLNALIGLENHKATTTEIFKWDGKKRSYPMWEKDMTLGDAMALSAVPVYQELARRTGLDLMQKEVKRVGFGNMNIGTQVDNFWLVGPLKITPIQEVNFADDLANNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMDVIPQVGWLTGWVEKSNGEKVPFSLNLEMKQGMSGSIRNEITYKSLENLGII UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2795 UPDATE MCR-3.1 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; model_name "UPDATED model_name with MCR-3.1 " 671 UPDATE CTX-M-137 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-137 is a beta-lactamase found in Escherichia coli. UPDATED accession with AB900900.1 " 672 UPDATE CMY-27 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-27 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with EU515250.1 " 673 UPDATE IMP-48 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences; ARO_category "UPDATED accession with KM087857.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1609 UPDATE QnrC sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrC is a plasmid-mediated quinolone resistance protein found in Proteus mirabilis. UPDATED accession with EU917444.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1979 UPDATE FosA4 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; ARO_description; model_sequences "UPDATED ARO_description with FosA4 is an enzyme that confers resistance to fosfomycin in Escherichia coli by breaking the epoxide ring of the molecule. UPDATED accession with AB908992.1 " 1978 UPDATE OXA-200 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-200 is a beta-lactamase found in A. baumannii. UPDATED accession with HQ734811.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1601 UPDATE LRA-1 class A LRA beta-lactamase; penam; cephalosporin; antibiotic inactivation; ARO_description; ARO_category "UPDATED ARO_description with LRA-1 is a beta-lactamase isolated from soil samples in Alaska. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1603 UPDATE SHV-86 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with DQ328802.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1602 UPDATE AAC(6')-Iai AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Iai is an aminoglycoside acetyltransferase encoded by plasmids and integrons in P. aeruginosa. UPDATED accession with EU886977.1 " 1605 UPDATE cphA5 carbapenem; CphA beta-lactamase; antibiotic inactivation; model_sequences "UPDATED accession with AY227051.1 " 1604 UPDATE CTX-M-84 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-84 is a beta-lactamase found in Salmonella enterica. UPDATED accession with FJ214367.1 " 1607 UPDATE Streptococcus pneumoniae PBP1a conferring resistance to amoxicillin penam; cephamycin; cephalosporin; Penicillin-binding protein mutations conferring resistance to beta-lactam antibiotics; antibiotic target alteration; amoxicillin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with PBP1a is a penicillin-binding protein found in Streptococcus pneumoniae. UPDATED accession with JN645776.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with Mutations in PBP transpeptidases that change the affinity for penicillin thereby conferring resistance to penicillin antibiotics. " 1606 UPDATE CTX-M-16 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-16 is a beta-lactamase found in Escherichia coli. UPDATED accession with AY029068.1 " 1555 UPDATE SHV-140 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JN051143.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 809 UPDATE lnuB antibiotic inactivation; lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; ARO_description "UPDATED ARO_description with lnuB is a plasmid-mediated nucleotidyltransferase found in Streptococcus lutetiensis. " 808 UPDATE TEM-171 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with GQ149347.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 803 UPDATE cphA4 carbapenem; CphA beta-lactamase; antibiotic inactivation; model_sequences "UPDATED accession with AY227050.1 " 802 UPDATE QnrA3 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrA3 is a plasmid-mediated quinolone resistance protein found in Shewanella algae. UPDATED accession with DQ058661.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 801 UPDATE mfpA sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with mfpA is a qnr homolog and a pentapeptide repeat protein that confers resistance to fluoroquinolones in Mycolicibacterium smegmatis. UPDATED accession with AL123456.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 800 UPDATE CTX-M-87 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-87 is a beta-lactamase found in Escherichia coli. UPDATED accession with EU545409.1 " 807 UPDATE OKP-B-1 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-B-1 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED partial with 0 UPDATED sequence with ATGCGTTATGTTCGCCTGTGCCTTATCTCCCTGATTGCCGCCCTGCCACTGGCGGTATTCGCCAGCCCTCAGCCGCTTGAGCAGATTAAAATCAGCGAAGGTCAGCTGGCGGGCCGGGTGGGCTATGTTGAAATGGATCTGGCCAGCGGCCGCATGCTGGCCGCCTGGCGCGCCAGTGAGCGCTTTCCGCTGATGAGCACCTTTAAAGTGCTGCTCTGCGGCGCGGTGCTGGCCCGGGTGGATGCCGGCGACGAACAGCTGGATCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCCGTCAGCGAAAAACACCTTGCCGACGGGATGACCGTTGGCGAACTCTGCGCCGCCGCCATCACCATGAGCGACAACAGCGCCGGCAATCTGCTGTTGAAGAGCGTCGGCGGCCCCGCGGGATTGACCGCTTTTCTGCGCCAGATCGGTGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTCAATGAGGCGCTTCCCGGCGACGTGCGCGACACCACCACCCCGGCCAGCATGGCCACCACCCTGCGCAAGTTGCTAACCACCCCCTCTCTGAGCGCCCGTTCGCAGCAGCAGCTGCTGCAGTGGATGGTGGACGACCGGGTGGCCGGCCCGTTGATCCGCGCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAAACCGGGGCCGGTGAGCGGGGCTCACGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAAGCGGAGCGTATCGTGGTGATCTATCTGCGGGATACCGCGGCGACCATGGCCGAACGTAACCAGCAGATCGCCGGGATAGGCGCGGCGCTGATCGAGCACTGGCAGCGCTAG UPDATED fmax with 861 UPDATED accession with AJ635402.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAG25813.2 UPDATED sequence with MRYVRLCLISLIAALPLAVFASPQPLEQIKISEGQLAGRVGYVEMDLASGRMLAAWRASERFPLMSTFKVLLCGAVLARVDAGDEQLDRRIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAGNLLLKSVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDVRDTTTPASMATTLRKLLTTPSLSARSQQQLLQWMVDDRVAGPLIRAVLPAGWFIADKTGAGERGSRGIVALLGPDGKAERIVVIYLRDTAATMAERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 806 UPDATE SHV-150 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX121117.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 805 UPDATE MexC penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; trimethoprim; aminocoumarin antibiotic; novobiocin; macrolide antibiotic; phenicol antibiotic; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; diaminopyrimidine antibiotic; tetracycline antibiotic; gentamicin C; chloramphenicol; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; model_sequences; ARO_category "UPDATED accession with U57969.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 804 UPDATE tetB(P) chlortetracycline; demeclocycline; oxytetracycline; tetracycline antibiotic; tetracycline; antibiotic target protection; minocycline; tetracycline-resistant ribosomal protection protein; doxycycline; model_sequences "UPDATED accession with L20800.1 " 4437 UPDATE CARB-53 penam; antibiotic inactivation; CARB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2848 UPDATE MCR-4.1 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; model_name "UPDATED model_name with MCR-4.1 " 2849 UPDATE MCR-5.1 peptide antibiotic; MCR phosphoethanolamine transferase; antibiotic target alteration; colistin B; colistin A; model_name "UPDATED model_name with MCR-5.1 " 2844 UPDATE Rhodobacter sphaeroides ampC beta-lactamase penam; antibiotic inactivation; benzylpenicillin; ampC-type beta-lactamase; cephalosporin; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Cereibacter sphaeroides 2.4.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2845 UPDATE Laribacter hongkongensis ampC beta-lactamase penam; antibiotic inactivation; cephalosporin; ampC-type beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2842 UPDATE Vibrio cholerae varG carbapenem; antibiotic inactivation; Subclass B1 Vibrio cholerae varG beta-lactamase; meropenem; ARO_category "UPDATED category_aro_name with Subclass B1 Vibrio cholerae varG beta-lactamase " 2843 UPDATE Escherichia coli ampC beta-lactamase penam; penicillin; cephalosporin; antibiotic inactivation; ampC-type beta-lactamase; ARO_category; model_name "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED model_name with Escherichia coli ampC beta-lactamase " 2840 UPDATE NPS-1 penam; antibiotic inactivation; NPS beta-lactamase; cephalosporin; model_sequences; ARO_category "UPDATED accession with AY027589.1 UPDATED accession with AAK14791.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2841 UPDATE Escherichia coli 23S rRNA with mutation conferring resistance to chloramphenicol antibiotic target alteration; phenicol antibiotic; 23S rRNA with mutation conferring resistance to phenicol antibiotics; chloramphenicol; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with Point mutation in the 23S rRNA of Escherichia coli shown clinically to confer resistance to chloramphenicol. UPDATED accession with AE014075.1 UPDATED category_aro_description with Point mutations in the 23S rRNA subunit shown clinically to confer resistance to phenicol class antibiotics, including chloramphenicol and florfenicol, by disrupting antibiotic binding-site affinity. " 3320 UPDATE QnrS10 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_category "UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 3321 UPDATE AAC(3)-IIe antibiotic inactivation; AAC(3); aminoglycoside antibiotic; ARO_description "UPDATED ARO_description with AAC(3)-IIe is a plasmid-encoded aminoglycoside acetyltransferase in E. coli. " 3323 UPDATE QnrS11 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_category "UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 3324 UPDATE Erm(49) antibiotic target alteration; streptogramin antibiotic; Erm 23S ribosomal RNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; ARO_description "UPDATED ARO_description with Erm(49) is an rRNA methylase gene. " 3326 UPDATE QnrS15 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_category "UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 3329 UPDATE Mycoplasma genitalium parC mutations confers resistance to Moxifloxacin antibiotic target alteration; fluoroquinolone resistant parC; fluoroquinolone antibiotic; model_name "UPDATED model_name with Mycoplasma genitalium parC mutations confers resistance to Moxifloxacin " 1775 UPDATE QnrS7 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrS7 is a plasmid-mediated quinolone resistance protein found in Escherichia coli. UPDATED accession with KF730651.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1774 UPDATE CTX-M-106 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with HQ913565.1 " 1777 UPDATE OXA-177 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-177 is a beta-lactamase found in A. baumannii. UPDATED accession with HM113563.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1776 UPDATE SHV-159 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX121126.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1771 UPDATE TEM-19 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX042489.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1770 UPDATE TEM-127 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY368236.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1772 UPDATE aadA11 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with aadA11 is an integron-encoded aminoglycoside nucleotidyltransferase gene in E. coli and P. aeruginosa. UPDATED accession with AY758206.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 1779 UPDATE CTX-M-12 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-12 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AF305837.1 " 1778 UPDATE OKP-A-5 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-A-5 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051143.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 1352 UPDATE OXA-251 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with JN118546.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 321 UPDATE CTX-M-35 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-35 is a beta-lactamase found in Citrobacter koseri. UPDATED accession with AB176534.1 " 31 UPDATE CTX-M-155 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with KM211508.1 " 327 UPDATE GES-17 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; model_sequences; ARO_category "UPDATED accession with HQ874631.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 3502 UPDATE OXA-429 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1159 UPDATE TEM-129 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AJ746225.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1158 UPDATE SHV-22 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF117746.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1155 UPDATE ACT-9 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with ACT-9 is a beta-lactamase found in Pantoea agglomerans. UPDATED accession with HQ693810.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1154 UPDATE TEM-146 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTCCGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCACGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA UPDATED fmax with 861 UPDATED accession with DQ105529.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with AAZ14084.2 UPDATED sequence with MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLPDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSHGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1157 UPDATE vanG glycopeptide antibiotic; glycopeptide resistance gene cluster; Van ligase; antibiotic target alteration; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VanG is a D-Ala-D-Ala ligase homolog that can synthesize D-Ala-D-Ser, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity in Enterococcus faecalis. UPDATED accession with DQ212986.1 UPDATED category_aro_name with Van ligase UPDATED category_aro_description with Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity. " 1156 UPDATE Erm(31) antibiotic target alteration; virginiamycin S2; vernamycin C; pristinamycin IC; patricin B; patricin A; oleandomycin; ostreogrycin B3; macrolide antibiotic; telithromycin; tylosin; lincosamide antibiotic; dirithromycin; clarithromycin; clindamycin; dalfopristin; pristinamycin IB; quinupristin; pristinamycin IA; Erm 23S ribosomal RNA methyltransferase; virginiamycin M1; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; roxithromycin; spiramycin; azithromycin; erythromycin; model_sequences; ARO_category "UPDATED accession with AF079138.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 1151 UPDATE OXA-240 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX089628.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1150 UPDATE QnrVC5 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrVC5 is an integron-mediated quinolone resistance protein found in Vibrio fluvialis. UPDATED accession with JN408080.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1153 UPDATE KPC-3 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with KPC-3 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AF395881.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1152 UPDATE CTX-M-39 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-39 is a beta-lactamase found in Escherichia coli. UPDATED accession with AY954516.1 " 1488 UPDATE TEM-75 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY130284.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 30 UPDATE OXA-226 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-226 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with FJ617207.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1551 UPDATE OXA-78 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-78 is a beta-lactamase found in A. baumannii. UPDATED accession with AY862132.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1550 UPDATE smeR penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; cephamycin; aminoglycoside antibiotic; ARO_description; ARO_category "UPDATED ARO_description with smeR is the responder component of a two component signal transduction system that includes smeS. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1553 UPDATE tetS chlortetracycline; demeclocycline; oxytetracycline; tetracycline antibiotic; tetracycline; antibiotic target protection; minocycline; tetracycline-resistant ribosomal protection protein; doxycycline; model_sequences "UPDATED accession with L09756.1 " 1552 UPDATE MUS-1 carbapenem; antibiotic inactivation; MUS beta-lactamase; model_sequences; model_name "UPDATED accession with AF441286.1 UPDATED model_name with MUS-1 " 59 UPDATE OXA-256 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HE616889.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 58 UPDATE QnrB47 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB47 is a plasmid-mediated quinolone resistance protein found in Escherichia coli. UPDATED accession with JX440358.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1557 UPDATE SHV-187 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with LN515533.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1556 UPDATE VIM-13 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-13 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with DQ365886.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 55 UPDATE OXA-69 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with OXA-69 is a beta-lactamase found in A. baumannii. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 54 UPDATE TEM-34 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with KC292503.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 57 UPDATE SHV-24 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AB023477.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 56 UPDATE TEM-7 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 51 UPDATE AAC(3)-IIIc antibiotic inactivation; AAC(3); aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(3)-IIIc is an aminoglycoside acetyltransferase in P. aeruginosa. UPDATED accession with L06161.1 " 50 UPDATE SME-2 carbapenem; antibiotic inactivation; SME beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with SME-2 is a beta-lactamase found in Serratia marcescens. UPDATED accession with AF275256.1 " 53 UPDATE MOX-5 penam; antibiotic inactivation; MOX beta-lactamase; cephamycin; cephalosporin; model_sequences; ARO_category "UPDATED accession with GQ152600.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 52 UPDATE OXY-2-2 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-2-2 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with AF473577.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 537 UPDATE OXA-120 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-120 is a beta-lactamase found in A. baumannii. UPDATED accession with HE963768.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 536 UPDATE TEM-95 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AJ308558.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 535 UPDATE Morganella morganii gyrB conferring resistance to fluoroquinolones fluoroquinolone resistant gyrB; grepafloxacin; trovafloxacin; ofloxacin; norfloxacin; nalidixic acid; lomefloxacin; gatifloxacin; levofloxacin; sparfloxacin; antibiotic target alteration; enoxacin; ciprofloxacin; pefloxacin; fluoroquinolone antibiotic; moxifloxacin; ARO_description; model_name "UPDATED ARO_description with Point mutation in Morganella morganii resulting in fluoroquinolone resistance. UPDATED model_name with Morganella morganii gyrB conferring resistance to fluoroquinolones " 534 UPDATE vanVB glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanV; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanVB, is a vanV variant found in the vanB gene cluster. It is found in some but not all vanB operons in E. faecalis, suggesting the existence of varied gene compositions in vanB operons. UPDATED accession with AE016830.1 UPDATED model_name with vanV gene in vanB cluster UPDATED ARO_name with vanV gene in vanB cluster " 533 UPDATE CARB-16 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences; ARO_category "UPDATED accession with HF953351.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 532 UPDATE CTX-M-47 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-47 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with AY847143.1 " 531 UPDATE SAT-3 streptothricin acetyltransferase (SAT); streptothricin; antibiotic inactivation; nucleoside antibiotic; model_sequences "UPDATED accession with Z48231.1 " 530 UPDATE VIM-11 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-11 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED partial with 0 UPDATED sequence with ATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATCATGGCTATTGCGAGTCCGCTCGCTTTTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCGGTCGGGGAGGTCCGGCTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAAAACACAGCGGCACTTCTCGCGGAGATTGAGAAGCAAATTGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCGGCGGCGTTGATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGTAGAGGGGAGCGAGATTCCCACGCACTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAACTCTTCTATCCTGGTGCTGCGCATTCGACCGACAACTTAGTTGTGTACGTCCCGTCTGCGAGTGTGCTCTATGGTGGTTGTGCGATTTATGAGTTGTCACGCACGTCTGCGGGGAACGTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCATTGAGCGGATTCAACAACACTACCCGGAAGCACAGTTCGTCATTCCGGGGCACGGCCTGCCGGGCGGTCTAGACTTGCTCAAGCACACAACGAATGTTGTAAAAGCGCACACAAATCGCTCAGTCGTTGAGTAG UPDATED fmax with 928 UPDATED accession with AY605049.2 UPDATED fmin with 127 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with AAT36613.1 UPDATED sequence with MFKLLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGSEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1518 UPDATE EreA2 antibiotic inactivation; macrolide antibiotic; macrolide esterase; erythromycin; ARO_description; model_sequences "UPDATED ARO_description with EreA2 is an integron-encoded erythromycin esterase that hydrolyses the drug's lactone ring. EreA2 is found in Providencia stuartii. UPDATED accession with AF099140.1 " 539 UPDATE QnrB59 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB59 is a plasmid-mediated quinolone resistance protein found in Citrobacter freundii. UPDATED accession with JX259320.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1908 UPDATE OKP-A-6 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-A-6 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051144.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 1558 UPDATE Bacillus subtilis mprF peptide antibiotic; antibiotic target alteration; defensin resistant mprF; defensin; model_sequences "UPDATED partial with 0 UPDATED sequence with TTGCTGATTAAAAAGAATGCTTTATCAATATTAAAAATCGTTTTTCCTATTGCTGTTTTGCTATTTGTTATTTATCAATCGAAAAAAGAACTGACAAATCTGTCATTCAAACGTACGCTCATGGTCATCAACGGACTGGAACGAACGGATTTATTCATGCTTGTGTTGATCGGCTTGCTGGCTGTTGCGGCTATGTCGCTGTATGATTACGTCCTGAAGTACTCACTGCGCCTATCGATCACAAACGGAAAAGTTTTCAGGGTTTCCTGGATCGCCAATTCATTTAATAATGTGTTGGGATTCGGCGGTTTAGCCGGAGTCGGGTTAAGAATGATGTTCTATAAGGAGCATACGAAAGACCATAAGGCACTCGTGAAAGGAATCGCCTGGCTCACATCATCTATGCTGCTCGGATTATCTGTTTTCAGCATTTTCGTTGCTGCGAGAGTGCTGCCAGTTGATGAAGTGATTCATGAGAAGCCTTGGCTGTGGGCGGTCGTTATCGGTTTTGCACTGATATTGCCGTTATCTTTAGCGGTGTCCAAAATAAAAGACCGCAAAGCTGGGGACGAAGAGAATGCGGATAAAGTGAAAAATCCGATTTTCGCATATATTGGAGCTTCAGTTGTTGAATGGCTCATGGCCGGGACCGTCATCTATTTTGCTTTGTTCGCTATGGGCATTCATGCAGATATCAGGTATGTGTTCGGGGTGTTCGTCATTGCGGCGATCGGAGGAATGATCAGCCTCGTGCCGGGCGGCTTCGGCTCGTTTGACCTTTTATTTTTGCTGGGGATGGAGCAGCTTGGCTATCATCAAGAGGCCATCGTTACTTCTATTGTGTTGTACAGGCTCGCCTACTCATTTATCCCATTTATCTTGGGACTGTTCTTTGCCGCCGGCGACCTGACGGAAAATACAATGAAGCGGCTCGAAACGAACCCGCGCATCGCACCGGCAATTGAGACGACAAACGTTCTGCTTGTTGTTCAGCGTGCGGTATTAGTGAGAATTTTGCAAGGCTCGCTTTCCCTTATTGTGTTCGTAGCAGGTCTGATTGTCTTGGCCTCAGTTTCCTTGCCGATTGACAGGCTGACGGTTATACCGCACATTCCGCGCCCGGCGCTTTTGCTGTTCAACGGCCTGTCCTTAAGCTCAGCGCTCATTCTGCTCATTTTGCCGATCGAGCTTTATAAACGGACAAAACGTTCCTACACGATGGCCATTACAGCGCTTGTCGGCGGCTTTGTGTTCAGCTTTTTAAAAGGGCTTAACATCAGCGCGATATTCGTACTGCCGATGATTATCGTATTGCTTGTGCTATTGAAAAAACAATTTGTCCGCGAACAGGCATCCTATACACTGGGACAATTGATATTCGCTGTGGCGCTGTTTACTGTGGCGCTCTTTAACTACAATCTGATCGCGGGCTTTATTTGGGACCGGATGAAGAAGGTGCTGCGTCACGAATATTTCGTCCACAGCACCTCGCATATTACACATGCAACCATCATGGCGATCATCATTGTGCCGCTGTTCTTCTTGATATTTACAGTGGTCTATCATAAGAGAACGAAACCGATCGGAGAGAAAGCTGACCCTGAGCGTCTTGCTGCGTTTCTCAATGAAAAAGGCGGCAACGCGCTGAGCCATCTTGGTTTTCTTGGAGATAAGCGGTTTTATTTTTCTAGCGATGGAAATGCACTGCTTCTGTTTGGGAAAATCGCCAGAAGGCTGGTCGTGCTCGGCGATCCATCTGGCCAAAGAGAATCATTCCCGCTCGTGCTGGAAGAATTTCTGAACGAAGCGCATCAGAAGGGATTCAGTGTTTTGTTCTATCAAATTGAACGAGAGGACATGGCGCTGTATCACGATTTTGGCTACAACTTCTTTAAATTGGGTGAGGAAGCATATGTAGATTTAAATACATTTACCTTGACTGGGAAGAAAAAAGCCGGCCTTCGGGCAATCAATAACCGCTTTGAGCGGGAGGAGTATACTTTCCATGTGGATCATCCCCCATTTTCTGATGCGTTTTTGGAGGAGCTGAAGCAAATCTCAGACGAATGGCTCGGCTCGAAAAAAGAGAAGGGATTCTCGCTCGGATTTTTTGATCCTTCCTATTTACAGAAAGCGCCGATCGCCTATATGAAAAATGCAGAAGGAGAGATCGTTGCATTCGCAAATGTCATGCCGATGTACCAGGAAGGAGAGATATCGGTCGATCTGATGCGCTATCGCGGCGACGCTCCAAATGGCATTATGGACGCATTGTTTATCCGTATGTTTTTATGGGCAAAGGAAGAGGGCTGTACGTCATTTAATATGGGGATGGCACCCTTGGCCAATGTCGGCACTGCCTTTACATCCTTCTGGTCCGAAAGGTTTGCCGCTGTCATTTTTAATAATGTCAGATACATGTACAGTTTCAGCGGCCTAAGAGCCTTTAAAGAAAAATATAAACCGGAGTGGCGAGGGAAATACTTAGCGTATCGGAAAAACAGATCTCTTTCTGTCACCATGTTCCTCGTTACACGTCTGATTGGCAAAAGCAAAAAAGACTCCGTCTAA UPDATED fmax with 919348 UPDATED accession with AL009126.3 UPDATED fmin with 916777 UPDATED strand with + UPDATED NCBI_taxonomy_name with Bacillus subtilis subsp. subtilis str. 168 UPDATED NCBI_taxonomy_id with 224308 UPDATED NCBI_taxonomy_cvterm_id with 39579 UPDATED accession with CAX52582.1 UPDATED sequence with MLIKKNALSILKIVFPIAVLLFVIYQSKKELTNLSFKRTLMVINGLERTDLFMLVLIGLLAVAAMSLYDYVLKYSLRLSITNGKVFRVSWIANSFNNVLGFGGLAGVGLRMMFYKEHTKDHKALVKGIAWLTSSMLLGLSVFSIFVAARVLPVDEVIHEKPWLWAVVIGFALILPLSLAVSKIKDRKAGDEENADKVKNPIFAYIGASVVEWLMAGTVIYFALFAMGIHADIRYVFGVFVIAAIGGMISLVPGGFGSFDLLFLLGMEQLGYHQEAIVTSIVLYRLAYSFIPFILGLFFAAGDLTENTMKRLETNPRIAPAIETTNVLLVVQRAVLVRILQGSLSLIVFVAGLIVLASVSLPIDRLTVIPHIPRPALLLFNGLSLSSALILLILPIELYKRTKRSYTMAITALVGGFVFSFLKGLNISAIFVLPMIIVLLVLLKKQFVREQASYTLGQLIFAVALFTVALFNYNLIAGFIWDRMKKVLRHEYFVHSTSHITHATIMAIIIVPLFFLIFTVVYHKRTKPIGEKADPERLAAFLNEKGGNALSHLGFLGDKRFYFSSDGNALLLFGKIARRLVVLGDPSGQRESFPLVLEEFLNEAHQKGFSVLFYQIEREDMALYHDFGYNFFKLGEEAYVDLNTFTLTGKKKAGLRAINNRFEREEYTFHVDHPPFSDAFLEELKQISDEWLGSKKEKGFSLGFFDPSYLQKAPIAYMKNAEGEIVAFANVMPMYQEGEISVDLMRYRGDAPNGIMDALFIRMFLWAKEEGCTSFNMGMAPLANVGTAFTSFWSERFAAVIFNNVRYMYSFSGLRAFKEKYKPEWRGKYLAYRKNRSLSVTMFLVTRLIGKSKKDSV " 1909 UPDATE AAC(6')-Iak AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description "UPDATED ARO_description with AAC(6')-Iak is a 6'-N-aminoglycoside acetyltransferase-encoding gene isolated from a multidrug-resistant clinical isolate of Stenotrophomonas maltophilia. " 3296 UPDATE erm(45) antibiotic target alteration; streptogramin antibiotic; Erm 23S ribosomal RNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; model_sequences; model_name "UPDATED NCBI_taxonomy_name with Mammaliicoccus fleurettii UPDATED model_name with erm(45) " 4690 UPDATE IMP-63 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1905 UPDATE ACT-21 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences; ARO_category "UPDATED accession with KF526118.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 304 UPDATE IND-11 carbapenem; antibiotic inactivation; IND beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IND-11 is a beta-lactamase found in Escherichia coli. UPDATED accession with HM245379.1 UPDATED category_aro_description with IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases. " 1902 UPDATE OXA-246 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-246 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with KF711993.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3455 UPDATE OXA-292 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3291 UPDATE Erm(48) antibiotic target alteration; streptogramin antibiotic; Erm 23S ribosomal RNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; model_sequences "UPDATED accession with LT223129.1 " 429 UPDATE mdsA penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; penem; carbapenem; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; cephamycin; monobactam; phenicol antibiotic; chloramphenicol; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 428 UPDATE OXY-2-7 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-2-7 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with Z49084.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1900 UPDATE ACT-13 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences; ARO_category "UPDATED accession with HE819402.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1399 UPDATE OXA-315 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-315 is a beta-lactamase found in A. baumannii. UPDATED accession with KF057032.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1398 UPDATE OXA-108 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-108 is a beta-lactamase found in A. baumannii. UPDATED accession with EF650034.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 421 UPDATE TEM-2 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with X54606.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 420 UPDATE CTX-M-1 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-1 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with X92506.1 " 1395 UPDATE Neisseria gonorrhoeae porin PIB (por) penam; reduced permeability to antibiotic; penem; cephamycin; carbapenem; cephalosporin; penicillin; General Bacterial Porin with reduced permeability to beta-lactams; tetracycline antibiotic; monobactam; tetracycline; model_sequences; model_name; ARO_category "UPDATED accession with U75641.1 UPDATED model_name with Neisseria gonorrhoeae porin PIB (por) UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 422 UPDATE FOX-10 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX049131.1 UPDATED category_aro_description with FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins. " 425 UPDATE TEM-182 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with TEM-182 is a beta-lactamase found in clinical isolates of H. parainfluenzae. UPDATED accession with HQ317449.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 424 UPDATE SHV-36 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF467947.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1391 UPDATE CTX-M-92 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-92 is a beta-lactamase found in Escherichia coli. UPDATED accession with GU127598.1 " 1390 UPDATE arlR antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; norfloxacin; efflux pump complex or subunit conferring antibiotic resistance; acriflavine; ciprofloxacin; fluoroquinolone antibiotic; disinfecting agents and antiseptics; ARO_category "UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 3812 UPDATE ROB-6 penam; antibiotic inactivation; cephalosporin; ROB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3813 UPDATE ROB-7 penam; antibiotic inactivation; cephalosporin; ROB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3810 UPDATE ROB-4 penam; antibiotic inactivation; cephalosporin; ROB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3811 UPDATE ROB-5 penam; antibiotic inactivation; cephalosporin; ROB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3816 UPDATE ROB-10 penam; antibiotic inactivation; cephalosporin; ROB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3814 UPDATE ROB-9 penam; antibiotic inactivation; cephalosporin; ROB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3815 UPDATE ROB-8 penam; antibiotic inactivation; cephalosporin; ROB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3818 UPDATE Thermus thermophilus 23s rRNA conferring resistance to pleuromutilin antibiotics 23S rRNA with mutation conferring resistance to pleuromutilin antibiotics; antibiotic target alteration; pleuromutilin antibiotic; ARO_category "UPDATED category_aro_description with Point mutations in the 23S rRNA subunit may confer resistance to pleuromutilin antibiotics. " 850 UPDATE OXA-26 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-26 is a beta-lactamase found in A. baumannii. UPDATED accession with AF201827.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 302 UPDATE TEM-207 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with KC818234.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 851 UPDATE Mycobacterium tuberculosis pncA mutations conferring resistance to pyrazinamide antibiotic target alteration; Pyrazinamide resistant pncA; pyrazinamide; model_sequences; ARO_category "UPDATED accession with AL123456.1 UPDATED category_aro_name with Pyrazinamide resistant pncA UPDATED category_aro_description with pncA is a pyrazinamidase/nicotinamidase. It catalyzes the activation of pyrazinamide to pyrazinoic acid. Mutations arise within the pncA gene that caused the loss of pyrazinamidase activity is the major mechanism of antibiotic resistance. " 307 UPDATE CTX-M-101 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with HQ398214.1 " 1422 UPDATE ACC-3 penam; monobactam; cephalosporin; ACC beta-lactamase; antibiotic inactivation; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with ACC-3 is a beta-lactamase found in Hafnia alvei. UPDATED accession with AF180958.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1443 UPDATE CARB-7 penam; antibiotic inactivation; CARB beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF409092.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1426 UPDATE IMP-7 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IMP-7 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with AF318077.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1425 UPDATE RbpA rifampin; rifapentine; RbpA bacterial RNA polymerase-binding protein; antibiotic target protection; rifabutin; rifaximin; rifamycin antibiotic; model_sequences "UPDATED accession with HQ203032.1 " 4743 UPDATE LEN-27 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4741 UPDATE KPC-82 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4740 UPDATE KPC-81 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4745 UPDATE LEN-31 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4744 UPDATE LEN-28 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1424 UPDATE OXY-2-4 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-2-4 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with Y17714.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3475 UPDATE OXA-341 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 722 UPDATE vanRA vanR; glycopeptide resistance gene cluster; teicoplanin; glycopeptide antibiotic; antibiotic target alteration; vancomycin; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanRA, is a vanR variant found in the vanA gene cluster. UPDATED accession with M97297.1 UPDATED model_name with vanR gene in vanA cluster UPDATED ARO_name with vanR gene in vanA cluster " 2183 UPDATE glycopeptide resistance gene cluster VanB glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; ARO_description "UPDATED ARO_description with This inducible cluster confers resistance to vancomycin but organisms remain sensitive to teicoplanin by allowing restructuring of peptidoglycan precursors to end in D-Ala-D-Lac. Sensitivity to teicoplanin is due to lack of binding to the sensor kinase VanS. The vanB gene cluster can be located either on plasmids or on the chromosome. Gene orientation: vanRSYWHBX. " 2182 UPDATE glycopeptide resistance gene cluster VanD glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; ARO_description "UPDATED ARO_description with Homologous to vanA, contains a D-Ala-D-Lac ligase. This cluster is constitutively expressed in the chromosome due to a dysfunctional D-ala-D-ala ligase and confers moderate resistance to both vancomycin and teicoplanin. Gene orientation: vanRSYHDX. " 2181 UPDATE glycopeptide resistance gene cluster VanF glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; ARO_description "UPDATED ARO_description with Homologous to vanA, contains a D-Ala-D-Lac ligase. The vanF gene cluster is inducible and confers high resistance to vancomycin in Paenibacillus popilliae. vanF organisms remain susceptible to teicoplanin. Gene orientation: RSYZHFX. " 2180 UPDATE glycopeptide resistance gene cluster VanL glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; ARO_description "UPDATED ARO_description with Homologous to VanC, contains a D-Ala-D-Ser ligase. The chromosome-located vanL gene cluster is inducible and confers low resistance to vancomycin. vanL organisms remain susceptible to teicoplanin. It is the only van gene cluster with two vanT genes. Gene orientation: vanL(XY)TmTrRS. " 2186 UPDATE glycopeptide resistance gene cluster VanG glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; ARO_description "UPDATED ARO_description with Contains a D-Ala-D-Ser ligase. The vanG gene cluster is inducible and confers low resistance to vancomycin. vanG organisms remain susceptible to teicoplanin. It is the only van gene cluster that contains two vanY genes. Gene orientation: vanRSYWGYT. " 229 UPDATE vanTmL glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanT; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanTmL, is a vanT variant found in the vanL gene cluster. vanTmL codes for the membrane-binding domain of vanTL. UPDATED accession with EU250284.1 UPDATED model_name with vanTm gene in vanL cluster UPDATED ARO_name with vanTm gene in vanL cluster " 228 UPDATE sdiA penam; antibiotic efflux; triclosan; rifampin; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; disinfecting agents and antiseptics; tetracycline antibiotic; cephalosporin; cefalotin; tigecycline; glycylcycline; ampicillin; fluoroquinolone antibiotic; rifamycin antibiotic; phenicol antibiotic; tetracycline; chloramphenicol; ARO_description; ARO_category "UPDATED ARO_description with SdiA is a cell division regulator that is also a positive regulator of AcrAB only when it's expressed from a plasmid. When the sdiA gene is on the chromosome, it has no effect on expression of acrAB. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 227 UPDATE OKP-B-3 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-B-3 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051152.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 226 UPDATE OXA-113 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-113 is a beta-lactamase found in A. baumannii. UPDATED accession with EF653400.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 224 UPDATE MIR-2 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY227752.1 UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 223 UPDATE GES-3 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with GES-3 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AB113580.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 222 UPDATE JOHN-1 carbapenem; penam; cephalosporin; antibiotic inactivation; JOHN beta-lactamase; model_sequences; model_name; ARO_category "UPDATED accession with AY028464.1 UPDATED model_name with JOHN-1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 221 UPDATE CMY-100 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with KF526113.1 " 220 UPDATE TEM-92 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF143804.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2213 UPDATE opmE kitasamycin; imipenem; thiamphenicol; resistance-nodulation-cell division (RND) antibiotic efflux pump; rokitamycin; antibiotic efflux; trimethoprim; macrolide antibiotic; disinfecting agents and antiseptics; carbapenem; efflux pump complex or subunit conferring antibiotic resistance; diaminopyrimidine antibiotic; acriflavine; tetracycline antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 2212 UPDATE mexQ kitasamycin; imipenem; thiamphenicol; resistance-nodulation-cell division (RND) antibiotic efflux pump; rokitamycin; antibiotic efflux; trimethoprim; macrolide antibiotic; disinfecting agents and antiseptics; carbapenem; efflux pump complex or subunit conferring antibiotic resistance; diaminopyrimidine antibiotic; acriflavine; tetracycline antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 2211 UPDATE mexP kitasamycin; imipenem; thiamphenicol; resistance-nodulation-cell division (RND) antibiotic efflux pump; rokitamycin; antibiotic efflux; trimethoprim; macrolide antibiotic; disinfecting agents and antiseptics; carbapenem; efflux pump complex or subunit conferring antibiotic resistance; diaminopyrimidine antibiotic; acriflavine; tetracycline antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; erythromycin; ARO_description; ARO_category "UPDATED ARO_description with MexP is the membrane fusion protein of the MexPQ-OpmE multidrug efflux complex. UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 2215 UPDATE Pseudomonas aeruginosa gyrA and parC conferring resistance to fluoroquinolones antibiotic target alteration; fluoroquinolone resistant parC; fluoroquinolone antibiotic; model_name "UPDATED model_name with Pseudomonas aeruginosa gyrA and parC conferring resistance to fluoroquinolones " 2219 UPDATE MexL antibiotic efflux; triclosan; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; disinfecting agents and antiseptics; tetracycline; erythromycin; ARO_category; model_name "UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. UPDATED model_name with MexL " 4713 UPDATE IND-16 carbapenem; antibiotic inactivation; IND beta-lactamase; ARO_category "UPDATED category_aro_description with IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases. " 1089 UPDATE CMY-14 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-14 is a beta-lactamase found in Proteus mirabilis. UPDATED partial with 0 UPDATED sequence with ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGATTATGCCCGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGATAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA UPDATED fmax with 1146 UPDATED accession with AJ555825.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Proteus mirabilis UPDATED NCBI_taxonomy_id with 584 UPDATED NCBI_taxonomy_cvterm_id with 36771 UPDATED accession with CAD88479.1 UPDATED sequence with MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYARGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEINPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ " 2786 UPDATE Burkholderia pseudomallei Omp38 penam; reduced permeability to antibiotic; imipenem; penem; benzylpenicillin; cephalosporin; carbapenem; ceftazidime; cephamycin; General Bacterial Porin with reduced permeability to beta-lactams; monobactam; cefoxitin; model_sequences; ARO_category "UPDATED accession with AY312416.1 UPDATED accession with AAP82271.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 151 UPDATE OKP-A-15 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-A-15 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with FJ755841.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 150 UPDATE catB3 antibiotic inactivation; thiamphenicol; chloramphenicol acetyltransferase (CAT); azidamfenicol; phenicol antibiotic; chloramphenicol; ARO_description; ARO_category "UPDATED ARO_description with catB3 is a plasmid or chromosome-encoded variant of the cat gene found in Salmonella typhimurium, Acinetobacter baumannii and Escherichia coli. UPDATED category_aro_description with Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini. " 155 UPDATE TEM-195 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with JN935137.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 154 UPDATE mgrA penam; peptide antibiotic; ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; antibiotic efflux; sparfloxacin; norfloxacin; disinfecting agents and antiseptics; moxifloxacin; daptomycin; cefotaxime; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; acriflavine; ciprofloxacin; tetracycline antibiotic; moenomycin A1; fluoroquinolone antibiotic; methicillin; tetracycline; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 157 UPDATE dfrA21 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description; model_sequences "UPDATED ARO_description with dfrA21 is an integron-encoded dihydrofolate reductase found in Salmonella enterica. UPDATED accession with AM932669.1 " 156 UPDATE AAC(6')-Iaf AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Iaf is an aminoglycoside acetyltransferase encoded by plasmids and integrons in P. aeruginosa. UPDATED accession with AB462903.1 " 159 UPDATE vgaALC dalfopristin; pleuromutilin; virginiamycin M1; pleuromutilin antibiotic; madumycin II; griseoviridin; ABC-F ATP-binding cassette ribosomal protection protein; macrolide antibiotic; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; phenicol antibiotic; lincosamide antibiotic; model_sequences; ARO_category "UPDATED accession with DQ823382.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 158 UPDATE myrA antibiotic target alteration; non-erm 23S ribosomal RNA methyltransferase (G748); macrolide antibiotic; lincosamide antibiotic; model_sequences; ARO_category "UPDATED accession with D16099.1 UPDATED category_aro_description with Non-erm 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides. " 1293 UPDATE OXA-197 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HQ425495.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1088 UPDATE Staphylococcus aureus rpoB mutants conferring resistance to daptomycin peptide antibiotic; daptomycin resistant beta-subunit of RNA polymerase (rpoB); antibiotic target alteration; daptomycin; rifamycin antibiotic; ARO_description "UPDATED ARO_description with Point mutations that occurs in Staphylococcus aureus rpoB resulting in resistance to daptomycin. " 2436 UPDATE D-Ala-D-Ala ligase glycopeptide antibiotic; antibiotic target alteration; Van ligase; ARO_category "UPDATED category_aro_name with Van ligase UPDATED category_aro_description with Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity. " 2434 UPDATE Klebsiella pneumoniae OmpK36 penam; reduced permeability to antibiotic; penem; carbapenem; cephalosporin; cephamycin; General Bacterial Porin with reduced permeability to beta-lactams; monobactam; resistance by absence; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with Mechanism of antibiotic resistance conferred by deletion of gene (usually a porin). " 1161 UPDATE lsaB pleuromutilin; pleuromutilin antibiotic; macrolide antibiotic; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; clindamycin; phenicol antibiotic; lincosamide antibiotic; ARO_description; model_sequences "UPDATED ARO_description with LsaB is an ABC-F subfamily protein expressed in Mammaliicoccus sciuri. It confers resistance to clindamycin. UPDATED NCBI_taxonomy_name with Mammaliicoccus sciuri " 1359 UPDATE OXA-233 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KJ657570.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1162 UPDATE aadA15 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with aadA15 is an integron-encoded aminoglycoside nucleotidyltransferase gene in P. aeruginosa. UPDATED accession with DQ393783.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 1428 UPDATE cphA2 carbapenem; CphA beta-lactamase; antibiotic inactivation; ARO_description; model_sequences "UPDATED ARO_description with CphA2 is an Ambler Class B MBL; subclass B2 originally isolated from Aeromonas hydrophila. This enzyme has specific activity against carbapenems and is active as a mono-zinc protein. UPDATED accession with U60294.1 " 2724 UPDATE MuxABC-OpmB kitasamycin; resistance-nodulation-cell division (RND) antibiotic efflux pump; rokitamycin; aztreonam; aminocoumarin antibiotic; novobiocin; macrolide antibiotic; antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; monobactam; tetracycline; erythromycin; model_description "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). " 2720 UPDATE MuxC kitasamycin; resistance-nodulation-cell division (RND) antibiotic efflux pump; rokitamycin; aztreonam; aminocoumarin antibiotic; novobiocin; macrolide antibiotic; antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; monobactam; tetracycline; erythromycin; model_sequences "UPDATED accession with AAG05914.1 " 2729 UPDATE MexJK-OprM antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; tetracycline; erythromycin; model_description "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). " 1163 UPDATE CMY-94 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with JX514368.1 " 5049 UPDATE OXA-740 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5048 UPDATE OXA-739 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5047 UPDATE OXA-738 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5046 UPDATE OXA-736 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5045 UPDATE OXA-735 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5044 UPDATE OXA-734 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5043 UPDATE OXA-733 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5042 UPDATE OXA-732 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5041 UPDATE OXA-731 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5040 UPDATE OXA-730 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1807 UPDATE OXA-70 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-70 is a beta-lactamase found in A. baumannii. UPDATED accession with AY750912.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1806 UPDATE OXA-14 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1805 UPDATE TEM-131 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY436361.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1804 UPDATE OXA-107 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-107 is a beta-lactamase found in A. baumannii. UPDATED accession with EF650033.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1803 UPDATE QnrVC3 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrVC3 is an integron-mediated quinolone resistance protein found in Vibrio cholerae. UPDATED accession with HM015626.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1802 UPDATE OXA-168 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HM488989.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1801 UPDATE AAC(6')-Ib11 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Ib11 is an integron-encoded aminoglycoside acetyltransferase in S. enterica. UPDATED accession with AY136758.1 " 1800 UPDATE SHV-120 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JF812965.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1809 UPDATE QnrB5 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB5 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica. UPDATED accession with DQ303919.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 4996 UPDATE OXA-684 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4997 UPDATE OXA-685 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4994 UPDATE OXA-682 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4995 UPDATE OXA-683 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4992 UPDATE OXA-679 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4993 UPDATE OXA-680 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4990 UPDATE OXA-677 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4991 UPDATE OXA-678 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 126 UPDATE TEM-183 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with HQ529916.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4998 UPDATE OXA-686 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4999 UPDATE OXA-687 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1532 UPDATE OXA-249 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-249 is a beta-lactamase found in A. baumannii. UPDATED accession with HE963770.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1547 UPDATE vanRC glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanR; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanRC, is a vanR variant found in the vanC gene cluster. UPDATED accession with AF162694.1 UPDATED model_name with vanR gene in vanC cluster UPDATED ARO_name with vanR gene in vanC cluster " 1183 UPDATE tetQ chlortetracycline; demeclocycline; oxytetracycline; tetracycline antibiotic; tetracycline; antibiotic target protection; minocycline; tetracycline-resistant ribosomal protection protein; doxycycline; model_sequences "UPDATED accession with Z21523.1 " 3258 UPDATE dfrA27 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description "UPDATED ARO_description with A dihydrofolate reductase and trimethoprim resistance gene from non-O1, non-O139 Vibrio cholerae. " 1524 UPDATE Lactobacillus reuteri cat-TC antibiotic inactivation; thiamphenicol; chloramphenicol acetyltransferase (CAT); azidamfenicol; phenicol antibiotic; chloramphenicol; ARO_description; ARO_name; model_sequences; model_name; ARO_category "UPDATED ARO_description with cat-TC is a plasmid-encoded variant of the cat gene found in Limosilactobacillus reuteri. UPDATED ARO_name with Limosilactobacillus reuteri cat-TC UPDATED accession with U75299.1 UPDATED NCBI_taxonomy_name with Limosilactobacillus reuteri UPDATED model_name with Limosilactobacillus reuteri cat-TC UPDATED category_aro_description with Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini. " 1948 UPDATE TEM-167 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with FJ360884.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1949 UPDATE cphA6 carbapenem; CphA beta-lactamase; antibiotic inactivation; model_sequences "UPDATED accession with AY227052.1 " 1257 UPDATE QnrB68 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB68 is a plasmid-mediated quinolone resistance protein found in Citrobacter braakii. UPDATED accession with KC580657.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1942 UPDATE BJP-1 carbapenem; antibiotic inactivation; BJP beta-lactamase; model_name "UPDATED model_name with BJP-1 " 1943 UPDATE Mycobacterium tuberculosis kasA mutant conferring resistance to isoniazid isoniazid; antibiotic target alteration; antibiotic resistant kasA; ARO_description; model_sequences "UPDATED ARO_description with Specific mutations on the Mycobacterium tuberculosis kasA gene resulting in lowered affinity of isoniazid, resulting in resistance. UPDATED accession with AL123456.1 " 1940 UPDATE QnrB30 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB30 is a plasmid-mediated quinolone resistance protein found in Citrobacter braakii. UPDATED accession with HM439650.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1941 UPDATE SHV-98 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AM941844.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1946 UPDATE CTX-M-10 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-10 is a beta-lactamase found in Escherichia coli. UPDATED accession with AY598759.1 " 3256 UPDATE dfrA9 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description "UPDATED ARO_description with A dihydrofolate reductase and trimethoprim resistance gene identified from porcine isolates of Esherichia coli. " 1945 UPDATE SHV-50 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY288915.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 818 UPDATE SHV-141 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JQ388884.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 819 UPDATE CTX-M-68 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-68 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with EU177100.1 " 1255 UPDATE OXA-119 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-119 is a beta-lactamase found in Enterobacteriaceae. UPDATED accession with AY139598.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 810 UPDATE mecC penam; methicillin resistant PBP2; antibiotic target replacement; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 811 UPDATE TEM-26 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 812 UPDATE CMY-10 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-10 is a beta-lactamase found in Klebsiella aerogenes. UPDATED accession with AF357597.1 " 813 UPDATE OXA-216 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with FR865168.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 814 UPDATE TEM-113 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY589494.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 815 UPDATE GOB-1 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; model_sequences; model_name; ARO_category "UPDATED accession with AF090141.1 UPDATED model_name with GOB-1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 816 UPDATE OXA-3 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-3 is a beta-lactamase found in P. aeruginosa. UPDATED accession with L07945.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 817 UPDATE CTX-M-158 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with KM211691.1 " 2859 UPDATE PDC-80 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 1991 UPDATE otrC tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; ATP-binding cassette (ABC) antibiotic efflux pump; tetracycline; antibiotic efflux; ARO_description; model_sequences "UPDATED ARO_description with otrC is a tetracycline resistance efflux pump found in Streptomyces rimosus. UPDATED accession with AY509111.1 " 1250 UPDATE CTX-M-96 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with AJ704396.1 " 1990 UPDATE CMY-82 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with KJ207203.1 " 2851 UPDATE Escherichia coli gyrA with mutation conferring resistance to triclosan antibiotic target alteration; triclosan; disinfecting agents and antiseptics; triclosan resistant gyrA; ARO_category "UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 2850 UPDATE Salmonella enterica gyrA with mutation conferring resistance to triclosan antibiotic target alteration; triclosan; disinfecting agents and antiseptics; triclosan resistant gyrA; ARO_category "UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 2853 UPDATE PDC-74 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 1251 UPDATE CTX-M-157 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; model_sequences "UPDATED accession with KM211510.1 " 2855 UPDATE PDC-76 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 1621 UPDATE SHV-45 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF547625.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2857 UPDATE PDC-78 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2856 UPDATE PDC-77 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 1494 UPDATE LAT-1 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with LAT-1 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with X78117.1 " 1498 UPDATE cphA8 carbapenem; CphA beta-lactamase; antibiotic inactivation; model_sequences "UPDATED accession with AY261375.1 " 1499 UPDATE VEB-6 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with VEB-6 is a beta-lactamase found in Proteus mirabilis. UPDATED category_aro_description with VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam. " 3338 UPDATE AAC(6')-Iag antibiotic inactivation; kanamycin A; aminoglycoside antibiotic; AAC(6'); isepamicin; sisomicin; arbekacin; amikacin; dibekacin; tobramycin; ARO_description "UPDATED ARO_description with AAC(6')-Iag is an aminoglycoside acetyltransferase encoded by integrons in Pseudomonas aeruginosa. " 423 UPDATE DHA-16 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED accession with KM087852.1 " 1626 UPDATE vgaE dalfopristin; pleuromutilin; virginiamycin M1; pleuromutilin antibiotic; madumycin II; griseoviridin; ABC-F ATP-binding cassette ribosomal protection protein; macrolide antibiotic; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; phenicol antibiotic; lincosamide antibiotic; model_sequences; ARO_category "UPDATED accession with FR772051.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 1700 UPDATE ACT-28 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences; ARO_category "UPDATED accession with KJ207206.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1701 UPDATE Erm(39) antibiotic target alteration; virginiamycin S2; vernamycin C; pristinamycin IC; patricin B; patricin A; oleandomycin; ostreogrycin B3; macrolide antibiotic; telithromycin; tylosin; lincosamide antibiotic; dirithromycin; clarithromycin; clindamycin; dalfopristin; pristinamycin IB; quinupristin; pristinamycin IA; Erm 23S ribosomal RNA methyltransferase; virginiamycin M1; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; roxithromycin; spiramycin; azithromycin; erythromycin; model_sequences; ARO_category "UPDATED accession with AY487229.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 1702 UPDATE MIR-1 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with MIR-1 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED partial with 0 UPDATED sequence with ATGATGACAAAATCCCTAAGCTGTGCCCTGCTGCTCAGCGTCGCCAGTTCTGCATTCGCCGCACCGATGTCCGAAAAACAGCTGGCTGAGGTGGTGGAACGTACCGTTACGCCGCTGATGAACGCGCAGGCCATTCCGGGTATGGCGGTGGCGGTAATTTATCAGGGTCAGCCACACTACTTTACCTTCGGTAAAGCCGATGTTGCGGCGAACAAACCCGTCACCCCGCAAACCCTGTTTGAGCTGGGCTCTATAAGTAAAACCTTCACCGGCGTACTGGGCGGCGATGCCATTGCCCGGGGTGAAATAGCGCTGGGCGATCCGGTAGCAAAATACTGGCCTGAGCTCACGGGCAAGCAGTGGCAGGGCATTCGCATGCTGGATCTGGCAACCTATACCGCAGGCGGTCTGCCGTTACAGGTGCCGGATGAGGTCACGGATACCGCCTCTCTGCTGCGCTTTTATCAAAACTGGCAGCCGCAGTGGAAGCCGGGCACCACGCGTCTTTACGCTAACGCCAGCATCGGTCTTTTTGGTGCGCTGGCGGTTAAACCTTCCGGCATGAGCTATGAGCAGGCCATGACGACGCGGGTCTTTAAACCCCTCAAGCTGGACCATACCTGGATTAACGTCCCGAAAGCGGAAGAGGCGCATTTCGCCTGGGGATACCGTGAGGGTAAAGCGGTCCACGTTTCGCCAGGGATGCTGGACGCGGAAGCCTATGGCGTAAAAACTAACGTGAAGGATATGGCGAGCTGGCTGATAGCCAACATGAAGCCGGATTCTCTTCAGGCTCCCTCACTCAAGCAAGGCATTGCTCTGGCGCAGTCTCGCTACTGGCGCGTGGGGGCTATGTATCAGGGGTTAGGCTGGGAGATGCTCAACTGGCCGGTCGATGCCAAAACCGTCGTCGGAGGCAGTGATAACAAGGTGGCGCTGGCACCATTGCCCGTGGCAGAAGTGAATCCACCCGCGCCGCCGGTCAAGGCCTCCTGGGTCCATAAAACAGGCTCGACGGGCGGGTTTGGCAGCTACGTGGCATTTATTCCTGAAAAGCAGCTCGGCATTGTGATGCTGGCGAATAAAAGCTATCCGAACCCGGCACGCGTTGAGGCGGCATACCGTATCCTCGACGCGCTGCAGTAA UPDATED fmax with 2073 UPDATED accession with M37839.2 UPDATED fmin with 927 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with AAD22636.1 UPDATED sequence with MMTKSLSCALLLSVASSAFAAPMSEKQLAEVVERTVTPLMNAQAIPGMAVAVIYQGQPHYFTFGKADVAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEIALGDPVAKYWPELTGKQWQGIRMLDLATYTAGGLPLQVPDEVTDTASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMSYEQAMTTRVFKPLKLDHTWINVPKAEEAHFAWGYREGKAVHVSPGMLDAEAYGVKTNVKDMASWLIANMKPDSLQAPSLKQGIALAQSRYWRVGAMYQGLGWEMLNWPVDAKTVVGGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQLGIVMLANKSYPNPARVEAAYRILDALQ UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 1704 UPDATE CMY-57 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-57 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with HQ285243.1 " 1705 UPDATE SHV-111 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AB372881.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1706 UPDATE OXA-142 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-142 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with EU358785.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1707 UPDATE QnrB4 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB4 is a plasmid-mediated quinolone resistance protein found in Escherichia coli. UPDATED partial with 0 UPDATED sequence with ATGACTCTGGCGTTAGTTGGCGAAAAAATTGACAGAAACAGGTTCACCGGTGAAAAAGTTGAAAATAGCACATTTTTCAACTGTGATTTTTCGGGTGCCGACCTTAGCGGCACTGAATTTATTGGCTGCCAGTTTTATGATCGAGAAAGTCAGAAAGGATGTAATTTTAGTCGCGCTAACCTGAAAGATGCCATTTTCAAAAGTTGTGATCTCTCCATGGCTGATTTCAGGAATATCAATGCGCTGGGAATCGAAATTCGCCACTGCCGGGCACAAGGGTCAGATTTTCGCGGCGCAAGTTTTATGAATATGATCACCACCCGCACCTGGTTTTGTAGCGCCTATATCACCAATACCAACTTAAGCTACGCCAACTTTTCAAAAGTCGTACTGGAAAAGTGCGAGCTGTGGGAAAACCGCTGGATGGGTACTCAGGTGCTGGGCGCAACGTTCAGTGGATCAGACCTCTCTGGCGGCGAGTTTTCATCCTTCGACTGGCGAGCAGCAAACGTTACGCACTGTGATTTGACCAATTCGGAACTGGGCGATTTAGATATCCGCGGGGTTGATTTGCAAGGCGTCAAACTGGACAGCTACCAGGCATCGTTGCTCCTGGAACGTCTTGGTATCGCTGTCATGGGTTAA UPDATED fmax with 648 UPDATED accession with DQ303921.2 UPDATED fmin with 3 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with ABC17630.3 UPDATED sequence with MTLALVGEKIDRNRFTGEKVENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRANLKDAIFKSCDLSMADFRNINALGIEIRHCRAQGSDFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWMGTQVLGATFSGSDLSGGEFSSFDWRAANVTHCDLTNSELGDLDIRGVDLQGVKLDSYQASLLLERLGIAVMG UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1708 UPDATE tet36 chlortetracycline; demeclocycline; oxytetracycline; tetracycline antibiotic; tetracycline; antibiotic target protection; minocycline; tetracycline-resistant ribosomal protection protein; doxycycline; model_sequences "UPDATED accession with AJ514254.1 " 1393 UPDATE THIN-B carbapenem; penam; cephalosporin; antibiotic inactivation; THIN-B beta-lactamase; model_sequences; model_name; ARO_category "UPDATED accession with AJ250876.1 UPDATED model_name with THIN-B UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1168 UPDATE NDM-9 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGGAATTGCCCAATATTATGCACCCGGTCGCGAAGCTGAGCACCGCATTAGCCGCTGCATTGATGCTGAGCGGGTGCATGCCCGGTGAAATCCGCCCGACGATTGGCCAGCAAATGGAAACTGGCGACCAACGGTTTGGCGATCTGGTTTTCCGCCAGCTCGCACCGAATGTCTGGCAGCACACTTCCTATCTCGACATGCCGGGTTTCGGGGCAGTCGCTTCCAACGGTTTGATCGTCAGGGATGGCGGCCGCGTGCTGGTGGTCGATACCGCCTGGACCGATGACCAGACCGCCCAGATCCTCAACTGGATCAAGCAGGAGATCAACCTGCCGGTCGCGCTGGCGGTGGTGACTCACGCGCATCAGGACAAGATGGGCGGTATGGACGCGCTGCATGCGGCGGGGATTGCGACTTATGCCAATGCGTTGTCGAACCAGCTTGCCCCGCAAAAGGGGATGGTTGCGGCGCAACACAGCCTGACTTTCGCCGCCAATGGCTGGGTCGAACCAGCAACCGCGCCCAACTTTGGCCCGCTCAAGGTATTTTACCCCGGCCCCGGCCACACCAGTGACAATATCACCGTTGGGATCGACGGCACCGACATCGCTTTTGGTGGCTGCCTGATCAAGGACAGCAAGGCCAAGTCGCTCGGCAATCTCGGTGATGCCGACACTGAGCACTACGCCGCGTCAGCGCGCGCGTTTGGTGCGGCGTTCCCCAAGGCCAGCATGATCGTGATGAGCCATTCCGCCCCCGATAGCCGCGCCGCAATCACTCATACGGCCCGCATGGCCGACAAGCTGCGCTGA UPDATED fmax with 1192 UPDATED accession with KC999080.2 UPDATED fmin with 379 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae subsp. pneumoniae UPDATED NCBI_taxonomy_id with 72407 UPDATED NCBI_taxonomy_cvterm_id with 39097 UPDATED accession with AGU91756.1 UPDATED sequence with MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQKGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1996 UPDATE vanXM glycopeptide antibiotic; glycopeptide resistance gene cluster; vanX; antibiotic target alteration; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanXM, is a vanX variant found in the vanM gene cluster. UPDATED accession with FJ349556.1 UPDATED model_name with vanX gene in vanM cluster UPDATED ARO_name with vanX gene in vanM cluster " 2097 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to paromomycin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; paromomycin; ARO_description; model_sequences; model_name "UPDATED ARO_description with Point mutations in the 3' minor domain of helix 44, in the rrsB 16S rRNA gene of Escherichia coli can confer resistance to paromomycin. UPDATED accession with U00096.1 UPDATED NCBI_taxonomy_name with Escherichia coli str. K-12 UPDATED model_name with Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to paromomycin " 1392 UPDATE aadA22 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with aadA22 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in S. enterica and E. coli. UPDATED accession with AM261837.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 2333 UPDATE LEN-26 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2096 UPDATE Escherichia coli 16S rRNA (rrsC) mutation conferring resistance to kasugamicin antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; kasugamycin; ARO_description; model_sequences; model_name "UPDATED ARO_description with Point mutations in the 3' minor, 3' major, and central domains in the rrsC 16S rRNA gene of Escherichia coli can confer resistance to kasugamicin. UPDATED accession with U00096.1 UPDATED NCBI_taxonomy_name with Escherichia coli str. K-12 UPDATED model_name with Escherichia coli 16S rRNA (rrsC) mutation conferring resistance to kasugamicin " 427 UPDATE OCH-7 penam; antibiotic inactivation; penem; cephalosporin; cephamycin; monobactam; OCH beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OCH-7 beta-lactamase is an Ambler class C chromosomal-encoded beta-lactamase in Brucella anthropi. UPDATED accession with AJ295345.1 UPDATED NCBI_taxonomy_name with Brucella anthropi UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OCH beta-lactamases are Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi. " 2091 UPDATE Mycobacteroides chelonae 16S rRNA mutation conferring resistance to gentamicin C antibiotic target alteration; gentamicin C; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description "UPDATED ARO_description with Point mutations in the 16S rRNA of Mycobacteroides chelonae can confer resistance to gentamicin C. " 426 UPDATE aadK antibiotic inactivation; streptomycin; aminoglycoside antibiotic; ANT(6); model_sequences; ARO_category "UPDATED accession with AL009126.1 UPDATED category_aro_description with Nucelotidylylation of streptomycin at the hydroxyl group at position 6. " 5188 UPDATE OXA-891 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2090 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to kanamycin kanamycin A; antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description "UPDATED ARO_description with Point mutations in the 16S rRNA of Mycobacteroides abscessus conferring resistance to kanamycin. " 1128 UPDATE OXA-23 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-23 is a beta-lactamase found in A. baumannii. UPDATED accession with AY795964.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1129 UPDATE CMY-19 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-19 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AB194410.1 " 5189 UPDATE OXA-892 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2093 UPDATE Chlamydophila psittaci 16S rRNA mutation conferring resistance to spectinomycin antibiotic target alteration; aminoglycoside antibiotic; spectinomycin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description "UPDATED ARO_description with Point mutation in the 16S rRNA helix 34 region of Chlamydophila psittaci can confer resistance against spectinomycin. " 1120 UPDATE IMI-7 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED accession with KM103296.1 " 1121 UPDATE APH(3')-VIa antibiotic inactivation; aminoglycoside antibiotic; isepamicin; paromomycin; kanamycin A; APH(3'); gentamicin B; amikacin; ribostamycin; G418; neomycin; butirosin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(3')-VIa is a plasmid-encoded aminoglycoside phosphotransferase in A. baumannii. UPDATED accession with X07753.1 UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'. " 1122 UPDATE OXA-180 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HM570036.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1123 UPDATE FOX-8 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with FOX-8 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with HM565917.1 UPDATED category_aro_description with FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins. " 1124 UPDATE TEM-186 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with JN227084.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1125 UPDATE OKP-B-11 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-B-11 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051161.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 1126 UPDATE OXA-184 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with JQ396378.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1127 UPDATE CTX-M-64 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-64 is a beta-lactamase found in Shigella sonnei. UPDATED partial with 0 UPDATED sequence with ATGGTTAAAAAATCACTGCGCCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACGGCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAAATACTTTATCGTGCTGATGAGCGCTTTCCAATGTGCAGTACCAGTAAAGTTATGGCGGCCGCGGCGGTGCTTAAGCAGAGTGAAACGCAAAAGCAGCTGCTTAATCAGCCTGTCGAGATCAAGCCTGCCGATCTGGTTAACTACAATCCGATTGCCGAAAAACACGTCAACGGCACAATGACGCTGGCAGAACTGAGCGCGGCCGCGTTGCAGTACAGCGACAATACCGCCATGAACAAATTGATTGCCCAGCTCGGTGGCCCGGGAGGCGTGACGGCTTTTGCCCGCGCGATCGGCGATGAGACGTTTCGTCTGGATCGCACTGAACCTACGCTGAATACCGCCATTCCCGGCGACCCGAGAGACACCACCACGCCGCGGGCGATGGCGCAGACGTTGCGTCAGCTTACGCTGGGTCATGCGCTGGGCGAAACCCAGCGGGCGCAGTTGGTGACGTGGCTCAAAGGCAATACGACCGGCGCAGCCAGCATTCGGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGCGGTGGCTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAACCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA UPDATED fmax with 1101 UPDATED accession with AB284167.2 UPDATED fmin with 225 UPDATED strand with + UPDATED NCBI_taxonomy_name with Shigella sonnei UPDATED NCBI_taxonomy_id with 624 UPDATED NCBI_taxonomy_cvterm_id with 36790 UPDATED accession with BAF63422.1 UPDATED sequence with MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPASWVVGDKTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL " 3654 UPDATE Neisseria gonorrhoeae gyrB conferring resistance to zoliflodacin antibiotic target alteration; Zoliflodacin; Zoliflodacin resistant gyrB; ARO_description; model_sequences; model_param "UPDATED ARO_description with Point mutation in Neisseria gonorrhoea gyrase B decreases affinity to zoliflodacin antibiotic. UPDATED partial with 0 UPDATED sequence with ATGACTGAACAAAAACACGAAGAATACGGCGCCGACAGCATCCAGGTGCTCGAAGGCTTGGAAGCGGTACGCAAACGCCCCGGCATGTACATCGGCGACACGCAGGACGGCAGCGGGCTGCACCATATGGTGTTTGAAGTATTGGACAACGCCATCGACGAAGCACTCGCCGGACATTGCGACAAAATCACGGTAACGATACACGCCGACCATTCCGTCAGCGTCGCCGACAACGGGCGCGGTATGCCCACCGGCATCCACCCGAAAGAAGGGCGTTCCGCCGCCGAAGTCATCATGACCGTCTTGCACGCGGGCGGCAAATTCGACAACAACAGCTACAAAATCTCCGGCGGCCTGCACGGCGTGGGCGTATCCGTCGTCAACGCGCTGTCCGACTGGGTAACGCTGACCATCTACCGCGACGGCAAAGAACACTTCGTCCGCTTCGTACGCGGCGAAACCGAAGAGCCGCTGAAAATTGTCGGCGATTCCGACAAAAAAGGCACGACCGTGCGCTTCCTCGCCGGCACGGAAACCTTCGGCAATATCGAATACAGCTTCGACATCCTCGCCAAACGTATTCGCGAACTTTCGTTCCTAAACAACGGCGTGGACATCGAATTGACCGACGAGCGCGACGGCAAGCACGAAAGCTTCGCCCTTTCCGGCGGCGTGGCGGGCTTCGTGCAATACATGAACCGCAAAAAAACGCCCTTGCACGAAAAAATCTTCTATGCGTTCGGCGAGAAAGACGGCATGAGCGTCGAATGCGCAATGCAATGGAACGACAGCTATCAGGAAAGCGTGCAGTGCTTCACCAACAACATCCCTCAGCGCGACGGCGGTACGCACCTGACCGCGCTGCGCCAAGTGATGACGCGCACCATCAACAGCTACATCGAAGCTAACGAAGTCGCCAAAAAAGCCAAAGTGGAAACCGCCGGCGACGATATGCGCGAAGGTTTGACCTGCGTGTTGTCCGTCAAACTGCCCGACCCCAAATTCTCATCCCAAACCAAAGACAAACTGGTTTCCGGCGAAATCGGCCCCGTTGTCAACGAAGTCATCAACCAAGCACTAACCGACTTCCTCGAAGAAAATCCGAACGAAGCCAAAATCATCACCGGCAAAATCGTCGATGCCGCCCGCGCACGCGAAGCCGCCCGCAAAGCCCGCGAAATCCCCCGCCGCAAAGGCGTGATGGACGGCTTGGGACTGCCCGGCAAACTCGCCGACTGCCAAGAAAAAGACCCTGCCCTGTCTGAACTCTACCTCGTCGAGGGCGACTCCGCAGGCGGTTCCGCCATGCAGGGCCGCGACCGCAAATTCCAAGCGATTTTGCCGCTCAAAGGTAAAATTTTGAACGTCGAAAAAGCACGTTTTGAAAAAATGCTCGCCAGCCAAGAGGTCGCCACCCTGATTACCGCGCTGGGTGCAGGCATCGGCAAAGAAGAGTTCAACCCTGAAAAACTACGCTACCACCGCATCATCATCATGACCGATGCCGACGTGGACGGTGCGCACATCCGCACCCTGCTCCTGACCTTCTTCTACCGCCAAATGCCCGAACTGGTCGAGCGCGGCTACATTTACATCGCCCAGCCGCCGCTCTACAAAGCCAAATACGGCAAGCAGGAGCGTTACCTCAAAGACGAACTGGAAAAAGACCAATGGCTGCTCGGCCTTGCCTTGGAAAAAGCCAAAATCGTTTCAGACGGCCGCACCATCGAAGGCGCAGAACTTGCCGACACCGCCAAACAATTCTTGTTGGCGAAAACCGTCATCGAACAGGAAAGCCGCTTCGTGGACGAACTCGTCCTGCGTGCCATGCTGCACGCGTCGCCCATTGATTTGACGTCGTCTGAAAACGCCGATAAAGCCGTTGCCGAACTTTCCGGTTTGCTTGACGAAAAAGAAGCCGCCCTCGAACGCATCGAAGGTCATGAAGGACACCAGTTCATCAAAATCACGCGCAAGCTGCACGGCAACGTCATGGTCAGCTACATCGAACCCAAGTTCCTCAACAGCAAAGCCTACCAAACCCTCACCCAAACCGCCGCCGCGCTCAAAGGCTTGGTCGGCGAGGGCGCCAAGCTCTACAAAGGCGAGAACGAGTACGACGCGGACAGCTTTGAAACCGCTTTGGACATCTTGATGAGCGTTGCCCAAAAAGGTATGTCCATCCAACGATACAAAGGTTTGGGCGAGATGAACCCCGAGCAGCTTTGGGAAACCACGATGGATCCCACCGTGCGCCGCCTGTTGAAAGTGCGCATCGAAGATGCCATTGCCGCCGACGAAGTGTTCGTTACCCTGATGGGCGACGAGGTCGAACCGCGCCGCGCCTTTATCGAAAACAATGCGCTGATTGCGCAAAATATCGACGCATAA UPDATED fmax with 48284 UPDATED accession with CQOZ01000008.1 UPDATED fmin with 45893 UPDATED strand with - UPDATED NCBI_taxonomy_name with Neisseria gonorrhoeae UPDATED NCBI_taxonomy_id with 485 UPDATED NCBI_taxonomy_cvterm_id with 36806 UPDATED accession with CNT74515.1 UPDATED sequence with MTEQKHEEYGADSIQVLEGLEAVRKRPGMYIGDTQDGSGLHHMVFEVLDNAIDEALAGHCDKITVTIHADHSVSVADNGRGMPTGIHPKEGRSAAEVIMTVLHAGGKFDNNSYKISGGLHGVGVSVVNALSDWVTLTIYRDGKEHFVRFVRGETEEPLKIVGDSDKKGTTVRFLAGTETFGNIEYSFDILAKRIRELSFLNNGVDIELTDERDGKHESFALSGGVAGFVQYMNRKKTPLHEKIFYAFGEKDGMSVECAMQWNDSYQESVQCFTNNIPQRDGGTHLTALRQVMTRTINSYIEANEVAKKAKVETAGDDMREGLTCVLSVKLPDPKFSSQTKDKLVSGEIGPVVNEVINQALTDFLEENPNEAKIITGKIVDAARAREAARKAREIPRRKGVMDGLGLPGKLADCQEKDPALSELYLVEGDSAGGSAMQGRDRKFQAILPLKGKILNVEKARFEKMLASQEVATLITALGAGIGKEEFNPEKLRYHRIIIMTDADVDGAHIRTLLLTFFYRQMPELVERGYIYIAQPPLYKAKYGKQERYLKDELEKDQWLLGLALEKAKIVSDGRTIEGAELADTAKQFLLAKTVIEQESRFVDELVLRAMLHASPIDLTSSENADKAVAELSGLLDEKEAALERIEGHEGHQFIKITRKLHGNVMVSYIEPKFLNSKAYQTLTQTAAALKGLVGEGAKLYKGENEYDADSFETALDILMSVAQKGMSIQRYKGLGEMNPEQLWETTMDPTVRRLLKVRIEDAIAADEVFVTLMGDEVEPRRAFIENNALIAQNIDA UPDATED 12583 with K450T UPDATED 12582 with K450N UPDATED 12584 with D429N UPDATED 12583 with K450T UPDATED 12582 with K450N UPDATED 12584 with D429N " 305 UPDATE chrB antibiotic target alteration; non-erm 23S ribosomal RNA methyltransferase (G748); macrolide antibiotic; lincosamide antibiotic; model_sequences; ARO_category "UPDATED accession with AY509120.1 UPDATED category_aro_description with Non-erm 23S ribosomal RNA methyltransferases modify guanosine 748 (E. coli numbering) to confer resistance to some macrolides and lincosamides. " 3024 UPDATE KPC-24 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2098 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to viomycin peptide antibiotic; antibiotic target alteration; 16s rRNA with mutation conferring resistance to peptide antibiotics; viomycin; model_name "UPDATED model_name with Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to viomycin " 524 UPDATE dfrA25 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description; model_sequences "UPDATED ARO_description with dfrA25 is an integron-encoded dihydrofolate reductase found in Salmonella agona. UPDATED accession with DQ267940.1 " 525 UPDATE CMY-13 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-13 is a beta-lactamase found in Escherichia coli. UPDATED partial with 0 UPDATED sequence with ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACGTTTGCCTCCGCCAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCATTATCTACCAGGGAAAACCCTATTATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGGTCGGTCAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAGTGGCAGGGTATCAGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTACTGATAAAGCCGCATTACTGCGTTTTTATCAAAACTGGCAGCCGCAATGGGCCCCGGGCGCTAAGCGTCTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACAGTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAACCTGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCCTATGGCGTGAAATCCAACGTTACCGATATGGCACGCTGGGTTCAGGTCAACATGGACGCCAGCCGCGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCTGATTCGATCATCAACGGTAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCGGCAGTGAAAGCCTCATGGGTGCATAAAACGGGATCCACTGGAGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA UPDATED fmax with 4786 UPDATED accession with AY339625.2 UPDATED fmin with 3640 UPDATED strand with - UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with AAQ16660.2 UPDATED sequence with MMKKSLCCALLLTASFSTFASAKTEQQIADIVNRTITPLMQEQAIPGMAVAIIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGISLLHLATYTAGGLPLQIPDDVTDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSNVTDMARWVQVNMDASRVQEKTLQQGIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ " 526 UPDATE ACT-2 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with ACT-2 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM076977.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 527 UPDATE SHV-38 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY079099.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1018 UPDATE APH(3')-IIc antibiotic inactivation; aminoglycoside antibiotic; paromomycin; kanamycin A; APH(3'); gentamicin B; ribostamycin; G418; neomycin; butirosin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(3')-IIc is a chromosomal-encoded aminoglycoside phosphotransferase in S. maltophilia. UPDATED accession with HQ424460.1 UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'. " 521 UPDATE OXA-386 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF986254.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 522 UPDATE floR antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; florfenicol; phenicol antibiotic; chloramphenicol; ARO_description; model_sequences "UPDATED ARO_description with floR is a plasmid or chromosome-encoded chloramphenicol exporter that is found in Bordetella bronchiseptica, Escherichia coli, Klebsiella pneumoniae, Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 and Vibrio cholerae. UPDATED partial with 0 UPDATED sequence with ATGACCACCACACGCCCCGCGTGGGCCTATACGCTGCCGGCAGCACTGCTGCTGATGGCTCCTTTCGACATCCTCGCTTCACTGGCGATGGATATTTATCTCCCTGTCGTTCCAGCGATGCCCGGCATCCTGAACACGACGCCCGCTATGATCCAACTCACGTTGAGCCTCTATATGGTGATGCTCGGCGTGGGCCAGGTGATTTTTGGTCCGCTCTCAGACAGAATCGGGCGACGGCCAATTCTACTTGCGGGCGCAACGGCTTTCGTCATTGCGTCTCTGGGAGCAGCTTGGTCTTCAACTGCACCGGCCTTTGTCGCTTTCCGTCTACTTCAAGCAGTGGGCGCGTCGGCCATGCTGGTGGCGACGTTCGCGACGGTTCGCGACGTTTATGCCAACCGTCCTGAGGGTGTCGTCATCTACGGCCTTTTCAGTTCGGTGCTGGCGTTCGTGCCTGCGCTCGGCCCTATCGCCGGAGCATTGATCGGCGAGTTCTTGGGATGGCAGGCGATATTCATTACTTTGGCTATACTGGCGATGCTCGCACTCCTAAATGCGGGTTTCAGGTGGCACGAAACCCGCCCTCTGGATCAAGTCAAGACGCGCCGATCTGTCTTGCCGATCTTCGCGAGTCCGGCTTTTTGGGTTTACACTGTCGGCTTTAGCGCCGGTATGGGCACCTTCTTCGTCTTCTTCTCGACGGCTCCCCGTGTGCTCATAGGCCAAGCGGAATATTCCGAGATCGGATTCAGCTTTGCCTTCGCCACTGTCGCGCTTGTAATGATCGTGACAACCCGTTTCGCGAAGTCCTTTGTCGCCAGATGGGGCATCGCAGGATGCGTGGCGCGTGGGATGGCGTTGCTTGTTTGCGGAGCGGTCCTGTTGGGGATCGGCGAACTTTACGGCTCGCCGTCATTCCTCACCTTCATCCTACCGATGTGGGTTGTCGCGGTCGGTATTGTCTTCACGGTGTCCGTTACCGCGAACGGCGCTTTGGCAGAGTTCGACGACATCGCGGGATCAGCGGTCGCGTTCTACTTCTGCGTTCAAAGCCTGATAGTCAGCATTGTCGGGACATTGGCGGTGGCACTTTTAAACGGTGACACAGCGTGGCCCGTGATCTGTTACGCCACGGCGATGGCGGTACTGGTTTCGTTGGGGCTGGTGCTCCTTCGGCTCCGTGGGGCTGCCACCGAGAAGTCGCCAGTCGTCTAA UPDATED fmax with 4522 UPDATED accession with AF231986.2 UPDATED fmin with 3307 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with AAG16656.1 UPDATED sequence with MTTTRPAWAYTLPAALLLMAPFDILASLAMDIYLPVVPAMPGILNTTPAMIQLTLSLYMVMLGVGQVIFGPLSDRIGRRPILLAGATAFVIASLGAAWSSTAPAFVAFRLLQAVGASAMLVATFATVRDVYANRPEGVVIYGLFSSVLAFVPALGPIAGALIGEFLGWQAIFITLAILAMLALLNAGFRWHETRPLDQVKTRRSVLPIFASPAFWVYTVGFSAGMGTFFVFFSTAPRVLIGQAEYSEIGFSFAFATVALVMIVTTRFAKSFVARWGIAGCVARGMALLVCGAVLLGIGELYGSPSFLTFILPMWVVAVGIVFTVSVTANGALAEFDDIAGSAVAFYFCVQSLIVSIVGTLAVALLNGDTAWPVICYATAMAVLVSLGLVLLRLRGAATEKSPVV " 523 UPDATE OXA-75 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with OXA-75 is a beta-lactamase found in A. baumannii. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1014 UPDATE SHV-25 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCGCCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCCGCCGCCATTACCGTGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 861 UPDATED accession with AF208796.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with AAF37209.2 UPDATED sequence with MRYIRLCIISLLAALPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITVSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1015 UPDATE evgA penam; antibiotic efflux; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; norfloxacin; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; oxacillin; tetracycline antibiotic; cloxacillin; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1016 UPDATE OXA-255 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-255 is a beta-lactamase found in A. baumannii. UPDATED partial with 0 UPDATED sequence with ATGAAAAAATTTATACTTCCTATCTTCAGCATTTCTACTCTACTTTCTCTCAGTGCATGCTCAACTATTCAAAATAAATTTGAAAAAACTTCTGATATTTCTGATCAGCAACATGAAAAAGCCATTAAAAGCTATTTTGATGAAGCTCAAACACAAGGTGTAATAATTATTAAAGAGGGAAAGAATATTAGAATCTATGGTAATAACCTGGTACGAGCACATACAGAATATGTCCCTGCGTCAACATTTAAGATGCTAAATGCCTTAATTGGATTAGAAAATCATAAAGCTACAACAACTGAGATTTTCAAATGGGATGGTAAAAAAAGATCTTATCCTATGTGGGAAAAAGATATGACTTTAGGTGATGCCATGGCACTTTCAGCAGTTCCTGTATATCAAGAACTTGCAAGACGGACTGGCTTAGATCTAATGCAAAAAGAAGTTAAACGGGTTGGTTTTGGTAATATGAGCATCGGGACACAAGTTAATAACTTCTGGTTAGTTGGCCCCCTCAAGATTACACCAATACAAGAGGCTAATTTTGCCGATGATCTTGCGAATAATCGATTACCCTTTAAATTAGAAACTCAAGAAGAAGTAAAAAAAATGCTTCTGATTAAAGAAGTCAATGGTAGTAAAATTTATGCGAAAAGTGGATGGGGAATGGATGTGACCCCTCAAGTAGGTTGGTTAACAGGTTGGGTAGAAAAATCTAATGGCGAAAAAGTTCCCTTTTCTCTAAACCTAGAAATGAAGCAAGGAATGTCTGGTTCTATTCGTAATGAAATTACTTATAAATCATTAGAAAATTTAGGGATTATATAA UPDATED fmax with 1496 UPDATED accession with KC479325.2 UPDATED fmin with 668 UPDATED strand with + UPDATED NCBI_taxonomy_name with Acinetobacter pittii UPDATED NCBI_taxonomy_id with 48296 UPDATED NCBI_taxonomy_cvterm_id with 36787 UPDATED accession with AGK07369.1 UPDATED sequence with MKKFILPIFSISTLLSLSACSTIQNKFEKTSDISDQQHEKAIKSYFDEAQTQGVIIIKEGKNIRIYGNNLVRAHTEYVPASTFKMLNALIGLENHKATTTEIFKWDGKKRSYPMWEKDMTLGDAMALSAVPVYQELARRTGLDLMQKEVKRVGFGNMSIGTQVNNFWLVGPLKITPIQEANFADDLANNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMDVTPQVGWLTGWVEKSNGEKVPFSLNLEMKQGMSGSIRNEITYKSLENLGII UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1017 UPDATE CTX-M-86 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-86 is a beta-lactamase found in Salmonella enterica. UPDATED accession with FJ214369.1 " 1010 UPDATE TEM-209 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF240808.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 529 UPDATE SHV-185 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with KM233164.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1012 UPDATE KPC-5 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCTGGCTTTTCTGCCACCGCGCTGACCAACCTCGTCGCGGAACCATTCGCTAAACTCGAACAGGACTTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGTTACCGCGCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCTGTGCTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTGGACACACCCATCCGTTACGGCAAAAATGCGCTGGTTCGGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTGGCGGAGCTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTGAAGGAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTCATGCGCTCTATCGGCGATACCACGTTCCGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGATACCTCATCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTGGCTGCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTAAAGGGAAACACGACCGGCAACCACCGCATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGAGTGTATGGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTGTTGGCCGTCTACACCCGGGCGCCTAACAAGGATGACAAGCACAGCGAGGCCGTCATCGCCGCTGCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGGCAGTAA UPDATED fmax with 3041 UPDATED accession with EU400222.2 UPDATED fmin with 2159 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with ABY91240.1 UPDATED sequence with MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVRWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1013 UPDATE APH(2'')-IIIa antibiotic inactivation; kanamycin A; gentamicin B; aminoglycoside antibiotic; sisomicin; arbekacin; APH(2''); netilmicin; gentamicin C; amikacin; isepamicin; tobramycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(2'')-IIIa is a plasmid-encoded aminoglycoside phosphotransferase in Enterococcus gallinarum. UPDATED accession with U51479.1 UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 2''. " 1234 UPDATE MIR-13 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; model_sequences; ARO_category "UPDATED accession with KM087862.1 UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 1236 UPDATE CMY-53 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-53 is a beta-lactamase found in Escherichia coli. UPDATED accession with HQ336940.1 " 1230 UPDATE CTX-M-33 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description "UPDATED ARO_description with CTX-M-33 is a beta-lactamase found in Salmonella enterica. " 1238 UPDATE OXA-397 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KM087865.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1239 UPDATE SHV-81 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACATCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCAGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAGCGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACCCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 886 UPDATED accession with AM176556.2 UPDATED fmin with 25 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAJ47136.2 UPDATED sequence with MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGSPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5672 UPDATE TTU-1 carbapenem; antibiotic inactivation; TTU beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 5673 UPDATE VEB-10 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; ARO_category "UPDATED category_aro_description with VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam. " 5675 UPDATE VEB-12 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; ARO_category "UPDATED category_aro_description with VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam. " 5676 UPDATE VEB-13 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; ARO_category "UPDATED category_aro_description with VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam. " 5677 UPDATE VEB-14 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; ARO_category "UPDATED category_aro_description with VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam. " 5678 UPDATE VEB-15 antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; ARO_category "UPDATED category_aro_description with VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam. " 4356 UPDATE AFM-1 carbapenem; antibiotic inactivation; AFM beta-lactamase; ARO_category "UPDATED category_aro_description with AFM beta-lactamases are class B1 beta-lactamases found in proteobacteria like Pseudomonas aeruginosa. " 4357 UPDATE AFM-2 carbapenem; antibiotic inactivation; AFM beta-lactamase; ARO_category "UPDATED category_aro_description with AFM beta-lactamases are class B1 beta-lactamases found in proteobacteria like Pseudomonas aeruginosa. " 1092 UPDATE tet(39) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; model_sequences "UPDATED accession with AY743590.1 " 1965 UPDATE LEN-11 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_description; ARO_category "UPDATED ARO_description with LEN-11 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 438 UPDATE VIM-6 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY165025.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 439 UPDATE SHV-83 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED partial with 1 UPDATED sequence with AAGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGGATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 861 UPDATED accession with AM176558.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAJ47138.2 UPDATED sequence with KRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 436 UPDATE OXY-4-1 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-4-1 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with AY077481.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 437 UPDATE SHV-69 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with DQ174308.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 434 UPDATE LEN-16 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with LEN-16 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AY743416.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 435 UPDATE OKP-A-9 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-A-9 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051148.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 433 UPDATE ACT-25 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences; ARO_category "UPDATED accession with KJ207208.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 430 UPDATE OXA-87 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with DQ348075.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 431 UPDATE Escherichia coli marR mutant conferring antibiotic resistance penam; antibiotic efflux; triclosan; rifampin; resistance-nodulation-cell division (RND) antibiotic efflux pump; protein(s) and two-component regulatory system modulating antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; antibiotic target alteration; disinfecting agents and antiseptics; tetracycline antibiotic; cephalosporin; cefalotin; tigecycline; glycylcycline; ampicillin; fluoroquinolone antibiotic; rifamycin antibiotic; phenicol antibiotic; tetracycline; chloramphenicol; model_sequences; ARO_name; ARO_category "UPDATED accession with U00096.1 UPDATED ARO_name with Escherichia coli AcrAB-TolC with MarR mutations conferring resistance to ciprofloxacin and tetracycline UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 4674 UPDATE IMI-20 carbapenem; antibiotic inactivation; IMI beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 3809 UPDATE ROB-3 penam; antibiotic inactivation; cephalosporin; ROB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3808 UPDATE ROB-2 penam; antibiotic inactivation; cephalosporin; ROB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3805 UPDATE ParS erythromycin; penem; tetracycline antibiotic; meropenem; antibiotic efflux; imipenem; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; reduced permeability to antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; protein(s) and two-component regulatory system modulating antibiotic efflux; penam; Outer Membrane Porin (Opr); efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; monobactam; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 3806 UPDATE ParR erythromycin; penem; tetracycline antibiotic; meropenem; antibiotic efflux; imipenem; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; reduced permeability to antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; protein(s) and two-component regulatory system modulating antibiotic efflux; penam; Outer Membrane Porin (Opr); efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; monobactam; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 3801 UPDATE AAC(3)-IVb antibiotic inactivation; AAC(3); aminoglycoside antibiotic; gentamicin A; tobramycin; ARO_description "UPDATED ARO_description with A novel aminoglycoside resistance gene identified from Cupriavidus gilardii; AAC(3)-IVb / aacC10 is an aminoglycoside-3-N-acetyltransferase gene which confers resistance to gentamicin and tobramycin. " 3800 UPDATE OXA-837 antibiotic inactivation; penam; carbapenem; cephalosporin; ampicillin; OXA beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with A class D OXA-like beta-lactamase described in the emerging pathogen Cupriavidus gilardii. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3802 UPDATE ANT(3'')-Ib antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_category "UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 1630 UPDATE IMP-13 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IMP-13 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with AJ550807.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2864 UPDATE PDC-85 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 4906 UPDATE OXA-580 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2865 UPDATE PDC-86 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 5708 UPDATE VIM-59 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5709 UPDATE VIM-60 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5704 UPDATE VIM-55 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5705 UPDATE VIM-56 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5706 UPDATE VIM-57 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5707 UPDATE VIM-58 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5700 UPDATE VIM-51 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5701 UPDATE VIM-52 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5702 UPDATE VIM-53 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5703 UPDATE VIM-54 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2868 UPDATE PDC-89 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2869 UPDATE PDC-90 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; ARO_description "UPDATED ARO_description with An AmpC-like beta-lactamase found in Pseudomonas aeruginosa. " 2249 UPDATE LpxA peptide antibiotic; antibiotic target alteration; colistin B; colistin A; Acinetobacter mutant Lpx gene conferring resistance to colistin; ARO_description "UPDATED ARO_description with The LpxA gene is widely known to be involved in the biosynthesis of lipid A in Gram-negative bacteria and mutations to this gene may cause resistance to antimicrobial peptides that target the outer membrane. " 1907 UPDATE vanSA glycopeptide resistance gene cluster; vanS; teicoplanin; glycopeptide antibiotic; antibiotic target alteration; vancomycin; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanSA, is a vanS variant found in the vanA gene cluster. UPDATED accession with M97297.1 UPDATED model_name with vanS gene in vanA cluster UPDATED ARO_name with vanS gene in vanA cluster " 634 UPDATE smeF antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; fluoroquinolone antibiotic; phenicol antibiotic; tetracycline; chloramphenicol; ARO_description; model_sequences "UPDATED ARO_description with smeF is an outer membrane multidrug efflux protein of the smeDEF complex in Stenotrophomonas maltophilia. UPDATED accession with AJ252200.1 " 1851 UPDATE KPC-13 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; model_sequences; ARO_category "UPDATED accession with HQ342889.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4682 UPDATE IMP-46 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4774 UPDATE MOX-13 penam; antibiotic inactivation; MOX beta-lactamase; cephamycin; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4775 UPDATE MOX-14 penam; antibiotic inactivation; MOX beta-lactamase; cephamycin; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4772 UPDATE MOX-11 penam; antibiotic inactivation; MOX beta-lactamase; cephamycin; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4773 UPDATE MOX-12 penam; antibiotic inactivation; MOX beta-lactamase; cephamycin; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4771 UPDATE MOX-10 penam; antibiotic inactivation; MOX beta-lactamase; cephamycin; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4778 UPDATE NDM-26 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with A class B New Delhi metallo-beta-lactamase and NDM-1 variant. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4779 UPDATE NDM-30 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4174 UPDATE ACT-84 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4175 UPDATE ACT-87 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4170 UPDATE ACT-80 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4171 UPDATE ACT-81 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4172 UPDATE ACT-82 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4173 UPDATE ACT-83 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1961 UPDATE TEM-105 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF516720.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4904 UPDATE OXA-578 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4888 UPDATE OXA-559 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4889 UPDATE OXA-560 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4918 UPDATE OXA-592 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4619 UPDATE GES-36 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 4618 UPDATE GES-35 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 238 UPDATE SHV-137 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with HQ661363.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 239 UPDATE OXA-83 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-83 is a beta-lactamase found in A. baumannii. UPDATED accession with DQ309277.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 234 UPDATE QnrS8 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrS8 is a plasmid-mediated quinolone resistance protein found in Klebsiella pneumoniae. UPDATED accession with KF730652.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 235 UPDATE OXA-181 penam; antibiotic inactivation; cephalosporin; carbapenem; piperacillin-tazobactam; amoxicillin; clavulanic acid; piperacillin; tazobactam; OXA beta-lactamase; amoxicillin-clavulanic acid; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-181 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with JN205800.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 236 UPDATE ACT-19 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences; ARO_category "UPDATED accession with KF992029.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 237 UPDATE Chryseobacterium meningosepticum BlaB carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 230 UPDATE OXA-422 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KM433671.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 231 UPDATE OXA-178 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with HM113564.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 232 UPDATE imiH carbapenem; CphA beta-lactamase; antibiotic inactivation; model_sequences "UPDATED accession with AJ548797.1 " 233 UPDATE LEN-21 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with LEN-21 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED partial with 0 UPDATED sequence with ATGCGTTATGTTCGCCTGTGTGTTATCTCCCTGTTAGCCACCCTGCCACTGGCGGTAGACGCCGGTCCACAGCCGCTTGAGCAGATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTGGGGATGGTGGAAATGGATCTGGCCAGCGGCCGCACGCTGGCCGCCTGGCGCGCCGATGAACGCTTTCCCATGGTGAGCACCTTTAAAGTGCTGCTGTGCGGCGCGGTGCTGGCGCGGGTGGATGCAGGGGTCGAACAACTGGTTCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCGGTCAGCGAAAAACACCTTGTCGACGGGATGACGATCGGCGAACTCTGCGCCGCCGCCATCACCCTGAGCGATAACAGCGCTGGCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCGGGATTAACTGCCTTTCTGCGCCAGATCGGTGACAACGTCACCCGTCTTGACCGCTGGGAAACGGCACTGAATGAGGCGCTTCCCGGCGACGCGCGCGACACCACCACCCCGGCCAGCATGGCCGCCACGCTGCGCAAACTACTGACCGCGCAGCATCTGAGCGCCCGTTCGCAACAGCAACTCCTGCAGTGGATGGTGGACGATCGGGTTGCCGGCCCGCTGATCCGCGCCGTGCTGCCGGCGGGCTGGTTTATCGCCGACAAAACCGGGGCTGGCGAACGGGGTGCGCGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAACCGGAGCGCATTGTGGTGATCTATCTGCGGGATACCCCGGCGAGTATGGCCGAGCGTAATCAACATATCGCCGGGATCGGCGCAGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 861 UPDATED accession with AM850911.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAP12349.2 UPDATED sequence with MRYVRLCVISLLATLPLAVDAGPQPLEQIKQSESQLSGRVGMVEMDLASGRTLAAWRADERFPMVSTFKVLLCGAVLARVDAGVEQLVRRIHYRQQDLVDYSPVSEKHLVDGMTIGELCAAAITLSDNSAGNLLLATVGGPAGLTAFLRQIGDNVTRLDRWETALNEALPGDARDTTTPASMAATLRKLLTAQHLSARSQQQLLQWMVDDRVAGPLIRAVLPAGWFIADKTGAGERGARGIVALLGPDGKPERIVVIYLRDTPASMAERNQHIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 993 UPDATE AAC(6')-Ib9 AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Ib9 is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa. UPDATED accession with AF043381.1 " 2228 UPDATE PEDO-1 carbapenem; antibiotic inactivation; subclass B3 PEDO beta-lactamase; model_sequences "UPDATED accession with KP109677.1 UPDATED accession with AJP77059.1 " 2229 UPDATE PEDO-2 carbapenem; antibiotic inactivation; subclass B3 PEDO beta-lactamase; model_sequences "UPDATED accession with KP109678.1 UPDATED accession with AJP77071.1 " 2227 UPDATE VCC-1 carbapenem; monobactam; VCC beta-lactamase; antibiotic inactivation; penam; model_sequences; ARO_category "UPDATED accession with KT818596.1 UPDATED accession with ALU64000.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2224 UPDATE Pseudomonas aeruginosa oprD with mutation conferring resistance to imipenem penam; carbapenem; imipenem; penem; reduced permeability to antibiotic; Outer Membrane Porin (Opr); cephalosporin; cephamycin; monobactam; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 992 UPDATE SHV-66 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with DQ174306.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2222 UPDATE VEB-1b antibiotic inactivation; monobactam; cephalosporin; VEB beta-lactamase; ARO_category "UPDATED category_aro_description with VEB beta-lactamases or Vietnamese extended-spectrum beta-lactamases are class A beta-lactamases that confer high-level resistance to oxyimino cephalosporins and to aztreonam. " 2223 UPDATE MexZ erythromycin; arbekacin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; protein(s) and two-component regulatory system modulating antibiotic efflux; penam; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; ARO_category; model_name "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 UPDATED model_name with MexZ " 1 UPDATE PDC-4 PDC beta-lactamase; monobactam; cephalosporin; antibiotic inactivation; carbapenem; model_sequences "UPDATED accession with FJ666067.1 " 2705 UPDATE MexEF-OprN with MexS mutations conferring resistance to chloramphenicol, ciprofloxacin, and trimethoprim antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; trimethoprim; efflux pump complex or subunit conferring antibiotic resistance; diaminopyrimidine antibiotic; ciprofloxacin; fluoroquinolone antibiotic; phenicol antibiotic; chloramphenicol; model_description "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). " 1433 UPDATE CMY-18 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description; model_sequences "UPDATED ARO_description with CMY-18 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with AY743434.1 " 133 UPDATE arr-8 antibiotic inactivation; rifampin; rifapentine; rifabutin; rifampin ADP-ribosyltransferase (Arr); rifaximin; rifamycin antibiotic; ARO_description; model_sequences "UPDATED ARO_description with arr-8 is an integron-encoded ribosyltransferase found in Klebsiella oxytoca. UPDATED accession with KC199968.1 " 4881 UPDATE OXA-552 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2707 UPDATE MexEF-OprN with MvaT deletion conferring resistance to chloramphenicol and norfloxacin antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; trimethoprim; efflux pump complex or subunit conferring antibiotic resistance; diaminopyrimidine antibiotic; fluoroquinolone antibiotic; phenicol antibiotic; chloramphenicol; model_description "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). " 146 UPDATE OXA-98 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-98 is a beta-lactamase found in A. baumannii. UPDATED accession with AM279652.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 144 UPDATE IMP-12 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IMP-12 is a beta-lactamase found in Pseudomonas putida. UPDATED accession with AJ420864.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 145 UPDATE OXA-229 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-229 is a beta-lactamase found in A. bereziniae. UPDATED accession with JQ422052.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 142 UPDATE tet(E) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; model_sequences "UPDATED accession with L06940.1 " 140 UPDATE AAC(6')-IIb AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-IIb is an integron-encoded aminoglycoside acetyltransferase in P. fluorescens. UPDATED accession with L06163.1 " 4884 UPDATE OXA-555 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1052 UPDATE OXA-206 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with AB634250.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 148 UPDATE SHV-92 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with DQ836922.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 149 UPDATE aadA12 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with aadA12 is an integron-encoded aminoglycoside nucleotidyltransferase gene in E. coli, Yersinia enterocolitica and S. enterica. UPDATED accession with FJ381668.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 1055 UPDATE Escherichia coli parE conferring resistance to fluoroquinolones fluoroquinolone resistant parE; grepafloxacin; trovafloxacin; ofloxacin; norfloxacin; nalidixic acid; lomefloxacin; gatifloxacin; levofloxacin; sparfloxacin; antibiotic target alteration; enoxacin; ciprofloxacin; pefloxacin; fluoroquinolone antibiotic; moxifloxacin; ARO_description "UPDATED ARO_description with Point mutation in Escherichia coli parE resulting in fluoroquinolones resistance. " 120 UPDATE aadA4 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with aadA4 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and chromosomes in Bordetella parapertussis and E. coli. UPDATED accession with AY138986.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 2088 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to streptomycin antibiotic target alteration; streptomycin; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description; model_name "UPDATED ARO_description with Point mutations in the helix 44 region of the 16S rRNA rrsB gene of Mycolicibacterium smegmatis can confer resistance to streptomycin. UPDATED model_name with Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to streptomycin " 1056 UPDATE VIM-19 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-19 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with FJ822963.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 121 UPDATE mdtF penam; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; macrolide antibiotic; efflux pump complex or subunit conferring antibiotic resistance; oxacillin; cloxacillin; fluoroquinolone antibiotic; erythromycin; model_sequences; ARO_category "UPDATED accession with U00096.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2083 UPDATE Mycoplasma hominis parC conferring resistance to fluoroquinolones grepafloxacin; trovafloxacin; ofloxacin; norfloxacin; nalidixic acid; lomefloxacin; gatifloxacin; sparfloxacin; levofloxacin; fluoroquinolone resistant parC; antibiotic target alteration; enoxacin; ciprofloxacin; pefloxacin; fluoroquinolone antibiotic; moxifloxacin; ARO_description; model_name "UPDATED ARO_description with Point mutation in Mycoplasma hominis parC resulting in fluoroquinolone resistance. UPDATED model_name with Mycoplasma hominis parC conferring resistance to fluoroquinolones " 2080 UPDATE Escherichia coli 16S rRNA (rrsH) mutation conferring resistance to spectinomycin antibiotic target alteration; aminoglycoside antibiotic; spectinomycin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description; model_sequences; model_name "UPDATED ARO_description with Point mutations in the 3' major domain of the rrsH 16S rRNA gene of Escherichia coli can confer resistance to spectinomycin. UPDATED accession with U00096.1 UPDATED NCBI_taxonomy_name with Escherichia coli str. K-12 UPDATED model_name with Escherichia coli 16S rRNA (rrsH) mutation conferring resistance to spectinomycin " 2086 UPDATE Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to tetracycline tetracycline antibiotic; antibiotic target alteration; 16S rRNA with mutation conferring resistance to tetracycline derivatives; tetracycline; ARO_description; model_sequences; model_name "UPDATED ARO_description with Point mutations in the 3' major domain of the rrnB 16S rRNA gene of Escherichia coli can confer resistance to tetracycline. UPDATED accession with U00096.1 UPDATED NCBI_taxonomy_name with Escherichia coli str. K-12 UPDATED model_name with Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to tetracycline " 2087 UPDATE aadA13 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; ARO_category "UPDATED ARO_description with aadA13 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in Pseudomonas rettgeri, P. aeruginosa, Y. enterocolitica and E. coli. UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 2084 UPDATE Mycobacteroides abscessus 16S rRNA mutation conferring resistance to amikacin antibiotic target alteration; amikacin; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description "UPDATED ARO_description with Point mutations in the 16S rRNA of Mycobacteroides abscessus conferring resistance to amikacin. " 2085 UPDATE Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to spectinomycin antibiotic target alteration; aminoglycoside antibiotic; spectinomycin; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description; model_sequences; model_name "UPDATED ARO_description with Point mutations in the 3' major domain of helix 35, in the rrnB gene operon for 16S rRNA of Escherichia coli can confer resistance to spectinomycin. UPDATED accession with U00096.1 UPDATED NCBI_taxonomy_name with Escherichia coli str. K-12 UPDATED model_name with Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to spectinomycin " 3342 UPDATE dfrA3b trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description; model_sequences "UPDATED ARO_description with A dihydrofolate reductase that confers resistance to trimethoprim. UPDATED partial with 0 UPDATED sequence with ATGACTAAACAAGCAATATTTGCCGTAGCCGAGAACCTAGCCTTCGGGCTAGGTGGGGGTCTCCCTTGGGATACGCTGAAAGACGACTTACAATTCTTTAAGAGGCTAACTGAAGGGACTGACTTAGTAATGGGAGCCTCCACGTACAGAACGCTGCCATTGTTACCAACCAATAACAGACAGTTTATTGTGGTAAGCAATACTGAGGAGCCTAGCCTTAATGTTCATGTGGTATCTCCAGAACACTTCAAGGCTTTCCTTAGCAAAACTTCCAGAAACCTTACTATTATCGGGGGCAGCTCGTTACTAACGGTAGATATATTATCAAAAATGGATAAGATAATTATGACTACGGTGTATGGAAGTTTTGATGCAGATGTATACTTACCTACTGAAGTAGTAAGTTATGTTACTGGCAAAGCTTCAAACGCCACATTATTTAATAACTCGGACGCAAAGATGGCAGTTTATTATGGATAA UPDATED fmax with 6095 UPDATED accession with AY162283.2 UPDATED fmin with 5615 UPDATED strand with + UPDATED NCBI_taxonomy_name with Citrobacter freundii UPDATED NCBI_taxonomy_id with 546 UPDATED NCBI_taxonomy_cvterm_id with 36915 UPDATED accession with AAN85115.1 UPDATED sequence with MTKQAIFAVAENLAFGLGGGLPWDTLKDDLQFFKRLTEGTDLVMGASTYRTLPLLPTNNRQFIVVSNTEEPSLNVHVVSPEHFKAFLSKTSRNLTIIGGSSLLTVDILSKMDKIIMTTVYGSFDADVYLPTEVVSYVTGKASNATLFNNSDAKMAVYYG " 3343 UPDATE dfrA6 from Proteus mirabilis trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description "UPDATED ARO_description with dfrA6 is a dihydrofolate reductase that confers resistance to trimethoprim. Found in Proteus mirabilis. " 124 UPDATE IND-7 carbapenem; antibiotic inactivation; IND beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IND-7 is a beta-lactamase found in Chryseobacterium indologenes. UPDATED accession with AB529520.1 UPDATED category_aro_description with IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases. " 3340 UPDATE aacA43 AAC(6'); kanamycin A; antibiotic inactivation; aminoglycoside antibiotic; tobramycin; ARO_description "UPDATED ARO_description with aacA43 is an aminoglycoside acetyltransferase encoded by integrons found in Klebsiella pneumoniae, Escherichia coli, and Enterobacter cloaecae. " 2712 UPDATE MexXY-OprA antibiotic efflux; tobramycin; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; meropenem; macrolide antibiotic; carbapenem; efflux pump complex or subunit conferring antibiotic resistance; arbekacin; ciprofloxacin; tetracycline antibiotic; gentamicin C; amikacin; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; ARO_description; model_description "UPDATED ARO_description with MexXY-OprA is a multidrug efflux protein expressed in Pseudomonas aeruginosa. MexY is the membrane fusion protein; MexX is the RND-type membrane protein; and OprA is the outer membrane channel. MexXY-OprA is associated with resistance to aminoglycosides. UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). " 2713 UPDATE MexXY-OprM erythromycin; tetracycline antibiotic; meropenem; antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; macrolide antibiotic; carbapenem; cephalosporin; ciprofloxacin; gentamicin C; amikacin; aminoglycoside antibiotic; disinfecting agents and antiseptics; penam; efflux pump complex or subunit conferring antibiotic resistance; cephamycin; acriflavine; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; tobramycin; model_description; ARO_category "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 3341 UPDATE Erm(K) antibiotic target alteration; streptogramin antibiotic; Erm 23S ribosomal RNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; ARO_description; model_sequences "UPDATED ARO_description with A 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(K) [Alkalihalobacillus halodurans]. UPDATED NCBI_taxonomy_name with Alkalihalobacillus halodurans " 3346 UPDATE AQU-2 antibiotic inactivation; AQU beta-lactamase; cephalosporin; ARO_description "UPDATED ARO_description with AQU-2 is a chromosomally-encoded AQU class C beta-lactamase and cephalosporinase from Aeromonas. " 127 UPDATE clbB dalfopristin; thiamphenicol; oxazolidinone antibiotic; virginiamycin M1; pleuromutilin antibiotic; tiamulin; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; antibiotic target alteration; lincosamide antibiotic; azidamfenicol; clindamycin; phenicol antibiotic; Cfr 23S ribosomal RNA methyltransferase; chloramphenicol; ARO_description; ARO_category "UPDATED ARO_description with clbB is a plasmid-encoded cfr gene found in Bacillus brevis. UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 3347 UPDATE AQU-3 antibiotic inactivation; AQU beta-lactamase; cephalosporin; ARO_description "UPDATED ARO_description with AQU-3 is a chromosomally-encoded AQU class C beta-lactamase and cephalosporinase from. " 128 UPDATE srmB pleuromutilin antibiotic; macrolide antibiotic; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; spiramycin; phenicol antibiotic; lincosamide antibiotic; ARO_description; model_sequences "UPDATED ARO_description with srmB is an ABC-F subfamily protein found in Streptomyces ambofaciens that confers resistance to spiramycin. UPDATED accession with X63451.1 " 5078 UPDATE OXA-769 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5079 UPDATE OXA-770 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5072 UPDATE OXA-763 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5073 UPDATE OXA-764 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5070 UPDATE OXA-761 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5071 UPDATE OXA-762 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5076 UPDATE OXA-767 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5077 UPDATE OXA-768 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5074 UPDATE OXA-765 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5075 UPDATE OXA-766 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1832 UPDATE QnrS2 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrS2 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica. UPDATED accession with DQ485530.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1833 UPDATE OXA-374 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with KF986255.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1830 UPDATE APH(3'')-Ib antibiotic inactivation; APH(3''); streptomycin; aminoglycoside antibiotic; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with TTGAATCGAACTAATATTTTTTTTGGTGAATCGCATTCTGACTGGTTGCCTGTCAGAGGCGGAGAATCTGGTGATTTTGTTTTTCGACGTGGTGACGGGCATGCCTTCGCGAAAATCGCACCTGCTTCCCGCCGCGGTGAGCTCGCTGGAGAGCGTGACCGCCTCATTTGGCTCAAAGGTCGAGGTGTGGCTTGCCCCGAGGTGATCAACTGGCAGGAGGAACAGGAGGGTGCATGCTTGGTGATAACGGCAATTCCGGGAGTACCGGCGGCTGATCTGTCTGGAGCGGATTTGCTCAAAGCGTGGCCGTCAATGGGGCAGCAACTTGGCGCTGTTCACAGCCTATTGGTTGATCAATGTCCGTTTGAGCGCAGGCTGTCGCGAATGTTCGGACGCGCCGTTGATGTGGTGTCCCGCAATGCCGTCAATCCCGACTTCTTACCGGACGAGGACAAGAGTACGCCGCAGCTCGATCTTTTGGCTCGTGTCGAACGAGAGCTACCGGTGCGGCTCGACCAAGAGCGCACCGATATGGTTGTTTGCCATGGTGATCCCTGCATGCCGAACTTCATGGTGGACCCTAAAACTCTTCAATGCACGGGTCTGATCGACCTTGGGCGGCTCGGAACAGCAGATCGCTATGCCGATTTGGCACTCATGATTGCTAACGCCGAAGAGAACTGGGCAGCGCCAGATGAAGCAGAGCGCGCCTTCGCTGTCCTATTCAATGTATTGGGGATCGAAGCCCCCGACCGCGAACGCCTTGCCTTCTATCTGCGATTGGACCCTCTGACTTGGGGTTGA UPDATED fmax with 16397 UPDATED accession with AF313472.2 UPDATED fmin with 15593 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with ABK33456.1 UPDATED sequence with MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRRGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPSMGQQLGAVHSLLVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLLARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG UPDATED category_aro_description with Phosphorylation of streptomycin on the hydroxyl group at position 3''. " 1831 UPDATE AAC(6')-Iid AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Iid is a chromosomal-encoded aminoglycoside acetyltransferase in Enterococcus durans. UPDATED partial with 0 UPDATED sequence with ATGATTATCAGTGAGTTTGATCGTGAGAATATTGTCTTGCGAGATCAGCTTGCAGATCTTTTAAGATTGACTTGGCCTGATGAGTATGGAACAGAGCCGATGAAAGAAGTCGAACAGTTGATGGCTCCAGAACGGATTGCTGTATCGGCGATTGAAGGGGAGGAATTGGTCGGTTTTGTTGGAGCGATCCCTCAATATGGCAAAACAGGGTGGGAGTTACATCCTTTGGTAGTAGCAAGCACACATCGCAAACAACAAATCGGGACACGATTGGTTTCCTACCTGGAAAAAGAAGTCGCTTCATATGGTGGCCTGGTCATCTATCTAGGGACAGATGATGTTGAAGGACAAACAAATTTAGTTGAAACGGATTTATTTGAAGATACCTTTGCAAAGTTACAAGAAATCAAAAATATCAATCATCATCCCTATACATTTTATGAGAAACTTGGCTATCAGATCATCGGTGTGATCCCAGATGCGAATGGGTGGAACCAGCCTGATATTTGGTTAGCAAAACGAGTGGCCAAACGAGAGCCAACGGAATAA UPDATED fmax with 582 UPDATED accession with AJ584700.2 UPDATED fmin with 33 UPDATED strand with + UPDATED NCBI_taxonomy_name with Enterococcus hirae UPDATED NCBI_taxonomy_id with 1354 UPDATED NCBI_taxonomy_cvterm_id with 39521 UPDATED accession with CAE50925.1 UPDATED sequence with MIISEFDRENIVLRDQLADLLRLTWPDEYGTEPMKEVEQLMAPERIAVSAIEGEELVGFVGAIPQYGKTGWELHPLVVASTHRKQQIGTRLVSYLEKEVASYGGLVIYLGTDDVEGQTNLVETDLFEDTFAKLQEIKNINHHPYTFYEKLGYQIIGVIPDANGWNQPDIWLAKRVAKREPTE " 1836 UPDATE OXA-201 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-201 is a beta-lactamase found in A. baumannii. UPDATED accession with HQ734812.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1834 UPDATE TEM-94 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AJ318094.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1835 UPDATE tet(38) tetracycline antibiotic; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; tetracycline; antibiotic efflux; model_sequences "UPDATED accession with AY825285.1 " 3794 UPDATE LpsA peptide antibiotic; reduced permeability to antibiotic; Intrinsic peptide antibiotic resistant Lps; ARO_category "UPDATED category_aro_description with LpsB is involved in lipopolysaccharide synthesis. It provides intrinsic resistance to colistin and other peptide antibiotics such as polymyxins. " 1839 UPDATE aadA14 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; ARO_category "UPDATED ARO_description with aadA14 is a plasmid-encoded aminoglycoside nucleotidyltransferase gene in Pasteurella multocida. UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 3790 UPDATE MecC-type methicillin resistance repressor MecI penam; methicillin resistant PBP2; antibiotic target replacement; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3793 UPDATE LpsB peptide antibiotic; reduced permeability to antibiotic; Intrinsic peptide antibiotic resistant Lps; ARO_category "UPDATED category_aro_description with LpsB is involved in lipopolysaccharide synthesis. It provides intrinsic resistance to colistin and other peptide antibiotics such as polymyxins. " 2404 UPDATE Neisseria gonorrhoeae gyrA conferring resistance to fluoroquinolones antibiotic target alteration; fluoroquinolone antibiotic; fluoroquinolone resistant gyrA; ciprofloxacin; ARO_description "UPDATED ARO_description with Point mutation in Neisseria gonorrhoeae DNA gyrase subunit A. Decreases affinity between fluoroquinolone antibiotic molecule and gyrA, thereby conferring resistance to fluoroquinolone. " 2405 UPDATE Neisseria gonorrhoeae parC conferring resistance to fluoroquinolones antibiotic target alteration; fluoroquinolone resistant parC; fluoroquinolone antibiotic; ciprofloxacin; ARO_description; model_name "UPDATED ARO_description with Point mutations in Neisseria gonorrhoeae parC protein that confer resistance to fluoroquinolone by reducing affinity to antibiotic binding site. UPDATED model_name with Neisseria gonorrhoeae parC conferring resistance to fluoroquinolones " 4985 UPDATE OXA-669 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4987 UPDATE OXA-674 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4986 UPDATE OXA-670 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4989 UPDATE OXA-676 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4988 UPDATE OXA-675 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 931 UPDATE OXA-316 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-316 is a beta-lactamase found in A. baumannii. UPDATED accession with KF057033.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2158 UPDATE Escherichia coli EF-Tu mutants conferring resistance to Pulvomycin antibiotic target alteration; elfamycin antibiotic; pulvomycin; elfamycin resistant EF-Tu; ARO_description "UPDATED ARO_description with Sequence variants of Escherichia coli elongation factor Tu that confer resistance to Pulvomycin. " 936 UPDATE OKP-A-13 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-A-13 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with FJ534513.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 935 UPDATE OXA-314 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-314 is a beta-lactamase found in A. baumannii. UPDATED accession with KF057031.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 934 UPDATE IMP-8 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IMP-8 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED partial with 0 UPDATED sequence with ATGAAGAAATTATTTGTTTTATGTGTATGCTTCCTTTGTAGCATTACTGCCGCAGGAGCGGCTTTGCCTGATTTAAAAATCGAGAAGCTTGAAGAAGGTGTTTATGTTCATACATCGTTCGAAGAAGTTAACGGTTGGGGTGTTGTTTCTAAACACGGTTTGGTGGTTCTTGTAAACACTGACGCCTATCTGATTGACACTCCATTTACTGCTACAGATACTGAAAAGTTAGTCAATTGGTTTGTGGAGCGCGGCTATAAAATCAAAGGCACTATTTCCTCACATTTCCATAGCGACAGCACAGGGGGAATAGAGTGGCTTAATTCTCAATCTATTCCCACGTATGCATCTGAATTAACAAATGAACTTCTTAAAAAAGACGGTAAGGTGCAAGCTAAAAACTCATTTAGCGGAGTTAGTTATTGGCTAGTTAAAAATAAAATTGAAGTTTTTTATCCCGGCCCGGGGCACACTCAAGATAACGTAGTGGTTTGGTTACCTGAAAAGAAAATTTTATTCGGTGGTTGTTTTGTTAAACCGGACGGTCTTGGTAATTTGGGTGACGCAAATTTAGAAGCTTGGCCAAAGTCCGCCAAAATATTAATGTCTAAATATGGTAAAGCAAAACTGGTTGTTTCAAGTCATAGTGAAATTGGGGACGCATCACTCTTGAAACGTACATGGGAACAGGCTGTTAAAGGGCTAAATGAAAGTAAAAAACCATCACAGCCAAGTAACTAA UPDATED fmax with 2822 UPDATED accession with AF322577.2 UPDATED fmin with 2081 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with AAK13430.1 UPDATED sequence with MKKLFVLCVCFLCSITAAGAALPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPSQPSN UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1955 UPDATE OXA-29 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-29 is a beta-lactamase found in Legionella gormanii. UPDATED accession with AJ400619.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1954 UPDATE TEM-154 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with FJ807656.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1957 UPDATE VIM-18 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-18 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with AM778091.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1956 UPDATE IMI-1 carbapenem; antibiotic inactivation; IMI beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with IMI-1 is a beta-lactamase found in Enterobacter cloacae. UPDATED accession with U50278.1 " 1951 UPDATE TEM-76 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF190694.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1950 UPDATE arr-1 antibiotic inactivation; rifampin; rifapentine; rifabutin; rifampin ADP-ribosyltransferase (Arr); rifaximin; rifamycin antibiotic; ARO_description; model_sequences "UPDATED ARO_description with arr-1 is a chromosome-encoded ribosyltransferase found in Mycolicibacterium smegmatis. UPDATED accession with AF001493.1 " 1953 UPDATE SHV-155 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX121122.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1952 UPDATE OXA-1 penam; antibiotic inactivation; cephalosporin; carbapenem; piperacillin-tazobactam; cefalotin; amoxicillin; ampicillin; clavulanic acid; piperacillin; tazobactam; OXA beta-lactamase; amoxicillin-clavulanic acid; ARO_description; ARO_category "UPDATED ARO_description with OXA-1 is a beta-lactamase found in E. coli. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1829 UPDATE CMY-87 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with AB699171.1 " 1959 UPDATE ACT-7 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences; ARO_category "UPDATED accession with FJ237368.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1958 UPDATE VIM-33 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-33 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with JX258134.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1828 UPDATE GES-6 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with GES-6 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with AY494718.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 569 UPDATE OXA-228 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-228 is a beta-lactamase found in A. bereziniae. UPDATED accession with JQ422053.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 132 UPDATE TEM-198 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AB700703.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 905 UPDATE CTX-M-93 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-93 is a beta-lactamase found in Escherichia coli. UPDATED accession with HQ166709.1 " 1992 UPDATE dfrA1 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description "UPDATED ARO_description with dfrA1 is an integron-encoded dihydrofolate reductase. " 1825 UPDATE CTX-M-27 penam; carbapenem; antibiotic inactivation; piperacillin-tazobactam; cephalosporin; cefazolin; ceftazidime; cefalotin; amoxicillin-clavulanic acid; amoxicillin; ampicillin; clavulanic acid; piperacillin; tazobactam; cefixime; ertapenem; CTX-M beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with CTX-M-27 is a beta-lactamase found in Escherichia coli. UPDATED accession with AY156923.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 829 UPDATE DHA-17 antibiotic inactivation; cephalosporin; cephamycin; DHA beta-lactamase; model_sequences "UPDATED accession with KM087850.1 " 828 UPDATE TEM-83 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF427129.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1824 UPDATE oleI antibiotic inactivation; ole glycosyltransferase; macrolide antibiotic; oleandomycin; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGACGAGCGAGCACCGCTCTGCCTCCGTGACACCCCGTCACATCTCCTTCTTCAACATCCCCGGCCACGGCCACGTGAACCCGTCACTCGGCATCGTCCAGGAACTGGTCGCGCGCGGCCACCGGGTCAGCTACGCCATCACCGACGAGTTCGCCGCACAGGTCAAGGCGGCCGGCGCGACGCCCGTGGTGTACGACTCCATCCTGCCGAAGGAGTCCAACCCCGAGGAGTCGTGGCCGGAGGACCAGGAGTCCGCGATGGGCCTGTTCCTCGACGAAGCCGTCCGGGTCCTGCCGCAGCTGGAGGACGCCTACGCCGACGACCGGCCGGACCTGATCGTCTACGACATCGCCTCCTGGCCCGCCCCGGTGCTCGGCCGGAAGTGGGACATCCCCTTCGTCCAGCTCTCCCCGACCTTCGTCGCCTACGAGGGCTTCGAGGAGGACGTACCCGCGGTGCAGGACCCCACGGCCGACCGCGGCGAGGAGGCCGCCGCCCCCGCGGGGACCGGGGACGCCGAGGAGGGTGCCGAGGCCGAGGACGGCCTGGTGCGCTTCTTCACCCGGCTCTCGGCCTTCCTGGAGGAGCACGGGGTGGACACCCCGGCCACCGAGTTCCTCATCGCGCCCAACCGCTGCATCGTCGCGCTGCCGCGCACCTTCCAGATCAAGGGCGACACGGTCGGCGACAACTACACCTTCGTCGGTCCCACCTACGGCGACCGGTCCCACCAGGGCACCTGGGAAGGCCCCGGGGACGGGCGTCCGGTGCTGCTGATCGCCCTGGGCTCGGCGTTCACCGACCACCTCGACTTCTACCGCACCTGCCTGTCCGCCGTCGACGGCCTGGACTGGCACGTGGTGCTCTCCGTGGGCCGCTTCGTCGACCCCGCGGACCTCGGCGAGGTCCCGCCGAACGTCGAGGTGCACCAGTGGGTGCCGCAGCTCGACATCCTGACCAAAGCCTCCGCGTTCATCACGCACGCGGGCATGGGCAGCACCATGGAGGCCCTGTCGAACGCGGTGCCCATGGTCGCGGTGCCGCAGATCGCGGAGCAGACGATGAACGCCGAGCGGATCGTCGAGCTGGGCCTCGGCCGGCACATCCCGCGGGACCAGGTCACGGCCGAGAAGCTGCGCGAGGCCGTGCTCGCCGTCGCCTCCGACCCCGGTGTCGCCGAACGGCTCGCGGCCGTCCGGCAGGAGATCCGTGAGGCGGGCGGCGCCCGGGCGGCCGCCGACATCCTGGAGGGCATCCTCGCCGAAGCAGGCTGA UPDATED fmax with 1275 UPDATED accession with DQ195535.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Streptomyces antibioticus UPDATED NCBI_taxonomy_id with 1890 UPDATED NCBI_taxonomy_cvterm_id with 36823 UPDATED accession with ABA42118.2 UPDATED sequence with MTSEHRSASVTPRHISFFNIPGHGHVNPSLGIVQELVARGHRVSYAITDEFAAQVKAAGATPVVYDSILPKESNPEESWPEDQESAMGLFLDEAVRVLPQLEDAYADDRPDLIVYDIASWPAPVLGRKWDIPFVQLSPTFVAYEGFEEDVPAVQDPTADRGEEAAAPAGTGDAEEGAEAEDGLVRFFTRLSAFLEEHGVDTPATEFLIAPNRCIVALPRTFQIKGDTVGDNYTFVGPTYGDRSHQGTWEGPGDGRPVLLIALGSAFTDHLDFYRTCLSAVDGLDWHVVLSVGRFVDPADLGEVPPNVEVHQWVPQLDILTKASAFITHAGMGSTMEALSNAVPMVAVPQIAEQTMNAERIVELGLGRHIPRDQVTAEKLREAVLAVASDPGVAERLAAVRQEIREAGGARAAADILEGILAEAG " 825 UPDATE SHV-20 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF117744.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 824 UPDATE vanD glycopeptide antibiotic; glycopeptide resistance gene cluster; Van ligase; antibiotic target alteration; model_sequences; ARO_category "UPDATED accession with AY082011.1 UPDATED category_aro_name with Van ligase UPDATED category_aro_description with Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity. " 827 UPDATE QnrB55 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrB55 is a plasmid-mediated quinolone resistance protein found in Raoultella terrigena. UPDATED accession with KF730650.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 826 UPDATE TolC tetracycline; erythromycin; penem; tetracycline antibiotic; piperacillin; antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; nalidixic acid; aminocoumarin antibiotic; cephalosporin; macrolide antibiotic; carbapenem; ceftazidime; cefalotin; spectinomycin; oxacillin; ciprofloxacin; cloxacillin; gentamicin C; streptomycin; aminoglycoside antibiotic; disinfecting agents and antiseptics; polymyxin B3; polymyxin B1; glycylcycline; rifamycin antibiotic; imipenem; peptide antibiotic; rifampin; ticarcillin; ampicillin; ertapenem; penam; triclosan; novobiocin; efflux pump complex or subunit conferring antibiotic resistance; polymyxin B2; tigecycline; polymyxin B4; cephamycin; fluoroquinolone antibiotic; tobramycin; phenicol antibiotic; azithromycin; chloramphenicol; model_sequences; model_name; ARO_category "UPDATED accession with FJ768952.1 UPDATED model_name with TolC UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 821 UPDATE Mycobacterium tuberculosis embB with mutation conferring resistance to rifampicin antibiotic target alteration; rifamycin-resistant arabinosyltransferase; rifampin; rifamycin antibiotic; ARO_description; model_sequences; model_name "UPDATED ARO_description with Specific mutations that occurs on Mycobacterium tuberculosis embB causing it to be rifampicin resistant. UPDATED accession with AE000516.1 UPDATED model_name with Mycobacterium tuberculosis embB with mutation conferring resistance to rifampicin " 820 UPDATE mdtB efflux pump complex or subunit conferring antibiotic resistance; antibiotic efflux; aminocoumarin antibiotic; resistance-nodulation-cell division (RND) antibiotic efflux pump; novobiocin; model_sequences "UPDATED accession with U00096.1 " 822 UPDATE QnrD1 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrD1 is a plasmid-mediated quinolone resistance protein found in Salmonella enterica. UPDATED accession with FJ228229.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 1826 UPDATE ykkC antibiotic efflux; small multidrug resistance (SMR) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; tetracycline antibiotic; streptomycin; aminoglycoside antibiotic; phenicol antibiotic; tetracycline; chloramphenicol; ARO_description; model_sequences "UPDATED ARO_description with ykkC is an SMR-type protein that is a subunit of the ykkCD efflux pump. UPDATED accession with AL009126.1 " 1536 UPDATE OXA-421 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4258 UPDATE ADC-193 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 1821 UPDATE AAC(6')-Ir AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Ir is a chromosomal-encoded aminoglycoside acetyltransferase in Acinetobacter colistiniresistens. UPDATED accession with AF031326.1 " 618 UPDATE emeA efflux pump complex or subunit conferring antibiotic resistance; antibiotic efflux; multidrug and toxic compound extrusion (MATE) transporter; acriflavine; disinfecting agents and antiseptics; model_sequences; ARO_category "UPDATED accession with AB091338.1 UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. DELETED 36193 " 1483 UPDATE AAC(3)-Xa kanamycin A; antibiotic inactivation; AAC(3); aminoglycoside antibiotic; ARO_description "UPDATED ARO_description with AAC(3)-Xa is a chromosomal-encoded aminoglycoside acetyltransferase in Streptomyces griseus. " 1482 UPDATE SME-1 carbapenem; antibiotic inactivation; SME beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with SME-1 is a beta-lactamase found in Serratia marcescens. UPDATED accession with Z28968.1 " 1481 UPDATE OXY-1-4 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-1-4 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with AY077483.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1480 UPDATE EXO-1 penam; antibiotic inactivation; EXO beta-lactamase; ARO_description; model_sequences; model_name; ARO_category "UPDATED ARO_description with Class A beta-lactamase found in Streptomyces albus G. UPDATED accession with M28303.1 UPDATED model_name with EXO-1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1485 UPDATE MOX-8 penam; antibiotic inactivation; MOX beta-lactamase; cephamycin; cephalosporin; model_sequences; ARO_category "UPDATED accession with JX173956.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1484 UPDATE ACT-27 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; model_sequences; ARO_category "UPDATED accession with KJ207209.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3301 UPDATE LnuP antibiotic inactivation; lincosamide nucleotidyltransferase (LNU); lincosamide antibiotic; ARO_description "UPDATED ARO_description with LnuP is a lincosamide nucleotidyltransferase major efflux facilitator. " 1713 UPDATE vanYM glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanY; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanYM, is a vanY variant found in the vanM gene cluster. UPDATED accession with FJ349556.1 UPDATED model_name with vanY gene in vanM cluster UPDATED ARO_name with vanY gene in vanM cluster " 1712 UPDATE IMP-41 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences; ARO_category "UPDATED accession with AB753458.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 794 UPDATE Staphylococcus aureus rpoC conferring resistance to daptomycin peptide antibiotic; antibiotic target alteration; daptomycin-resistant beta prime subunit of RNA polymerase (rpoC); daptomycin; ARO_description "UPDATED ARO_description with Point mutations that occurs in Staphylococcus aureus rpoC resulting in resistance to daptomycin. " 793 UPDATE IMP-34 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGAGCAAGTTATCTGTATTCTTTATATTTTTGTTTTGCAGCATTGCTACCGCAGCAGAGTCTTTGCCAGATTTAAAAATTGAAAAGCTTGATGAAGGCGTTTATGTTCATACTTCGTTTGAAGAAGTTAACGGGTGGGGCGTTGTTCCTAAACATGGTTTGGTGGTTCTTGTAAATGCTGAGGCTTATTTAATTGACACTCCATTTACGGCTAAAGATACTGAAAAGTTAGTCACTTGGTTTGTGGAGCGTGGCTATAAAATAAAAGGCAGTATTTCCTCTCATTTTCATAGCGACAGCACGGGCGGAATAGGGTGGCTTAATTCTCGATCTATCCCCACGTATGCATCTGAATTAACAAATGAACTGCTTAAAAAAGACGGTAAGGTTCAAGCCACAAATTCATTTAGCGGAGTTAACTATTGGCTAGTTAAAAATAAAATTGAAGTTTTTTATCCAGGCCCGGGACACACTCCAGATAACGTAGTGGTTTGGCTGCCTGAAAGGAAAATATTATTCGGTGGTTGTTTTATTAAACCGTACGGTTTAGGCAATTTGGGTGACGCAAATATAGAAGCTTGGCCAAAGTCCGCCAAATTATTAAAGTCCAAATATGGTAAGGCAAAACTGGTTGTTCCAAGTCACAGTGAAGTTGGAGACGCATCACTCTTGAAACTTACATTAGAGCAGGCGGTTAAAGGATTAAACGAAAGTAAAAAACCATCAAAACCAAGCAACTAA UPDATED fmax with 27966 UPDATED accession with AB715422.2 UPDATED fmin with 27225 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella oxytoca UPDATED NCBI_taxonomy_id with 571 UPDATED NCBI_taxonomy_cvterm_id with 36788 UPDATED accession with BAP75826.1 UPDATED sequence with MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIGWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 792 UPDATE OXY-1-1 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-1-1 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with Z30177.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 791 UPDATE SHV-14 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF226622.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1719 UPDATE ceoA efflux pump complex or subunit conferring antibiotic resistance; fluoroquinolone antibiotic; aminoglycoside antibiotic; resistance-nodulation-cell division (RND) antibiotic efflux pump; antibiotic efflux; ARO_description; model_sequences "UPDATED ARO_description with ceoA is a periplasmic linker subunit of the CeoAB-OpcM efflux pump. UPDATED accession with U97042.1 " 799 UPDATE CTX-M-31 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-31 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with AJ567481.1 " 798 UPDATE cmeC antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; macrolide antibiotic; cefotaxime; efflux pump complex or subunit conferring antibiotic resistance; cephalosporin; fluoroquinolone antibiotic; fusidic acid; erythromycin; model_sequences "UPDATED accession with AB894099.1 " 1270 UPDATE QnrS3 sparfloxacin; norfloxacin; quinolone resistance protein (qnr); gatifloxacin; levofloxacin; antibiotic target protection; ciprofloxacin; fluoroquinolone antibiotic; nalidixic acid; moxifloxacin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with QnrS3 is a plasmid-mediated quinolone resistance protein found in Escherichia coli. UPDATED accession with EU077611.1 UPDATED category_aro_description with Qnr proteins are pentapeptide repeat proteins that mimic DNA and protect the cell from the activity of fluoroquinolone antibiotics. " 2412 UPDATE Shigella flexneri parC conferring resistance to fluoroquinolones antibiotic target alteration; fluoroquinolone resistant parC; nalidixic acid; fluoroquinolone antibiotic; norfloxacin; ARO_description "UPDATED ARO_description with Point mutation in parC conferring resistance to fluoroquinolone antibiotics in Shigella flexneri,. " 4399 UPDATE BlaB-38 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1271 UPDATE AAC(6')-Iw AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; model_sequences "UPDATED accession with AF031331.1 " 2143 UPDATE Borreliella burgdorferi 16S rRNA mutation conferring resistance to gentamicin antibiotic target alteration; gentamicin C; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description "UPDATED ARO_description with Point mutations in the 3' minor domain of the 16S rRNA gene of Borreliella burgdorferi can confer resistance to gentamicin. " 1290 UPDATE TEM-141 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY956335.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 610 UPDATE SHV-153 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX121120.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1715 UPDATE OXA-73 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-73 is a beta-lactamase found in Klebsiella pneumonia. UPDATED accession with AY762325.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2142 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to viomycin peptide antibiotic; antibiotic target alteration; 16s rRNA with mutation conferring resistance to peptide antibiotics; viomycin; model_name "UPDATED model_name with Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to viomycin " 1139 UPDATE dfrA12 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description "UPDATED ARO_description with dfrA12 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae. " 137 UPDATE APH(2'')-Ie antibiotic inactivation; kanamycin A; gentamicin B; aminoglycoside antibiotic; sisomicin; arbekacin; APH(2''); netilmicin; gentamicin C; amikacin; isepamicin; tobramycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(2'')-Ie is a plasmid or transposon-encoded aminoglycoside phosphotransferase in E. faecium and E. casseliflavus. UPDATED accession with AY939911.1 UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 2''. " 1133 UPDATE SHV-109 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with EU418913.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1995 UPDATE AAC(6')-Iz AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Iz is a chromosomal-encoded aminoglycoside acetyltransferase in S. maltophilia. UPDATED accession with AF140221.1 " 1131 UPDATE AAC(3)-Ic antibiotic inactivation; AAC(3); sisomicin; gentamicin B; gentamicin C; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(3)-Ic is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa. UPDATED accession with AJ511268.1 " 1130 UPDATE PDC-9 antibiotic inactivation; cephalosporin; carbapenem; ceftazidime; PDC beta-lactamase; monobactam; model_sequences "UPDATED accession with FJ666072.1 " 1137 UPDATE TEM-90 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF351241.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1136 UPDATE MIR-6 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; model_sequences; ARO_category "UPDATED accession with JQ664733.1 UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 1135 UPDATE Staphylococcus aureus parE conferring resistance to aminocoumarin aminocoumarin resistant parE; clorobiocin; aminocoumarin antibiotic; novobiocin; coumermycin A1; antibiotic target alteration; ARO_description "UPDATED ARO_description with Point mutation in Staphylococcus aureus parE resulting in aminocoumarin resistance. " 617 UPDATE OXA-147 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-147 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with FJ848783.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 920 UPDATE TEM-152 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with DQ834728.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2061 UPDATE VIM-7 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with VIM-7 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with AJ536835.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 922 UPDATE AAC(6')-30/AAC(6')-Ib' fusion protein AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-30/AAC(6')-Ib' is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa. UPDATED partial with 0 UPDATED sequence with ATGACATTCCTGATCCGACCCGTAGAACAAAGTGACGCTGAATCTTGGGAGCGCTTACGCAACCTTTTGTGGGAGGGCGACGACCACAAAAGCGAGATCACACAATTCTTCAACGGCGAAGTAGAAGAACCCAATGAAGTGTTGCTTGCCGTAACCGAAGAAAATGATGCAATAGCGCACATCGAGCTATCGTTGAGGTATGACATTGATGGCTTGACGGGCATCAAGACCGGTTACATCGAAGGCCTTTTTGTAGAGGAGCGGCACCGTGCCGCAGGTGTAGTCCTCAAGCTATTGCGAGCCGCAGAGTTCTGGGCAAGAGATCAAGGATGTCTGGCGTTTGCCTCAGACAGGGATGATCGTGTCATCATCTATGCTCGCTACACGGGAGCGCCACCTAACAATTCATTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGTTGCCTAA UPDATED fmax with 2913 UPDATED accession with AJ584652.2 UPDATED fmin with 1926 UPDATED strand with + UPDATED NCBI_taxonomy_name with Pseudomonas aeruginosa UPDATED NCBI_taxonomy_id with 287 UPDATED NCBI_taxonomy_cvterm_id with 36752 UPDATED accession with CAE48335.2 UPDATED sequence with MTFLIRPVEQSDAESWERLRNLLWEGDDHKSEITQFFNGEVEEPNEVLLAVTEENDAIAHIELSLRYDIDGLTGIKTGYIEGLFVEERHRAAGVVLKLLRAAEFWARDQGCLAFASDRDDRVIIYARYTGAPPNNSLGITKYSIVTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSVA " 328 UPDATE Salmonella enterica cmlA antibiotic efflux; efflux pump complex or subunit conferring antibiotic resistance; major facilitator superfamily (MFS) antibiotic efflux pump; phenicol antibiotic; chloramphenicol; ARO_description; model_sequences "UPDATED ARO_description with cmlA is a plasmid-encoded chloramphenicol exporter that is found in Salmonella typhimurium. UPDATED partial with 0 UPDATED sequence with ATGGACATGTACTTGCCAGCAGTGCCGTTTATGCCAAACGCGCTTGGTACGACAGCGAGCACAATTCAGCTTACGCTGACAACGTACTTGGTCATGATTGGTGCCGGTCAGCTCTTGTTTGGACCGCTATCGGACCGACTGGGGCGCCGCCCCGTTCTACTGGGAGGTGGCCTCGCAAACGTTGTGGCGTCAATGGGCCTCGCTCTTACGTCATCGGCTGAAGTCTTTCTGGGGCTTCGGATTCTTCAGGCTTGTGGTGCCTCGGCGTGCCTTGTTTCCACATTTGCAACAGTACGTGACATTTACGCAGGTCGCGAGGAAAGTAATGTCATTTACGGCATACTCGGATCCATGCTGGCCATGGTCCCGGCGGTAGGCCCATTGCTCGGAGCGCTCGTCGACATGTGGCTTGGGTGGCGGGCTATCTTTGCGTTTCTAGGTTTGGGCATGATCGCTGCATCTGCAGCAGCGTGGCGATTCTGGCCTGAAACCCGGGTGCAACGAGTTGCGGGCTTGCAATGGTCGCAGCTGCTACTCCCCGTTAAGTGCCTGAACTTCTGGTTGTACACGTTGTGTTACGCCGCTGGAATGGGTAGCTTCTTCGTCTTTTTCTCCATTGCGCCCGGACTAATGATGGGCAGGCAAGGTGTGTCTCAGCTTGGCTTCAGCCTGCTGTTCGCCACAGTGGCAATTGCCATGGTGTTTACGGCTCGTTTTATGGGGCGTGTGATACCCAAGTGGGGCAGCCCAAGTGTCTTGCGAATGGGAATGGGATGCCTGATAGCTGGAGCAGTATTGCTTGCCATCACCGAAATATGGGCTTTGCAGTCCGTGTTAGGCTTTATTGCTCCAATGTGGCTAGTGGGTATTGGTGTCGCCACAGCGGTATCTGTGGCGCCCAATGGCGCTCTTCGAGGATTCGACCATGTTGCTGGAACGGTCACGGCAGTCTACTTCTGCTTGGGCGGTGTACTGCTAGGAAGCATCGGAACGTTGATCATTTCGCTGTTGCCGCGCAACACGGCTTGGCCGGTTGTCGTGTACTGTTTGACCCTTGCAACAGTCGTGCTCGGTCTGTCTTGTGTTTCCCGAGTGAAGGGCTCTCGCGGCCAGGGGGAGCATGATGTGGTCGCGCTACAAAGTGCGGGAAGTACATCAAATCCCAATCGTTGA UPDATED fmax with 2858 UPDATED accession with AJ487033.2 UPDATED fmin with 1685 UPDATED strand with + UPDATED NCBI_taxonomy_name with Salmonella enterica subsp. enterica serovar Typhimurium UPDATED NCBI_taxonomy_id with 90371 UPDATED NCBI_taxonomy_cvterm_id with 35732 UPDATED accession with CAD31707.1 UPDATED sequence with MDMYLPAVPFMPNALGTTASTIQLTLTTYLVMIGAGQLLFGPLSDRLGRRPVLLGGGLANVVASMGLALTSSAEVFLGLRILQACGASACLVSTFATVRDIYAGREESNVIYGILGSMLAMVPAVGPLLGALVDMWLGWRAIFAFLGLGMIAASAAAWRFWPETRVQRVAGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFSIAPGLMMGRQGVSQLGFSLLFATVAIAMVFTARFMGRVIPKWGSPSVLRMGMGCLIAGAVLLAITEIWALQSVLGFIAPMWLVGIGVATAVSVAPNGALRGFDHVAGTVTAVYFCLGGVLLGSIGTLIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRGQGEHDVVALQSAGSTSNPNR " 923 UPDATE VIM-25 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences; ARO_category "UPDATED accession with HM750249.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3013 UPDATE ADC-68 carbapenem; antibiotic inactivation; ADC beta-lactamase with carbapenemase activity; ARO_description "UPDATED ARO_description with A class C carbapenemase and extended-spectrum beta-lactamase identified from Acinetobacter baumannii. " 3014 UPDATE IMP-55 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3015 UPDATE IMP-56 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; IMP beta-lactamase; cephamycin; ARO_description; ARO_category "UPDATED ARO_description with An IMP class B metallo-beta-lactamase enzyme identified from carbapenem-resistant Pseudomonas aeruginosa. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 519 UPDATE VIM-26 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences; ARO_category "UPDATED accession with FR748153.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 518 UPDATE vanXYN glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanXY; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanXYN, is a vanXY variant found in the vanN gene cluster. UPDATED partial with 0 UPDATED sequence with ATGCATAATTTTTATTTACAGCTTGTAAACCAACAACACCCTTGGAAATCATTTAATCATTCGCCACAGCTTGTTCAAGCGACCTATGCGGAAGAAAAGATTTTAATAGATTCCAAGGTTAACCATCAATTCAATCAGTTACTTGAAACACTACAATTAACTGATCGCATCATGATCGTTGATGGTCATCGAACGGTTGCTGAGCAAAAACATTTGTGGAACTATTCTTTAAACGCACATGGGGTGAATTATACAAAAAGTTATGTAGCATCTCCTGGCTGTAGTGAACATCATACGGGACTAGCAATTGATCTCGGTCTACGAAAGACAGAACATGATCTCATTGCGCCACGCTTCGAGGGACCAGAAGCCGAACTGTTTTTACAACATATGAAAGATTATGGATTTATTTTACGCTATCCTAAAAATAAGCAAAAAATTACAGGAATTGCTTATGAGCCTTGGCATTTTCGCTATGTAGGTACCCCTCATAGTCAAATCATCATGGACCACGGATGGACCTTAGAAGAGTATATTGAATTTTTAAAACATCAAATTGAGGCGGTCTCATGA UPDATED fmax with 2165 UPDATED accession with JF802084.2 UPDATED fmin with 1592 UPDATED strand with + UPDATED NCBI_taxonomy_name with Enterococcus faecium UPDATED NCBI_taxonomy_id with 1352 UPDATED NCBI_taxonomy_cvterm_id with 36779 UPDATED accession with AEP40501.1 UPDATED sequence with MHNFYLQLVNQQHPWKSFNHSPQLVQATYAEEKILIDSKVNHQFNQLLETLQLTDRIMIVDGHRTVAEQKHLWNYSLNAHGVNYTKSYVASPGCSEHHTGLAIDLGLRKTEHDLIAPRFEGPEAELFLQHMKDYGFILRYPKNKQKITGIAYEPWHFRYVGTPHSQIIMDHGWTLEEYIEFLKHQIEAVS UPDATED model_name with vanXY gene in vanN cluster UPDATED ARO_name with vanXY gene in vanN cluster " 2149 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to hygromycin B antibiotic target alteration; hygromycin B; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; model_name "UPDATED model_name with Mycolicibacterium smegmatis 16S rRNA (rrsA) mutation conferring resistance to hygromycin B " 1009 UPDATE IND-1 carbapenem; antibiotic inactivation; IND beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with IND-1 is a beta-lactamase found in Chryseobacterium indologenes. UPDATED accession with AF099139.1 UPDATED category_aro_description with IND beta-lactamases are class B carbapenem-hydrolyzing beta-lactamases. " 1008 UPDATE BEL-1 penam; monobactam; cephalosporin; antibiotic inactivation; BEL beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with BEL-1 is a beta-lactamase found in Pseudomonas aeruginosa. UPDATED accession with DQ089809.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1007 UPDATE OKP-A-8 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-A-8 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051147.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 510 UPDATE CTX-M-9 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-9 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with AF174129.1 " 1005 UPDATE Escherichia coli soxR with mutation conferring antibiotic resistance antibiotic target alteration; tetracycline antibiotic; antibiotic efflux; ATP-binding cassette (ABC) antibiotic efflux pump; major facilitator superfamily (MFS) antibiotic efflux pump; resistance-nodulation-cell division (RND) antibiotic efflux pump; norfloxacin; cephalosporin; cefalotin; ciprofloxacin; disinfecting agents and antiseptics; protein(s) and two-component regulatory system modulating antibiotic efflux; rifampin; ampicillin; penam; triclosan; efflux pump complex or subunit conferring antibiotic resistance; tigecycline; glycylcycline; fluoroquinolone antibiotic; chloramphenicol; phenicol antibiotic; tetracycline; rifamycin antibiotic; model_sequences; ARO_category "UPDATED accession with U00096.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. " 512 UPDATE CTX-M-82 antibiotic inactivation; cephalosporin; CTX-M beta-lactamase; ARO_description; model_sequences "UPDATED ARO_description with CTX-M-82 is a beta-lactamase found in the Enterobacteriaceae family. UPDATED accession with DQ256091.1 " 515 UPDATE mgtA antibiotic inactivation; methymycin; macrolide antibiotic; mgt macrolide glycotransferase; tylosin; azithromycin; erythromycin; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGAAGCGAAAAGAGTTGCACGAGACGTCTCGTCTCGCATACGGTCGTCGCATGACCACTCGCCCCGCGCACATCGCCATGTTCTCCATCGCCCTGCACGGCCACGTGAACCCCAGCCTGGAGGTCATCCGCGAGCTCGTCGCGCGGGGGCACCGGGTGACGTACGCGATCCCGCCGCTCCTCGCGGACAAGGTCGCCGAGGCGGGCGCCGAACCCAAGCTCTGGAACAGCACACTGCCCGGCCCCGACGCCGACCCGGAGGCCTGGGGGAGCACCCTCCTGGACAACGTGGAGCCCTTCCTCGCCGACGCGATCCAGTCGCTCCCGCAGCTCGCCCAGGCGTACGAGGGGGACGAGCCGGACCTGGTCCTGCACGACATCGCCTCCTACACCGCCCGCGTCCTGGGCCGCCGCTGGGAGGTGCCCGTGATCTCCCTGTCGCCCTGCATGGTCGCCTGGGAGGGGTACGAGCAGGAGGTCGGCGAGCCGATGTGGGAGGAGCCGCGGAAGACCGAGCGCGGGCAGGCGTACTACGCCCGCTTCCACGCCTGGCTGGAGGAGAACGGGATCACCGACCACCCCGACCCGTTCATCGGCCGCCCCGACCGCTCCCTGGTGCTGATCCCCAAGGCGCTCCAGCCCCACGCCGACCGGGTGGACGAGACGACGTACACCTTCGTCGGCGCCTGCCAGGGGGACCGCACCGCCGAGGGCGACTGGGCCCGTCCCGAGGGCGCGGAGAAGGTCGTCCTGGTCTCGCTCGGTTCGGCCTTCACCAAGCAGCCCGCGTTCTACCGGGAGTGCGTCCGGGCCTTCGGTGAGCTGCCCGGCTGGCACACCGTGCTCCAGGTCGGCCGGCACGTAGACCCGGCCGAGCTGGGCGACGTACCGGACAACGTGGAAGTCCGCACGTGGGTACCGCAGTTGGCGATCCTCCAGCAGGCCGACCTGTTCGTCACCCACGCGGGCGCGGGCGGCAGCCAGGAGGGTCTGGCCACCGCCACGCCGATGATCGCCGTACCGCAGGCCGCGGACCAGTTCGGCAACGCCGACATGCTCCAGGGCCTCGGCGTCGCCCGCACCCTCCCGACCGAGGAGGCCACCGCGAAGGCGCTGCGCACCGCCGCCCTCGCCCTGGTCGACGACCCGGAGGTGGCGGCGCGCCTGAAGGAGATCCAGGCGCGGATGGCCCAGGAGGGCGGCACCCGCCGGGCCGCCGACCTCATCGAGGCCGAACTGGCCGCCGCGCGCGGCTGA UPDATED fmax with 1257 UPDATED accession with DQ185434.2 UPDATED fmin with 0 UPDATED strand with + UPDATED NCBI_taxonomy_name with Streptomyces lividans UPDATED NCBI_taxonomy_id with 1916 UPDATED NCBI_taxonomy_cvterm_id with 39569 UPDATED accession with ABA28305.2 UPDATED sequence with MKRKELHETSRLAYGRRMTTRPAHIAMFSIALHGHVNPSLEVIRELVARGHRVTYAIPPLLADKVAEAGAEPKLWNSTLPGPDADPEAWGSTLLDNVEPFLADAIQSLPQLAQAYEGDEPDLVLHDIASYTARVLGRRWEVPVISLSPCMVAWEGYEQEVGEPMWEEPRKTERGQAYYARFHAWLEENGITDHPDPFIGRPDRSLVLIPKALQPHADRVDETTYTFVGACQGDRTAEGDWARPEGAEKVVLVSLGSAFTKQPAFYRECVRAFGELPGWHTVLQVGRHVDPAELGDVPDNVEVRTWVPQLAILQQADLFVTHAGAGGSQEGLATATPMIAVPQAADQFGNADMLQGLGVARTLPTEEATAKALRTAALALVDDPEVAARLKEIQARMAQEGGTRRAADLIEAELAAARG " 514 UPDATE LEN-10 penam; LEN beta-lactamase; antibiotic inactivation; penem; ARO_description; ARO_category "UPDATED ARO_description with LEN-10 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1001 UPDATE Staphylococcus aureus mprF with mutation conferring resistance to daptomycin peptide antibiotic; antibiotic target alteration; daptomycin; daptomycin resistant mprF; ARO_description; model_sequences; model_name "UPDATED ARO_description with Point mutations that occur within Staphylococcus aureus mprF gene resulting in resistance to daptomycin. UPDATED accession with HM140977.1 UPDATED accession with ADJ67256.1 UPDATED model_name with Staphylococcus aureus mprF with mutation conferring resistance to daptomycin " 1000 UPDATE AAC(6')-Ib-Hangzhou AAC(6'); antibiotic inactivation; aminoglycoside antibiotic; ARO_description; model_sequences "UPDATED ARO_description with AAC(6')-Ib-Hangzhou is an aminoglycoside acetyltransferase in A. baumannii. UPDATED accession with FJ503047.1 " 621 UPDATE ErmF antibiotic target alteration; virginiamycin S2; vernamycin C; pristinamycin IC; patricin B; patricin A; oleandomycin; ostreogrycin B3; macrolide antibiotic; telithromycin; tylosin; lincosamide antibiotic; dirithromycin; clarithromycin; clindamycin; dalfopristin; pristinamycin IB; quinupristin; pristinamycin IA; Erm 23S ribosomal RNA methyltransferase; virginiamycin M1; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; roxithromycin; spiramycin; azithromycin; erythromycin; model_sequences; ARO_category "UPDATED accession with M17124.1 UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 627 UPDATE Escherichia coli rpoB mutants conferring resistance to rifampicin rifampin; rifapentine; rifabutin; rifamycin-resistant beta-subunit of RNA polymerase (rpoB); antibiotic target replacement; antibiotic target alteration; rifaximin; rifamycin antibiotic; ARO_description "UPDATED ARO_description with Point mutations that occurs in Escherichia coli rpoB resulting in resistance to rifampicin. " 1222 UPDATE FosA fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; model_name "UPDATED model_name with FosA " 1221 UPDATE OXA-231 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-231 is a beta-lactamase found in A. baumannii. UPDATED partial with 0 UPDATED sequence with ATGAAAAAATTTATACTTCCTATTCTCAGCATTTCTACTCTACTTTCTGTCAGTGCATGCTCATCTATTCAAACTAAATTTGAAGACACTTTTCATACTTCTAATCAGCAACATGAAAAAGCCATTAAAAGCTATTTTGATGAAGCTCAAACACAGGGTGTAATCATTATTAAAAAGGGAAAAAATATTAGTACCTATGGTAATAACCTGACACGAGCACATACAGAATATGTCCCTGCATCAACATTTAAGATGCTAAATGCCTTAATTGGACTAGAAAATCATAAAGCTACAACAACTGAGATTTTCAAATGGGACGGTAAAAAGAGATCTTATCCCATGTGGGAAAAAGATATGACTTTAGGTGATGCCATGGCACTTTCAGCAGTTCCTGTATATCAAGAACTTGCAAGACGGACTGGCTTAGACCTAATGCAAAAAGAAGTTAAACGGGTTGGTTTTGGTAATATGAACATTGGAACACAAGTTGATAACTTCTGGTTGGTTGGCCCCCTCAAGATTACACCAATACAAGAGGTTAATTTTGCCGATGATTTTGCAAATAATCGATTACCCTTTAAATTAGAGACTCAAGAAGAAGTTAAAAAAATGCTTCTGATTAAAGAATTCAATGGTAGTAAAATTTATGCAAAAAGCGGCTGGGGAATGGCTGTAACCCCTCAAGTAGGTTGGTTAACAGGTTGGGTAGAAAAATCTAATGGAGAAAAAGTTGCCTTTTCTCTAAACATAGAAATGAAGCAAGGAATGCCTGGTTCTATTCGTAATGAAATTACTTATAAATCATTAGAGAATTTAGGGATTATATAA UPDATED fmax with 1021 UPDATED accession with JQ326200.2 UPDATED fmin with 193 UPDATED strand with + UPDATED NCBI_taxonomy_name with Acinetobacter baumannii UPDATED NCBI_taxonomy_id with 470 UPDATED NCBI_taxonomy_cvterm_id with 35507 UPDATED accession with AFG29918.1 UPDATED sequence with MKKFILPILSISTLLSVSACSSIQTKFEDTFHTSNQQHEKAIKSYFDEAQTQGVIIIKKGKNISTYGNNLTRAHTEYVPASTFKMLNALIGLENHKATTTEIFKWDGKKRSYPMWEKDMTLGDAMALSAVPVYQELARRTGLDLMQKEVKRVGFGNMNIGTQVDNFWLVGPLKITPIQEVNFADDFANNRLPFKLETQEEVKKMLLIKEFNGSKIYAKSGWGMAVTPQVGWLTGWVEKSNGEKVAFSLNIEMKQGMPGSIRNEITYKSLENLGII UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1220 UPDATE OCH-5 penam; antibiotic inactivation; penem; cephalosporin; cephamycin; monobactam; OCH beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OCH-5 beta-lactamase is an Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi. UPDATED accession with AJ295343.1 UPDATED NCBI_taxonomy_name with Brucella anthropi UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OCH beta-lactamases are Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi. " 5663 UPDATE SPU-1 carbapenem; antibiotic inactivation; SPU beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 5662 UPDATE SPS-1 SPS beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 5661 UPDATE SPR-1 carbapenem; SPR beta-lactamase; antibiotic inactivation; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 5666 UPDATE STA-1 STA beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 5664 UPDATE SRT-3 antibiotic inactivation; cephalosporin; SRT beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 5669 UPDATE TEM-99 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5668 UPDATE TEM-98 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4342 UPDATE ADC-86 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 4341 UPDATE ADC-85 antibiotic inactivation; cephalosporin; ADC beta-lactamases pending classification for carbapenemase activity; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 2886 UPDATE Haemophilus influenzae PBP3 conferring resistance to beta-lactam antibiotics penam; cephamycin; cephalosporin; Penicillin-binding protein mutations conferring resistance to beta-lactam antibiotics; antibiotic target alteration; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with Mutations in PBP transpeptidases that change the affinity for penicillin thereby conferring resistance to penicillin antibiotics. " 2884 UPDATE RSA-1 carbapenem; antibiotic inactivation; cephalosporin; RSA beta-lactamase; ARO_category "UPDATED category_aro_description with A family of class A beta-lactamase enzymes, RSA beta-lactamases show carbapenemase and cephalosporinase activity. " 2885 UPDATE RSA-2 carbapenem; antibiotic inactivation; cephalosporin; RSA beta-lactamase; ARO_category "UPDATED category_aro_description with A family of class A beta-lactamase enzymes, RSA beta-lactamases show carbapenemase and cephalosporinase activity. " 1072 UPDATE OXA-37 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-37 is a beta-lactamase found in A. baumannii. UPDATED accession with AY007784.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2888 UPDATE HERA-1 penam; HERA beta-lactamase; antibiotic inactivation; ARO_description; ARO_category "UPDATED ARO_description with A class A beta-lactamase with penicillinase activity described in Atlantibacter (Escherichia) hermannii. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2889 UPDATE TRU-1 penam; antibiotic inactivation; cephalosporin; TRU beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with A class C beta-lactamase endogenous to Aeromonas enteropelogenes (tructi). " 2 UPDATE CblA-1 antibiotic inactivation; CblA beta-lactamase; cephaloridine; cephalosporin; model_sequences "UPDATED accession with GQ343019.1 " 3879 UPDATE APH(3')-XV antibiotic inactivation; APH(3'); aminoglycoside antibiotic; G418; neomycin; ARO_category "UPDATED category_aro_description with Phosphorylation of 2-deoxystreptamine aminoglycosides on the hydroxyl group at position 3'. " 4395 UPDATE BlaB-33 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1286 UPDATE SHV-34 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY036620.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1714 UPDATE ErmW antibiotic target alteration; streptogramin antibiotic; Erm 23S ribosomal RNA methyltransferase; macrolide antibiotic; lincosamide antibiotic; model_sequences "UPDATED accession with D14532.1 " 1043 UPDATE SHV-76 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCGCCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAACAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGTGAACTCTGCGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGAAGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATCGTGGTGATTTATCTGCGGGATACCCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 891 UPDATED accession with AM176551.2 UPDATED fmin with 30 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAJ47131.2 UPDATED sequence with MRYIRLCIISLLAALPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVEDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 11 UPDATE Erm(34) antibiotic target alteration; virginiamycin S2; vernamycin C; pristinamycin IC; patricin B; patricin A; oleandomycin; ostreogrycin B3; macrolide antibiotic; telithromycin; tylosin; lincosamide antibiotic; dirithromycin; clarithromycin; clindamycin; dalfopristin; pristinamycin IB; quinupristin; pristinamycin IA; Erm 23S ribosomal RNA methyltransferase; virginiamycin M1; madumycin II; griseoviridin; lincomycin; streptogramin antibiotic; roxithromycin; spiramycin; azithromycin; erythromycin; model_sequences; ARO_category "UPDATED accession with AY234334.1 UPDATED NCBI_taxonomy_name with Alkalihalobacillus clausii UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. " 10 UPDATE CARB-5 penam; antibiotic inactivation; CARB beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with CARB-5 is a beta-lactamase found in Acinetobacter calcoaceticus. UPDATED accession with AF135373.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 13 UPDATE LRA-12 penam; antibiotic inactivation; subclass B3 LRA beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with LRA-12 is a beta-lactamase isolated from soil samples in Alaska. UPDATED accession with EU408351.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 12 UPDATE TEM-126 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AY628199.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 15 UPDATE TEM-59 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF062386.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 14 UPDATE TEM-72 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF157553.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5719 UPDATE VIM-70 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5718 UPDATE VIM-69 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5717 UPDATE VIM-68 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5716 UPDATE VIM-67 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5715 UPDATE VIM-66 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5714 UPDATE VIM-65 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5713 UPDATE VIM-64 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5712 UPDATE VIM-63 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5711 UPDATE VIM-62 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5710 UPDATE VIM-61 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1924 UPDATE vanM glycopeptide antibiotic; glycopeptide resistance gene cluster; Van ligase; antibiotic target alteration; model_sequences; ARO_category "UPDATED accession with FJ349556.1 UPDATED category_aro_name with Van ligase UPDATED category_aro_description with Van ligases synthesize alternative substrates for peptidoglycan synthesis that reduce vancomycin binding affinity. " 3904 UPDATE CMY-165 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_065862.1 " 3905 UPDATE CMY-166 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_065863.1 " 3906 UPDATE CMY-149 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_054682.1 " 3907 UPDATE CMY-139 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_048807.1 " 3900 UPDATE CMY-162 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_060523.1 " 3901 UPDATE CMY-140 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_050943.1 " 3902 UPDATE CMY-164 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_065422.1 " 3903 UPDATE CMY-161 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_057479.1 " 1927 UPDATE SHV-29 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with AF301532.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3908 UPDATE CMY-148 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_054681.1 " 3909 UPDATE CMY-163 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with NG_060564.1 " 4763 UPDATE MIR-18 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; ARO_category "UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 4765 UPDATE MIR-20 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; ARO_category "UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 4764 UPDATE MIR-19 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; ARO_category "UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 4767 UPDATE MIR-22 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; ARO_category "UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 4766 UPDATE MIR-21 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; ARO_category "UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 4768 UPDATE MIR-7 antibiotic inactivation; monobactam; cephalosporin; MIR beta-lactamase; ARO_category "UPDATED category_aro_description with MIR beta-lactamases are plasmid-mediated beta-lactamases that confer resistance to oxyimino- and alpha-methoxy beta-lactams. " 4167 UPDATE ACT-77 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4166 UPDATE ACT-76 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4165 UPDATE ACT-75 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4164 UPDATE ACT-74 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4163 UPDATE ACT-73 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4162 UPDATE ACT-72 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4161 UPDATE ACT-70 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4160 UPDATE ACT-69 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 599 UPDATE OKP-A-3 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-A-3 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AM051140.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 3604 UPDATE GOB-3 carbapenem; penam; GOB beta-lactamase; antibiotic inactivation; cephalosporin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4169 UPDATE ACT-79 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4168 UPDATE ACT-78 antibiotic inactivation; carbapenem; penam; ACT beta-lactamase; cephalosporin; cephamycin; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1073 UPDATE OKP-B-19 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-B-19 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED partial with 0 UPDATED sequence with ATGCGTTATGTTCGCCTGTGCCTTATCTCCCTGATTGCCGCCCTGCCACTGGCGGTATTCGCCAGCCCTCAGCCGCTTGAGCAGATTAAAATCAGCGAAGGTCAGCTGGCGGGCCGGGTGGGCTATGTTGAAATGGATCTGGCCAGCGGCCGCATGCTGGCCGCCTGGCGCGCCAGTGAGCGCTTTCCGCTGATGAGCACCTTTAAAGTGCTGCTCTGCGGCGCTGTGCTGGCCCGGGTGGATGCCGGCGACGAACAGCTGGATCGGCGGATCCACTACCGCCAGCAGGATCTGGTGGACTACTCCCCGGTCAGCGAAAAACACCTTGCCGACGGGATGACCGTTGGCGAACTCTGCGCCGCCGCCATCACCATGAGCGACAACACCGCCGGCAATCTGCTGTTGAAGATCGTCGGCGGCCCCGCGGGATTGACCGCTTTTCTGCGCCAGATCGGTGACAACGTCACCCGTCTTGACCGCTGGGAAACGGAACTCAATGAGGCGCTTCCCGGCGACGTGCGCGACACCACCACCCCGGCCAGCATGGCCACCACCCTGCGCAAGCTGCTAACCACCCCCTCTCTGAGCGCCCGTTCGCAGCAGCAGCTGCTGCAGTGGATGGTTGACGACCGGGTGGCCGGCCCGTTGATCCGCGCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAAACCGGGGCCGGTGAGCGGGGCTCACGCGGCATTGTCGCCCTGCTCGGCCCGGACGGCAAAGCGGAGCGTATCGTGGTGATCTATCTGCGTGATACCCCGGCGACCATGGTCGAGCGTAACCAGCAGATCGCCGGGATAGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA UPDATED fmax with 885 UPDATED accession with AM850921.2 UPDATED fmin with 24 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with CAP12359.2 UPDATED sequence with MRYVRLCLISLIAALPLAVFASPQPLEQIKISEGQLAGRVGYVEMDLASGRMLAAWRASERFPLMSTFKVLLCGAVLARVDAGDEQLDRRIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNTAGNLLLKIVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDVRDTTTPASMATTLRKLLTTPSLSARSQQQLLQWMVDDRVAGPLIRAVLPAGWFIADKTGAGERGSRGIVALLGPDGKAERIVVIYLRDTPATMVERNQQIAGIGAALIEHWQR UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 201 UPDATE OCH-3 penam; antibiotic inactivation; penem; cephalosporin; cephamycin; monobactam; OCH beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OCH-3 beta-lactamase is an Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi. UPDATED accession with AJ295341.1 UPDATED NCBI_taxonomy_name with Brucella anthropi UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OCH beta-lactamases are Ambler class C chromosomal-encoded beta-lactamases in Brucella anthropi. " 200 UPDATE LEN-14 penam; LEN beta-lactamase; antibiotic inactivation; penem; model_sequences; ARO_category "UPDATED accession with AY265889.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 203 UPDATE OXY-2-8 penam; OXY beta-lactamase; cephalosporin; antibiotic inactivation; monobactam; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXY-2-8 is a beta-lactamase found in Klebsiella oxytoca. UPDATED accession with AY055205.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 202 UPDATE SHV-101 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with EU155018.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 205 UPDATE APH(4)-Ia antibiotic inactivation; hygromycin B; aminoglycoside antibiotic; APH(4); plazomicin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with APH(4)-Ia is a plasmid-encoded aminoglycoside phosphotransferase in E. coli. UPDATED accession with V01499.1 UPDATED category_aro_description with Phosphorylation of hygromycin on the hydroxyl group at position 4. " 204 UPDATE VIM-43 penam; antibiotic inactivation; penem; carbapenem; cephalosporin; cephamycin; VIM beta-lactamase; model_sequences; ARO_category "UPDATED accession with KP096412.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 207 UPDATE GES-12 carbapenem; penam; cephalosporin; antibiotic inactivation; GES beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with GES-12 is a beta-lactamase found in Acinetobacter baumannii. UPDATED accession with FN554543.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with GES beta-lactamases or Guiana extended-spectrum beta-lactamases are related to the other plasmid-located class A beta-lactamases. " 206 UPDATE FomA fosfomycin; antibiotic inactivation; Fom phosphotransferase family; model_sequences "UPDATED accession with AB016934.1 " 209 UPDATE AAC(3)-Ib/AAC(6')-Ib'' antibiotic inactivation; AAC(3); AAC(6'); kanamycin A; gentamicin C; aminoglycoside antibiotic; tobramycin; ARO_description; model_sequences "UPDATED ARO_description with AAC(3)-Ib/AAC(6')-Ib'' is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa. UPDATED accession with AF355189.1 " 208 UPDATE CMY-105 antibiotic inactivation; CMY beta-lactamase; cephamycin; model_sequences "UPDATED accession with KJ207205.1 " 2745 UPDATE AcrAB-TolC penam; antibiotic efflux; triclosan; rifampin; resistance-nodulation-cell division (RND) antibiotic efflux pump; efflux pump complex or subunit conferring antibiotic resistance; disinfecting agents and antiseptics; tetracycline antibiotic; cephalosporin; cefalotin; tigecycline; glycylcycline; ampicillin; fluoroquinolone antibiotic; rifamycin antibiotic; phenicol antibiotic; tetracycline; chloramphenicol; model_description; ARO_category; model_name "UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. UPDATED model_name with AcrAB-TolC " 830 UPDATE SHV-157 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with JX121124.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 642 UPDATE aadA25 antibiotic inactivation; aminoglycoside antibiotic; ANT(3''); streptomycin; spectinomycin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with Streptomycin/spectinomycin resistance gene found in Pasteurella multocida isolated from bovine respiratory tract. UPDATED accession with CP003022.1 UPDATED category_aro_description with Nucleotidylylation of streptomycin at the hydroxyl group at position 3''. " 1573 UPDATE SHV-110 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with HQ877615.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 831 UPDATE OKP-B-13 penam; antibiotic inactivation; OKP beta-lactamase; cephalosporin; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OKP-B-13 is a beta-lactamase found in Klebsiella pneumoniae. UPDATED accession with AY825330.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. UPDATED category_aro_description with OKP beta-lactamases are chromosomal class A beta-lactamase that confer resistance to penicillins and early cephalosporins in Klebsiella pneumoniae. OKP beta-lactamases can be subdivided into two groups: OKP-A and OKP-B which diverge by about 4.2%. " 1572 UPDATE OXA-205 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED accession with JF800667.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 836 UPDATE TEM-68 penam; antibiotic inactivation; penem; cephalosporin; monobactam; ampicillin; TEM beta-lactamase; model_sequences; ARO_category "UPDATED accession with AJ239002.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1571 UPDATE vanSE glycopeptide antibiotic; vanS; antibiotic target alteration; glycopeptide resistance gene cluster; ARO_description; model_sequences; model_name; ARO_name "UPDATED ARO_description with Also known as vanSE, is a vanS variant found in the vanE gene cluster. UPDATED accession with FJ872411.1 UPDATED model_name with vanS gene in vanE cluster UPDATED ARO_name with vanS gene in vanE cluster " 837 UPDATE vatH dalfopristin; antibiotic inactivation; streptogramin vat acetyltransferase; virginiamycin M1; madumycin II; griseoviridin; streptogramin antibiotic; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with vatH is a plasmid-mediated acetyltransferase found in Enterococcus faecium. UPDATED partial with 0 UPDATED sequence with ATGGCAGAAAAATTAAAAGGACCCAACTCAAATGAAATGTATCCGATTGCCGGAAATAAAAGTGTTCAATTTGTTAAACCGTCATTAACAAGGCCCAATATTATAGTTGGTGAGTTCACTTATTATGATAGCAAGAACGGAGAGCTTTTTGAGGATCAAGTTCTGTATCATTATGAAATTATAGGGGATCGACTGATCATCGGGAAATTTTGTTCAATCGGTCCTGGAGTCACTTTTATTATGAATGGAGCTAATCATCGCATGGATGGCTCCACTTATCCATTTAATATCTTTGGGCATGGGTGGGAAAAGCATACACCTACACTAGATATGCTGCCTTTAAAGGGGGATACTATTGTTGGTAATGACGTATGGATTGGACTAGATGCTACAATTATGCCAGGCGTAAAAATAGGAGACGGCGCGATTATTGCAGCCAAATCTGTAGTAACAAAAGACGTTGACCCCTCCACAATTGTTGGTGGTAATCCTGCAAAACAAATAAAGAAACGATTTTCGGAGTCAAAAATTCAAGAACTATTAAAGATAAAATGGTGGGATTTTGAAGACCAGGTTATTAGCGATAATATTGATGCTATTCTAAGTTTGGATGTTGAAGCGCTTAATAATATTTCTAAAGAAAATGATTAG UPDATED fmax with 3687 UPDATED accession with GQ205627.2 UPDATED fmin with 3036 UPDATED strand with + UPDATED NCBI_taxonomy_name with Enterococcus faecium UPDATED NCBI_taxonomy_id with 1352 UPDATED NCBI_taxonomy_cvterm_id with 36779 UPDATED accession with ACX92987.1 UPDATED sequence with MAEKLKGPNSNEMYPIAGNKSVQFVKPSLTRPNIIVGEFTYYDSKNGELFEDQVLYHYEIIGDRLIIGKFCSIGPGVTFIMNGANHRMDGSTYPFNIFGHGWEKHTPTLDMLPLKGDTIVGNDVWIGLDATIMPGVKIGDGAIIAAKSVVTKDVDPSTIVGGNPAKQIKKRFSESKIQELLKIKWWDFEDQVISDNIDAILSLDVEALNNISKEND UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 2245 UPDATE vanKI glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; vanK; ARO_description; ARO_category; model_name; ARO_name "UPDATED ARO_description with Also known as vanKI, is a peptidoglycan bridge formation protein also known as FemAB that is part of the vanI glycopeptide resistance gene cluster. UPDATED category_aro_description with VanK is a member of the Fem family of enzymes that add the cross-bridge amino acids to the stem pentapeptide of cell wall precursors in Streptomyces coelicolor that confers inducible, high-level vancomycin resistance. UPDATED model_name with vanK gene in vanI cluster UPDATED ARO_name with vanK gene in vanI cluster " 1570 UPDATE OprA antibiotic efflux; tobramycin; resistance-nodulation-cell division (RND) antibiotic efflux pump; ofloxacin; norfloxacin; meropenem; macrolide antibiotic; carbapenem; efflux pump complex or subunit conferring antibiotic resistance; arbekacin; ciprofloxacin; tetracycline antibiotic; gentamicin C; amikacin; aminoglycoside antibiotic; fluoroquinolone antibiotic; tetracycline; erythromycin; model_sequences; model_name "UPDATED accession with AB639410.1 UPDATED model_name with OprA " 834 UPDATE FosA3 fosfomycin; fosfomycin thiol transferase; antibiotic inactivation; model_sequences "UPDATED accession with JF411006.1 " 998 UPDATE SHV-134 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with HM559945.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2231 UPDATE CPS-1 carbapenem; antibiotic inactivation; CPS beta-lactamase; model_sequences "UPDATED accession with KP109675.1 UPDATED accession with AJP77054.1 " 2230 UPDATE PEDO-3 carbapenem; antibiotic inactivation; subclass B1 PEDO beta-lactamase; model_sequences "UPDATED accession with KP109679.1 UPDATED accession with AJP77076.1 " 2233 UPDATE MSI-1 carbapenem; antibiotic inactivation; MSI beta-lactamase; model_sequences "UPDATED accession with KP109676.1 UPDATED accession with AJP77057.1 " 2232 UPDATE ESP-1 carbapenem; antibiotic inactivation; ESP beta-lactamase; model_sequences "UPDATED accession with KP109681.1 UPDATED accession with AJP77085.1 " 2235 UPDATE SPG-1 carbapenem; SPG beta-lactamase; antibiotic inactivation; model_sequences "UPDATED accession with KP109680.1 UPDATED accession with AJP77080.1 " 2234 UPDATE MSI-OXA MSI-OXA family beta-lactamase; carbapenem; antibiotic inactivation; model_sequences "UPDATED accession with KP109676.1 UPDATED accession with AJP77058.1 " 1576 UPDATE OXA-17 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED partial with 0 UPDATED sequence with ATGAAAACATTTGCCGCATATGTAATTATCGCGTGTCTTTCGAGTACGGCATTAGCTGGTTCAATTACAGAAAATACGTCTTGGAACAAAGAGTTCTCTGCCGAAGCCGTCAATGGTGTCTTCGTGCTTTGTAAAAGTAGCAGTAAATCCTGCGCTACCAATGACTTAGCTCGTGCATCAAAGGAATATCTTCCAGCATCAACATTTAAGATCCCCAGCGCAATTATCGGCCTAGAAACTGGTGTCATAAAGAATGAGCATCAGGTTTTCAAATGGGACGGAAAGCCAAGAGCCATGAAGCAATGGGAAAGAGACTTGACCTTAAGAGGGGCAATACAAGTTTCAGCTGTTCCCGTATTTCAACAAATCGCCAGAGAAGTTGGCGAAGTAAGAATGCAGAAATACCTTAAAAAATTTTCCTATGGCAACCAGAATATCAGTGGTGGCATTGACAAATTCTGGTTGGAAGGCCAGCTTAGAATTTCCGCAGTTAATCAAGTGGAGTTTCTAGAGTCTCTATATTTAAATAAATTGTCAGCATCTAAAGAAAACCAGCTAATAGTAAAAGAGGCTTTGGTAACGGAGGCGGCACCTGAATATCTAGTGCATTCAAAAACTGGTTTTTCTGGTGTGGGAACTGAGTCAAATCCTGGTGTCGCATGGTGGGTTGGGTGGGTTGAGAAGGAGACAGAGGTTTACTTTTTCGCCTTTAACATGGATATAGACAACGAAAGTAAGTTGCCGCTAAGAAAATCCATTCCCACCAAAATCATGGAAAGTGAGGGCATCATTGGTGGCTAA UPDATED fmax with 3517 UPDATED accession with DQ902344.1 UPDATED fmin with 2716 UPDATED strand with + UPDATED NCBI_taxonomy_name with Klebsiella pneumoniae UPDATED NCBI_taxonomy_id with 573 UPDATED NCBI_taxonomy_cvterm_id with 35915 UPDATED accession with ABI63579.1 UPDATED sequence with MKTFAAYVIIACLSSTALAGSITENTSWNKEFSAEAVNGVFVLCKSSSKSCATNDLARASKEYLPASTFKIPSAIIGLETGVIKNEHQVFKWDGKPRAMKQWERDLTLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGIDKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQLIVKEALVTEAAPEYLVHSKTGFSGVGTESNPGVAWWVGWVEKETEVYFFAFNMDIDNESKLPLRKSIPTKIMESEGIIGG UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3575 UPDATE CME-1 penam; antibiotic inactivation; CME beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1575 UPDATE OXA-91 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_description; model_sequences; ARO_category "UPDATED ARO_description with OXA-91 is a beta-lactamase found in A. baumannii. UPDATED accession with DQ519086.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3574 UPDATE CKO-1 CKO beta-lactamase; penam; antibiotic inactivation; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1574 UPDATE Mycobacterium tuberculosis inhA mutations conferring resistance to isoniazid isoniazid; antibiotic target alteration; isoniazid resistant inhA; model_sequences; ARO_category "UPDATED accession with AL123456.1 UPDATED category_aro_description with Genes with mutations in inhA which confer resistance to isoniazid class antibiotics. " 1711 UPDATE AQU-1 antibiotic inactivation; AQU beta-lactamase; cephalosporin; ARO_description; model_sequences "UPDATED ARO_description with AQU-1 is a chromosomal class C beta-lactamase found in clinical Aeromonas dhakensis isolates. UPDATED accession with AB765395.1 " 3577 UPDATE CMY-132 antibiotic inactivation; CMY beta-lactamase; cephamycin; ARO_description "UPDATED ARO_description with From Lahey's list of beta-lactamases, no additional information available. " 2185 UPDATE glycopeptide resistance gene cluster VanM glycopeptide antibiotic; glycopeptide resistance gene cluster; antibiotic target alteration; ARO_description "UPDATED ARO_description with Homologous to vanA, contains a D-Ala-D-Lac ligase. The plasmid-located vanM gene cluster is inducible and confers high resistance to vancomycin and teicoplanin. Gene orientation: RSYHMX. " 3498 UPDATE OXA-414 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3499 UPDATE OXA-416 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3496 UPDATE OXA-412 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3497 UPDATE OXA-413 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3494 UPDATE OXA-409 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3495 UPDATE OXA-411 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3492 UPDATE OXA-407 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3493 UPDATE OXA-408 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3490 UPDATE OXA-405 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3491 UPDATE OXA-406 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3658 UPDATE NDM-16 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with New Delhi class B metallo-beta-lactamase-16 variant of NDM-1. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 3659 UPDATE NDM-18 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with A class B New Delhi metallo-beta-lactamase and NDM-1 variant. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4607 UPDATE FOX-17 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; ARO_category "UPDATED category_aro_description with FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins. " 3656 UPDATE Burkholderia dolosa gyrA conferring resistance to fluoroquinolones antibiotic target alteration; fluoroquinolone antibiotic; fluoroquinolone resistant gyrA; ciprofloxacin; model_sequences "UPDATED partial with 0 UPDATED sequence with ATGGATCAATTCGCCAAAGAGACCCTGCCCACCTCCCTCGAGGAGGAAATGCGCCGTTCGTATCTCGATTACGCGATGAGCGTGATCGTCGGACGTGCCCTTCCGGATGTCCGCGATGGCCTGAAGCCCGTGCACCGGCGCGTACTGTTCGCGATGCACGAACTGAACAACGACTGGAACCGCGCGTACAAGAAATCGGCGCGTATCGTCGGCGACGTGATCGGTAAGTACCACCCGCACGGCGACACGGCGGTCTACGACACGATCGTGCGGATGGCGCAGGACTTCTCGCTGCGCTACATGCTGATCGACGGGCAGGGCAACTTCGGCTCGATCGACGGCGACAATGCGGCGGCGATGCGGTACACCGAAATTCGCATGGCGAAGATCGGGCACGAGCTGCTCGCCGACATCGACAAGGAAACGGTCGATTTCGAGCCGAACTACGACGGCAACGAAACGCAGCCGTCGGTCCTGCCGTCGCGGATCCCGAACCTGCTGATCAACGGCTCGTCGGGCATCGCCGTCGGCATGGCGACCAACATTCCGCCGCACAACCTGAACGAAGTCGTCGACGCGTGCCAGCACCTGCTGAGCAACCCCGACGCGACGGTCGACGAACTGATCGAGATCATCCCGGCGCCGGATTTCCCGACGGCCGGCATCATCTACGGCGTCGCCGGCGTGCGCGACGGCTACCGCACCGGCCGCGGCCGCGTCGTGATGCGCGCGGCCACGCACTTCGAGGAGATCGACCGCGGCCAGCGGATGGCGATCATCGTCGACGAGCTGCCGTACCAGGTCAACAAGCGCTCGCTGCTCGAGCGGATCGCCGAGCTCGTCAACGAGAAGAAGCTCGAAGGCATTTCCGATATCCGCGACGAATCCGACAAGAGCGGCATGCGGGTCGTGATCGAGCTCAAGCGCGGCGAAGTGCCGGAAGTGGTGCTGAACAACCTGTACAAGGCGACGCAGCTGCAGGACACGTTCGGCATGAACATGGTCGCGCTCGTCGACGGCCAGCCGAAGCTGCTGAACCTGAAGGAAATCCTGCAGTGCTTCCTGTCGCACCGGCGCGAAGTGCTGACGCGCCGCACGATCTACGAACTGCGCAAGGCGCGCGAGCGCGGCCACGTGCTCGAAGGTCTCGCGGTCGCGCTCGCGAACATCGACGAGTTCATCGCGATCATCAAGGCCGCGCCGACGCCGCCGATCGCGAAGCAGGAGCTGATGACGAAGTCGTGGGATTCGTCGCTCGTACGCGAGATGCTGACGCGCGCCGAATCCGAGAACGCGGCGGCGGGCGGCCGTGCCGCGTACCGTCCGGAAGGGCTGAATCCGGCGTACGGGATGCAGGCCGACGGGCTGTACAGGTTGTCCGACACGCAGGCGCAGGAAATCCTGCAGATGCGTCTGCAGCGCCTGACCGGCCTCGAGCAGGACAAGATCATCGGCGAGTATCGCGAAGTGATGGCGCAGATCGCCGATCTGCTCGACATCCTCGCGCGCCCGGAGCGCATCACGACGATGATCGGCGACGAGCTGACGACGGTGAAGGCCGAATTCGGCGATGCGCGCCGCTCGCGGATCGAGCTGAACGCGACCGAACTGAATACCGAAGACCTGATCACGCCGCAGGACATGGTCGTCACGATGTCGCATGCCGGCTACGTGAAGTCGCAGCCGCTGTCGGAGTACCGCGCGCAGAAGCGCGGCGGCCGCGGCAAGCAGGCGACGCAGATGAAGGAAGACGACTGGATCGAGACGCTCTTCATCGCGAATACGCACGACTACATGCTGTGCTTCTCGAACCGCGGTCGCGTGTACTGGATCAAGGTCTACGAGGTGCCGCAAGGTTCGCGCAACTCGCGCGGCCGTCCGATCGTCAACATGTTCCCGCTGCAGGAAGGCGAGAAGATCAACGTCGTGCTGCCGGTGAAGGAATTCTCGGCCGACAAGTTCGTGTTCATGGCGACGTCGCTCGGCACGGTCAAGAAGACGCCGCTCGAAGCGTTCAGCCGTCCGATGAAGAAGGGCATCATCGCGGTCGGCCTCGACGAGGGCGACTATCTGATCGGCGCGTCGATCACCGACGGCGCGCACGACGTGATGCTGTTCTCCGATTCGGGCAAGGCCGTGCGCTTCGACGAGAACGACGTGCGTCCGATGGGCCGCGAAGCGCGCGGCGTGCGCGGCATGCAGCTCGAGGACGGGCAGCAGGTCATCGCGCTGCTGGTCGCGGGCAGCGAGGAGCAGTCCGTGCTCACCGCAACCGAGAACGGCTTCGGCAAGCGTACGCCGATCACCGAGTACACGCGTCACGGCCGCGGCACGAAGGGTATGATCGCGATCCAGACCTCCGAGCGTAACGGCAAGGTCGTCGCTGCGACGCTCGTCGATCCGGAAGATCAGATCATGCTGATCACGACGGCCGGCGTGTTGATTCGCACGCGCGTTTCCGAGATCCGCGAGATGGGACGGGCGACGCAAGGTGTTACACTCATCAGTCTCGATGAGGGTACGAAGCTTTCGGGTCTGCAGCAGATTGCCGAGGCCGAAGAGGGCGATGGCGAAGCCGACGAGGCGTCGGACGGCGAAGCCTGA UPDATED fmax with 2301346 UPDATED accession with CP009795.1 UPDATED fmin with 2298742 UPDATED strand with - UPDATED NCBI_taxonomy_name with Burkholderia dolosa AU0158 UPDATED NCBI_taxonomy_id with 350701 UPDATED NCBI_taxonomy_cvterm_id with 42997 UPDATED accession with AJY14066.1 UPDATED sequence with MDQFAKETLPTSLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHELNNDWNRAYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRYMLIDGQGNFGSIDGDNAAAMRYTEIRMAKIGHELLADIDKETVDFEPNYDGNETQPSVLPSRIPNLLINGSSGIAVGMATNIPPHNLNEVVDACQHLLSNPDATVDELIEIIPAPDFPTAGIIYGVAGVRDGYRTGRGRVVMRAATHFEEIDRGQRMAIIVDELPYQVNKRSLLERIAELVNEKKLEGISDIRDESDKSGMRVVIELKRGEVPEVVLNNLYKATQLQDTFGMNMVALVDGQPKLLNLKEILQCFLSHRREVLTRRTIYELRKARERGHVLEGLAVALANIDEFIAIIKAAPTPPIAKQELMTKSWDSSLVREMLTRAESENAAAGGRAAYRPEGLNPAYGMQADGLYRLSDTQAQEILQMRLQRLTGLEQDKIIGEYREVMAQIADLLDILARPERITTMIGDELTTVKAEFGDARRSRIELNATELNTEDLITPQDMVVTMSHAGYVKSQPLSEYRAQKRGGRGKQATQMKEDDWIETLFIANTHDYMLCFSNRGRVYWIKVYEVPQGSRNSRGRPIVNMFPLQEGEKINVVLPVKEFSADKFVFMATSLGTVKKTPLEAFSRPMKKGIIAVGLDEGDYLIGASITDGAHDVMLFSDSGKAVRFDENDVRPMGREARGVRGMQLEDGQQVIALLVAGSEEQSVLTATENGFGKRTPITEYTRHGRGTKGMIAIQTSERNGKVVAATLVDPEDQIMLITTAGVLIRTRVSEIREMGRATQGVTLISLDEGTKLSGLQQIAEAEEGDGEADEASDGEA " 3657 UPDATE NDM-15 antibiotic inactivation; penam; carbapenem; cephalosporin; cephamycin; NDM beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with New Delhi metallo-beta-lactamase-15 variant of NDM-1. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2099 UPDATE Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to kanamycin A kanamycin A; antibiotic target alteration; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description; model_name "UPDATED ARO_description with Point mutations in the helix 44 region of the 16S rRNA rrsB gene of Mycolicibacterium smegmatis can confer resistance to kanamycin A. UPDATED model_name with Mycolicibacterium smegmatis 16S rRNA (rrsB) mutation conferring resistance to kanamycin A " 3652 UPDATE CMY-136 antibiotic inactivation; cefotaxime; cephalosporin; cephamycin; cefuroxime; CMY beta-lactamase; ceftolozane; ARO_category "UPDATED category_aro_description with A fifth generation cephalosporin antibiotic. " 3653 UPDATE SCO-1 penam; cefalotin; antibiotic inactivation; penicillin; penem; piperacillin-tazobactam; cephalosporin; cefotaxime; ceftazidime; cefepime; SCO beta-lactamase; ticarcillin; ticarcillin-clavulanic acid; amoxicillin; cefuroxime; clavulanic acid; piperacillin; tazobactam; amoxicillin-clavulanic acid; ARO_description; ARO_category "UPDATED ARO_description with Narrow-spectrum beta-lactamase isolated from several Acinetobacter spp. isolates from Argentina, as well as E. Coli. Hydrolyzes penicillins at a high level and cephalosporins and carbapenems at a very low level. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2526 UPDATE vgbC virginiamycin S2; pristinamycin IB; quinupristin; pristinamycin IC; patricin B; patricin A; ostreogrycin B3; vernamycin C; pristinamycin IA; antibiotic inactivation; streptogramin antibiotic; streptogramin vgb lyase; ARO_category; model_name "UPDATED category_aro_name with pristinamycin IC UPDATED category_aro_description with Pristinamycin IC is a class B streptogramin derived from virginiamycin S1. UPDATED category_aro_description with Pristinamycin IA is a type B streptogramin antibiotic produced by Streptomyces pristinaespiralis. It binds to the P site of the 50S subunit of the bacterial ribosome, preventing the extension of protein chains. UPDATED model_name with vgbC " 2520 UPDATE CatU antibiotic inactivation; thiamphenicol; chloramphenicol acetyltransferase (CAT); azidamfenicol; phenicol antibiotic; chloramphenicol; ARO_category "UPDATED category_aro_description with Inactivates chloramphenicol by addition of an acyl group. CAT is used to describe many variants of the chloramphenicol acetyltransferase gene in a range of organisms including Acinetobacter calcoaceticus, Agrobacterium tumefaciens, Alkalihalobacillus clausii, Bacillus subtilis, Campylobacter coli, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Listeria monocytogenes, Listonella anguillarum, Morganella morganii, Photobacterium damselae subsp. piscicida, Proteus mirabilis, Salmonella typhi, Serratia marcescens, Shigella flexneri, Staphylococcus aureus, Staphylococcus haemolyticus, Staphylococcus intermedius, Streptococcus agalactiae, Streptococcus suis and Streptomyces acrimycini. " 2523 UPDATE VatI dalfopristin; antibiotic inactivation; streptogramin vat acetyltransferase; virginiamycin M1; madumycin II; griseoviridin; streptogramin antibiotic; ARO_category "UPDATED category_aro_name with virginiamycin M1 UPDATED category_aro_description with Virginiamycin M1 is a streptogramin A antibiotic. " 4602 UPDATE FOX-12 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; ARO_category "UPDATED category_aro_description with FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins. " 2529 UPDATE cpaA antibiotic inactivation; capreomycin; aminoglycoside antibiotic; cpa acetyltransferase; ARO_category "UPDATED category_aro_description with Acetyltransferases of the cpa family confer resistance to capreomycin, an aminoglycoside antibiotic. " 4603 UPDATE FOX-13 antibiotic inactivation; cephamycin; cephalosporin; FOX beta-lactamase; ARO_category "UPDATED category_aro_description with FOX beta-lactamases are plasmid-encoded AmpC-type beta-lactamase which conferred resistance to broad-spectrum cephalosporins and cephamycins. " 4600 UPDATE EVM-1 carbapenem; antibiotic inactivation; EVM beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 2666 UPDATE Escherichia coli fabI mutations conferring resistance to isoniazid and triclosan isoniazid; antibiotic target alteration; triclosan; disinfecting agents and antiseptics; antibiotic resistant fabI; ARO_description; ARO_category; model_name "UPDATED ARO_description with fabI is a enoyl-acyl carrier reductase used in lipid metabolism and fatty acid biosynthesis. The bacterial biocide Triclosan blocks the final reduction step in fatty acid elongation, inhibiting biosynthesis. Point mutations in fabI can confer resistance to Triclosan and Isoniazid. UPDATED category_aro_class_name with Antibiotic UPDATED category_aro_name with disinfecting agents and antiseptics UPDATED category_aro_cvterm_id with 43746 UPDATED category_aro_accession with 3005386 UPDATED category_aro_class_name with Drug Class UPDATED category_aro_description with Disinfectants that can also interact with antimicrobial resistance mechanisms, e.g. molecule efflux, and thus are the targets of disinfectant resistance. UPDATED model_name with Escherichia coli fabI mutations conferring resistance to isoniazid and triclosan " 4601 UPDATE FIA-1 carbapenem; antibiotic inactivation; FIA beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 598 UPDATE dfrA16 trimethoprim; diaminopyrimidine antibiotic; trimethoprim resistant dihydrofolate reductase dfr; antibiotic target replacement; ARO_description; model_sequences "UPDATED ARO_description with dfrA16 is an integron-encoded dihydrofolate reductase found in Salmonella enterica. UPDATED partial with 0 UPDATED sequence with GTGAAGTTATCACTAATGGCTGCCAAGTCGAAGAACGGTATTATCGGTAATGGACCAGATATTCCATGGAGCGCCAAAGGCGAGCAACTTCTATTTAAGGCAATTACATATAATCAATGGCTTTTAGTTGGACGCAAAACTTTTGAGTCAATGGGCGCTCTCCCAAATCGAAAGTATGCAGTTGTAACTCGCTCTAATTTTTCTACGAATGATGAGGGTGTAATGGTTTTCTCCTCAATTCAGGATGCCTTAATAAATTTAGAGGAAATCACGGATCATGTTATCGTTTCTGGTGGTGGTGAAATATACAAAAGCTTGATTTCCAAAGTAGATACTTTGCATATTTCAACAGTCGACATCGAGCGAGATGGAGACATAGTTTTTCCTGAAATCCCAGATACATTCAAGTTGGTATTTGAGCAAGATTTCGAGTCTAACATTAACTATTGTTATCAAATCTGGCAAAAGAGTTAA UPDATED fmax with 1825 UPDATED accession with AF174129.3 UPDATED fmin with 1351 UPDATED strand with + UPDATED NCBI_taxonomy_name with Escherichia coli UPDATED NCBI_taxonomy_id with 562 UPDATED NCBI_taxonomy_cvterm_id with 35914 UPDATED accession with AAK60186.1 UPDATED sequence with MKLSLMAAKSKNGIIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSNFSTNDEGVMVFSSIQDALINLEEITDHVIVSGGGEIYKSLISKVDTLHISTVDIERDGDIVFPEIPDTFKLVFEQDFESNINYCYQIWQKS " 5065 UPDATE OXA-756 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5064 UPDATE OXA-755 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5067 UPDATE OXA-758 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5066 UPDATE OXA-757 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5061 UPDATE OXA-752 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5060 UPDATE OXA-751 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5063 UPDATE OXA-754 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5062 UPDATE OXA-753 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4880 UPDATE OXA-551 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 2704 UPDATE MexEF-OprN with MexT mutation conferring resistance to chloramphenicol, ciprofloxacin, and trimethoprim antibiotic efflux; resistance-nodulation-cell division (RND) antibiotic efflux pump; trimethoprim; efflux pump complex or subunit conferring antibiotic resistance; diaminopyrimidine antibiotic; ciprofloxacin; fluoroquinolone antibiotic; phenicol antibiotic; chloramphenicol; ARO_description; model_description "UPDATED ARO_description with The MexEF–OprN efflux pump in P. aeruginosa is overexpressed with MexT mutation conferring resistance to chloramphenicol and ciprofloxacin. UPDATED model_description with A meta-model used to detect an efflux pump (and its subunits) along with its regulators and any determinants of overexpression (e.g., mutations in efflux pump subunits, mutations in local and global regulators, mutations in two component regulatory systems). " 4882 UPDATE OXA-553 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 5069 UPDATE OXA-760 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4885 UPDATE OXA-556 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4886 UPDATE OXA-557 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4887 UPDATE OXA-558 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1070 UPDATE sul1 sulfadiazine; sulfadoxine; sulfacetamide; sulfadimidine; mafenide; sulfamethoxazole; sulfisoxazole; sulfonamide resistant sul; antibiotic target replacement; sulfamethizole; sulfasalazine; sulfonamide antibiotic; model_sequences "UPDATED accession with JF969163.1 " 4090 UPDATE KPC-26 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_description; ARO_category "UPDATED ARO_description with Carbapenem-hydrolyzing class A beta-lactamase kpc-26 [Klebsiella pneumoniae] Accession: WP_068981634.1. UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4719 UPDATE KPC-21 antibiotic inactivation; penam; carbapenem; cephalosporin; monobactam; KPC beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4408 UPDATE CAR-1 carbapenem; antibiotic inactivation; CAR beta-lactamase; model_sequences "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance " 4409 UPDATE CARB-11 penam; antibiotic inactivation; CARB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4404 UPDATE BlaB-8 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4405 UPDATE BlaB-9 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 1827 UPDATE SHV-5 carbapenem; penam; cephalosporin; antibiotic inactivation; SHV beta-lactamase; model_sequences; ARO_category "UPDATED accession with X55640.1 UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4400 UPDATE BlaB-39 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4401 UPDATE BlaB-5 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4402 UPDATE BlaB-6 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; model_sequences; ARO_category "UPDATED NCBI_taxonomy_name with Bacteria, Viruses, Fungi, and other genome sequence associated with antimicrobial resistance UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 4403 UPDATE BlaB-7 carbapenem; penam; antibiotic inactivation; BlaB beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases such as syphilis and Staphylococcus infections. Penicillins are still widely used today, though many types of bacteria are now resistant. All penicillins are beta-lactam antibiotics in the penam sub-group, and are used in the treatment of bacterial infections caused by susceptible, usually Gram-positive, organisms. " 928 UPDATE carA pleuromutilin antibiotic; macrolide antibiotic; ABC-F ATP-binding cassette ribosomal protection protein; antibiotic target protection; oxazolidinone antibiotic; tetracycline antibiotic; streptogramin antibiotic; phenicol antibiotic; lincosamide antibiotic; ARO_description; model_sequences "UPDATED ARO_description with carA is an ABC-F subfamily protein involved in macrolide resistance. It is found in Streptomyces thermotolerans. UPDATED accession with M80346.1 " 2146 UPDATE Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to streptomycin antibiotic target alteration; streptomycin; aminoglycoside antibiotic; 16s rRNA with mutation conferring resistance to aminoglycoside antibiotics; ARO_description; model_sequences; model_name "UPDATED ARO_description with Point mutations in the 5' domain of helix 18, in the rrnB 16S rRNA gene of Escherichia coli can confer resistance to streptomycin. UPDATED accession with U00096.1 UPDATED NCBI_taxonomy_name with Escherichia coli str. K-12 UPDATED model_name with Escherichia coli 16S rRNA (rrnB) mutation conferring resistance to streptomycin " 2145 UPDATE Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to tetracycline tetracycline antibiotic; antibiotic target alteration; 16S rRNA with mutation conferring resistance to tetracycline derivatives; tetracycline; ARO_description; model_sequences; model_name "UPDATED ARO_description with Point mutations in the 3' major domain of the rrsB 16S rRNA gene of Escherichia coli can confer resistance to tetracycline. UPDATED accession with U00096.1 UPDATED NCBI_taxonomy_name with Escherichia coli str. K-12 UPDATED model_name with Escherichia coli 16S rRNA (rrsB) mutation conferring resistance to tetracycline " 2144 UPDATE Mycobacterium tuberculosis variant bovis embB with mutation conferring resistance to ethambutol antibiotic target alteration; polyamine antibiotic; ethambutol; ethambutol resistant embB; ARO_description; model_sequences; model_name "UPDATED ARO_description with Point mutations that occur within Mycobacterium tuberculosis variant bovis embB gene resulting in resistance to ethambutol. UPDATED accession with BX248333.1 UPDATED model_name with Mycobacterium tuberculosis variant bovis embB with mutation conferring resistance to ethambutol " 4978 UPDATE OXA-658 carbapenem; penam; cephalosporin; antibiotic inactivation; OXA beta-lactamase; ARO_category "UPDATED category_aro_description with Penams are a group of antibiotics derived from Penicillium fungi that share a skeleton beta-lactam moiety fused with a thiazolidine ring. This is the most defining feature of penicillins. Penicillin antibiotics are historically significant because they are the first drugs that were effective against many previously serious diseases suc